Patent application title: DEVICES, SYSTEMS AND METHODS FOR OPTOGENETIC MODULATION OF ACTION POTENTIALS IN TARGET CELLS
Inventors:
IPC8 Class: AA61K4100FI
USPC Class:
1 1
Class name:
Publication date: 2019-05-02
Patent application number: 20190125871
Abstract:
Aspects of the disclosure include devices, systems and methods for
optogenetic modulation of action potentials in target cells. The subject
devices include light-generating devices, control devices, and delivery
devices for delivering vectors to target cells. The subject systems
include light-activated proteins, response proteins, nucleic acids
comprising nucleotide sequences encoding these proteins, as well as
expression systems that facilitate expression of these proteins in target
cells. Also provided are methods of using the subject devices and systems
to optogenetically inhibit and intercept action potentials in target
cells, e.g., to treat a neurological or psychiatric condition in a human
or non-human animal subject.Claims:
1. A system for modulating the membrane potential of a cell, the system
comprising: a first nucleic acid comprising a nucleotide sequence
encoding a light-activated protein that is adapted to allow a first ion
to pass through a cell membrane in response to light; a second nucleic
acid comprising a nucleotide sequence encoding a response protein that
responds to the passage of the first ion through the cell membrane by
allowing a second ion to pass through the cell membrane; and a device
configured to illuminate a target location with a light.
2. The system according to claim 1, wherein the light-activated protein is an ion pump.
3. The system according to claim 2, wherein the ion pump is a hydrogen ion pump, a sodium ion pump, a potassium ion pump, a chloride ion pump, or a calcium ion pump.
4. The system according to claim 1, wherein the light-activated protein is an ion channel.
5. The system according to claim 4, wherein the ion channel is a hydrogen ion channel, a sodium ion channel, a potassium ion channel, a chloride ion channel, or a calcium ion channel.
6. The system according to claim 1, wherein the response protein is an ion pump.
7. The system according to claim 6, wherein the ion pump is a hydrogen ion pump, a sodium ion pump, a potassium ion pump, a chloride ion pump, or a calcium ion pump.
8. The system according to claim 1, wherein the response protein is an ion channel, an ion exchange protein, or an ion co-transporter.
9. The system according to claim 8, wherein the ion channel is a hydrogen ion channel, a sodium ion channel, a potassium ion channel, a chloride ion channel, a calcium ion channel, or a cation channel.
10. The system according to claim 1, wherein the device is configured to illuminate the target location with light having a wavelength ranging from about 350 to about 750 nm.
11. The system according to claim 10, wherein the device is configured to illuminate the target location with light having a wavelength ranging from about 530 up to about 560 nm.
12. The system according to claim 1, wherein the device is configured to constantly illuminate the target location with a light.
13. The system according to claim 1, wherein the device is configured to illuminate the target location with pulses of light.
14. The system according to claim 12 or 13, wherein the device is configured to modulate the wavelength and/or the intensity of the light.
15. The system according to claim 13, wherein the device is configured to modulate the frequency and/or the duration of the pulses of light.
16. The system according to 12 or 13, wherein the device is configured to illuminate the target location in response to a user input.
17. The system according to 16, wherein the user input comprises: the wavelength of light, the intensity of light, the duration of a light pulse, the frequency of a light pulse, and/or the target location.
18. The system according to claim 1, wherein the device is adapted to be implanted in a subject.
19. The system according to claim 1, wherein the target location is: a cell, a portion of a cell, a plurality of cells, a bundle of nerve fibers, a neuromuscular junction, a central nervous system (CNS) tissue, a peripheral nervous system (PNS) tissue, or an anatomical region.
20. The system according to claim 1, wherein the first nucleic acid and the second nucleic acid are present within a single expression vector.
21. The system according to claim 1, wherein the nucleotide sequence encoding a light-activated protein that is adapted to allow a first ion to pass through a cell membrane in response to light is operably linked to a neuron-specific transcription control element.
22. The system according to claim 1, wherein the second nucleic acid comprising a nucleotide sequence encoding a response protein that responds to the passage of the first ion through the cell membrane by allowing a second ion to pass through the cell membrane is operably linked to a neuron-specific transcription control element.
23. A pharmaceutical composition comprising: a first nucleic acid comprising a nucleotide sequence encoding a light-activated protein that is adapted to allow a first ion to pass through a cell membrane in response to light; a second nucleic acid comprising a nucleotide sequence encoding a response protein that responds to the passage of the first ion through the cell membrane by allowing a second ion to pass through the cell membrane.
24. The composition according to claim 23, wherein the light-activated protein is an ion pump.
25. The composition according to claim 24, wherein the ion pump is a hydrogen ion pump, a sodium ion pump, a potassium ion pump, a chloride ion pump, or a calcium ion pump.
26. The composition according to claim 21, wherein the light-activated protein is an ion channel.
27. The composition according to claim 26, wherein the ion channel is a hydrogen ion channel, a sodium ion channel, a potassium ion channel, a chloride ion channel, or a calcium ion channel.
28. The composition according to claim 23, wherein the response protein is an ion pump.
29. The composition according to claim 28, wherein the ion pump is a hydrogen ion pump, a sodium ion pump, a potassium ion pump, a chloride ion pump, or a calcium ion pump.
30. The composition according to claim 23, wherein the response protein is an ion channel, an ion-exchange protein, or an ion co-transporter.
31. The composition according to claim 30, wherein the ion channel is a hydrogen ion channel, a sodium ion channel, a potassium ion channel, a chloride ion channel, a calcium ion channel, or a cation channel.
32. The composition according to claim 23, wherein the first nucleic acid and the second nucleic acid are present within a single expression vector.
33. The composition according to claim 23, wherein the nucleotide sequence encoding a light-activated protein that is adapted to allow a first ion to pass through a cell membrane in response to light is operably linked to a neuron-specific transcription control element.
34. The composition according to claim 23, wherein the second nucleic acid comprising a nucleotide sequence encoding a response protein that responds to the passage of the first ion through the cell membrane by allowing a second ion to pass through the cell membrane is operably linked to a neuron-specific transcription control element.
35. A cell comprising: a first nucleic acid comprising a nucleotide sequence encoding a light-activated protein that is adapted to allow a first ion to pass through a cell membrane in response to light; a second nucleic acid comprising a nucleotide sequence encoding a response protein that responds to the passage of the first ion through the cell membrane by allowing a second ion to pass through the cell membrane.
36. The cell according to claim 35, wherein the light-activated protein is an ion pump.
37. The cell according to claim 36, wherein the ion pump is a hydrogen ion pump, a sodium ion pump, a potassium ion pump, a chloride ion pump, or a calcium ion pump.
38. The cell according to claim 35, wherein the light-activated protein is an ion channel.
39. The cell according to claim 38, wherein the ion channel is a hydrogen ion channel, a sodium ion channel, a potassium ion channel, a chloride ion channel, or a calcium ion channel.
40. The cell according to claim 35, wherein the response protein is an ion pump.
41. The cell according to claim 40, wherein the ion pump is a hydrogen ion pump, a sodium ion pump, a potassium ion pump, a chloride ion pump, or a calcium ion pump.
42. The cell according to claim 35, wherein the response protein is an ion channel, an ion exchange protein, or an ion co-transporter.
43. The cell according to claim 42, wherein the ion channel is a hydrogen ion channel, a sodium ion channel, a potassium ion channel, a chloride ion channel, a calcium ion channel, or a cation channel.
44. The cell according to claim 35, wherein the first nucleic acid and the second nucleic acid are present within a single expression vector.
45. The cell according to claim 35, wherein the nucleotide sequence encoding a light-activated protein that is adapted to allow a first ion to pass through a cell membrane in response to light is operably linked to a neuron-specific transcription control element.
46. The cell according to claim 35, wherein the second nucleic acid comprising a nucleotide sequence encoding a response protein that responds to the passage of the first ion through the cell membrane by allowing a second ion to pass through the cell membrane is operably linked to a neuron-specific transcription control element.
47. A method for modulating the membrane potential of a cell in response to light, the method comprising exposing a cell to light of an activating wavelength, wherein the cell is genetically modified with: a) a first nucleic acid comprising a nucleotide sequence encoding a light-activated protein that is adapted to allow a first ion to pass through a cell membrane in response to light; and b) a second nucleic acid comprising a nucleotide sequence encoding a response protein that responds to the passage of the first ion through the cell membrane by allowing a second ion to pass through the cell membrane.
48. The method according to claim 47, wherein the light-activated protein is an ion pump.
49. The method according to claim 48, wherein the ion pump is a hydrogen ion pump, a sodium ion pump, a potassium ion pump, a chloride ion pump, or a calcium ion pump.
50. The method according to claim 47, wherein the light-activated protein is an ion channel.
51. The method according to claim 50, wherein the ion channel is a hydrogen ion channel, a sodium ion channel, a potassium ion channel, a chloride ion channel, or a calcium ion channel.
52. The method according to claim 47, wherein the response protein is an ion pump.
53. The method according to claim 52, wherein the ion pump is a hydrogen ion pump, a sodium ion pump, a potassium ion pump, a chloride ion pump, or a calcium ion pump.
54. The method according to claim 47, wherein the response protein is an ion channel, an ion exchange protein, or an ion co-transporter.
55. The method according to claim 54, wherein the ion channel is a hydrogen ion channel, a sodium ion channel, a potassium ion channel, a chloride ion channel, a calcium ion channel, or a cation channel.
56. The method according to claim 47, wherein exposing the cell to light of an activating wavelength inhibits retrograde propagating action potentials within the cell.
57. A method for inhibiting the activity of a voltage-gated sodium channel in a cell in response to light, the method comprising exposing the cell to light of an activating wavelength, wherein the cell is genetically modified with: a) a first nucleic acid comprising a nucleotide sequence encoding a light-activated protein that is adapted to allow a plurality of hydrogen ions to pass through a cell membrane in an outward direction in response to light; and b) a second nucleic acid comprising a nucleotide sequence encoding a response protein that responds to the presence of the hydrogen ions on or near the external surface of the cell membrane by allowing a plurality of sodium ions to pass through the cell membrane in an inward direction, causing sustained depolarization of the cell membrane, thereby inactivating the voltage-gated sodium ion channel and inhibiting its activity.
58. The method according to claim 57, wherein the light-activated protein is an ion pump.
59. The method according to claim 58, wherein the ion pump is a hydrogen ion pump, a sodium ion pump, a potassium ion pump, a chloride ion pump, or a calcium ion pump.
60. The method according to claim 57, wherein the light-activated protein is an ion channel.
61. The method according to claim 60, wherein the ion channel is a hydrogen ion channel, a sodium ion channel, a potassium ion channel, a chloride ion channel, or a calcium ion channel.
62. The method according to claim 57, wherein the response protein is an ion pump.
63. The method according to claim 62, wherein the ion pump is a hydrogen ion pump, a sodium ion pump, a potassium ion pump, a chloride ion pump, or a calcium ion pump.
64. The method according to claim 57, wherein the response protein is an ion channel, an ion exchange protein, or an ion co-transporter.
65. The method according to claim 64, wherein the ion channel is a hydrogen ion channel, a sodium ion channel, a potassium ion channel, a chloride ion channel, a calcium ion channel, or a cation channel.
66. The method according to claim 57, wherein exposing the cell to light of an activating wavelength inhibits retrograde or anterograde propagating action potentials within the cell.
67. A method of treating a condition in a subject, the method comprising: genetically modifying a target cell of the subject with: a) a first nucleic acid comprising a nucleotide sequence encoding a light-activated protein that is adapted to allow a first ion to pass through a membrane of the target cell in response to light; and b) a second nucleic acid comprising a nucleotide sequence encoding a response protein that responds to the passage of the first ion through the membrane of the target cell by allowing a second ion to pass through the membrane, wherein passage of the second ion through the membrane treats the condition; and exposing the target cell to light of an activating wavelength to treat the subject for the condition.
68. The method according to claim 67, wherein the light-activated protein is an ion pump.
69. The method according to claim 68, wherein the ion pump is a hydrogen ion pump, a sodium ion pump, a potassium ion pump, a chloride ion pump, or a calcium ion pump.
70. The method according to claim 67, wherein the light-activated protein is an ion channel.
71. The method according to claim 70, wherein the ion channel is a hydrogen ion channel, a sodium ion channel, a potassium ion channel, a chloride ion channel, or a calcium ion channel.
72. The method according to claim 67, wherein the response protein is an ion pump.
73. The method according to claim 72, wherein the ion pump is a hydrogen ion pump, a sodium ion pump, a potassium ion pump, a chloride ion pump, or a calcium ion pump.
74. The method according to claim 67, wherein the response protein is an ion channel, an ion exchange protein, or an ion co-transporter.
75. The method according to claim 74, wherein the ion channel is a hydrogen ion channel, a sodium ion channel, a potassium ion channel, a chloride ion channel, a calcium ion channel, or a cation channel.
76. The method according to claim 67, wherein exposing the cell to light of an activating wavelength inhibits retrograde or anterograde propagating action potentials within the cell.
77. The method according to claim 67, wherein the condition is a cardiac condition, a gastrointestinal condition, an endocrine condition, a neurological condition, or a psychiatric condition.
78. A method for treating a condition in a subject, the method comprising: genetically modifying a nerve cell of the subject with: a) a first nucleic acid comprising a nucleotide sequence encoding a light-activated protein that is adapted to allow a plurality of hydrogen ions to pass through a membrane of the nerve cell in an outward direction in response to light; and b) a second nucleic acid comprising a nucleotide sequence encoding a response protein that responds to the passage of the plurality of hydrogen ions through the membrane of the nerve cell by allowing a plurality of sodium ions to pass through the membrane in an inward direction, wherein passage of the plurality of sodium ions through the membrane depolarizes the membrane and inactivates a voltage-gated sodium channel in the membrane of the nerve cell, and thereby treats the neurological condition; and exposing the nerve cell to light of an activating wavelength to treat the subject for the condition.
79. The method according to claim 78, wherein the light-activated protein is a hydrogen ion pump.
80. The method according to claim 78, wherein the light-activated protein is a hydrogen ion channel.
81. The method according to claim 78, wherein the response protein is a sodium ion pump.
82. The method according to claim 78, wherein the response protein is a sodium ion channel, a sodium ion exchange protein, or a sodium ion-cotransporter.
83. The method according to claim 78, wherein exposing the cell to light of an activating wavelength inhibits retrograde or anterograde propagating action potentials within the cell.
84. The method according to claim 78, wherein the condition is a cardiac condition, a gastrointestinal condition, or a neurological condition.
85. A method of selectively inhibiting retrograde propagating action potentials within a nerve cell or a portion thereof, the method comprising: genetically modifying the nerve cell with: a) a first nucleic acid comprising a nucleotide sequence encoding a light-activated protein that is adapted to allow a plurality of hydrogen ions to pass through a membrane of the nerve cell in response to light; and b) a second nucleic acid comprising a nucleotide sequence encoding a response protein that responds to the passage of the hydrogen ions through the membrane of the nerve cell by allowing a plurality of sodium ions to pass through the membrane, wherein passage of the sodium ions through the membrane depolarizes the membrane and inactivates a plurality of voltage-gated sodium channels in the membrane of the nerve cell that cause retrograde propagating action potentials; and exposing the nerve cell, or a portion thereof, to light of an activating wavelength to inhibit retrograde propagating action potentials therein.
86. The method according to claim 85, wherein the light-activated protein is a hydrogen ion pump.
87. The method according to claim 85, wherein the light-activated protein is a hydrogen ion channel.
88. The method according to claim 85, wherein the response protein is a sodium ion pump.
89. The method according to claim 85, wherein the response protein is a sodium ion channel, a sodium ion exchange protein, or a sodium ion co-transporter.
90. A kit comprising: a first nucleic acid comprising a nucleotide sequence encoding a light-activated protein that is adapted to allow a first ion to pass through a cell membrane in response to light; and a second nucleic acid comprising a nucleotide sequence encoding a response protein that responds to the passage of the first ion through the cell membrane by allowing a second ion to pass through the cell membrane.
91. The kit according to claim 90, wherein the light-activated protein is an ion pump.
92. The kit according to claim 91, wherein the ion pump is a hydrogen ion pump, a sodium ion pump, a potassium ion pump, a chloride ion pump, or a calcium ion pump.
93. The kit according to claim 90, wherein the light-activated protein is an ion channel, an ion exchange protein, or an ion co-transporter.
94. The kit according to claim 93, wherein the ion channel is a hydrogen ion channel, a sodium ion channel, a potassium ion channel, a chloride ion channel, a calcium ion channel, or a cation channel.
95. The kit according to claim 90, wherein the response protein is an ion pump.
96. The kit according to claim 95, wherein the ion pump is a hydrogen ion pump, a sodium ion pump, a potassium ion pump, a chloride ion pump, or a calcium ion pump.
97. The kit according to claim 90, wherein the response protein is an ion channel.
98. The kit according to claim 97, wherein the ion channel is a hydrogen ion channel, a sodium ion channel, a potassium ion channel, a chloride ion channel, or a calcium ion channel.
99. The kit according to claim 90, further comprising a device configured to illuminate a target location with a light.
100. The kit according to claim 99, wherein the device is configured to illuminate the target location with light having a wavelength ranging from about 350 to about 750 nm.
101. The kit according to claim 99, wherein the device is configured to illuminate the target location with light having a wavelength ranging from about 530 up to about 560 nm.
102. The kit according to claim 99, wherein the device is configured to constantly illuminate the target location with a light.
103. The kit according to claim 99, wherein the device is configured to illuminate the target location with pulses of light.
104. The kit according to claim 102 or 103, wherein the device is configured to modulate the wavelength and/or the intensity of the light.
105. The kit according to claim 103, wherein the device is configured to modulate the frequency and/or duration of the pulses of light.
106. The kit according to claim 102 or 103, wherein the device is configured to illuminate the target location in response to a user input.
107. The kit according to claim 106, wherein the user input comprises: the wavelength of light, the intensity of light, the duration of a light pulse, the frequency of a light pulse, and/or the target location.
108. The kit according to claim 90, wherein the device is adapted to be implanted in a subject.
109. The kit according to claim 90, wherein the target location is: a cell, a portion of a cell, a plurality of cells, a bundle of nerve fibers, a neuromuscular junction, a central nervous system (CNS) tissue, a peripheral nervous system (PNS) tissue, or an anatomical region.
110. A fusion polypeptide comprising: a) a light-responsive protein that is adapted to allow a first ion to pass through a cell membrane in response to light; and b) a response protein that responds to the passage of the first ion through the cell membrane by allowing a second ion to pass through the cell membrane.
111. The fusion polypeptide according to claim 110, wherein the fusion polypeptide comprises, in order from amino terminus to carboxyl terminus: a) a light-responsive protein that is adapted to allow a first ion to pass through a cell membrane in response to light; b) a membrane trafficking signal; c) a response protein that responds to the passage of the first ion through the cell membrane by allowing a second ion to pass through the cell membrane; and d) a membrane trafficking signal.
112. The fusion polypeptide according to claim 110 or 111, wherein the response protein comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the ASIC2a polypeptide amino acid sequence set forth in SEQ ID NO:19.
113. The fusion polypeptide according to claim 111, wherein the membrane trafficking signal comprises the amino acid sequence KSRITSEGEYIPLDQIDINV (SEQ ID NO:37).
114. The fusion polypeptide according to any one of claims 110-113, further comprising an endoplasmic reticulum (ER) export signal.
115. The fusion polypeptide according to claim 114, wherein the ER export signal comprises the amino acid sequence FCYENEV (SEQ ID NO:47)
116. The fusion polypeptide according to any one of claims 110-115, wherein the fusion polypeptide comprises, interposed between the light-responsive polypeptide and the response protein, a self-cleaving polypeptide.
117. The fusion polypeptide according to claim 116, wherein the self-cleaving polypeptide comprises the amino acid sequence ATNFSLLKQAGDVEENPGP (SEQ ID NO:49).
118. A nucleic acid comprising a nucleotide sequence encoding the fusion polypeptide according to any one of claims 110-117.
119. A recombinant expression vector comprising the nucleic acid according to claim 118.
120. The recombinant expression vector according to claim 119, wherein the nucleotide sequence encoding the fusion polypeptide is operably linked to a neuron-specific transcriptional control element.
121. A cell genetically modified with the recombinant expression vector according to claim 119.
122. The cell according to claim 121, wherein the cell is a neuron.
Description:
CROSS-REFERENCE
[0001] This application claims the benefit of U.S. Provisional Patent Application No. 61/817,221, filed Apr. 29, 2013, which application is incorporated herein by reference in its entirety.
INCORPORATION BY REFERENCE OF SEQUENCE LISTING PROVIDED AS A TEXT FILE
[0002] A Sequence Listing is provided herewith as a text file, "STAN-1030WO SeqList_ST25.txt" created on Apr. 29, 2014 and having a size of 208 KB. The contents of the text file are incorporated by reference herein in their entirety.
INTRODUCTION
[0003] Optogenetics refers to the combination of genetic and optical methods used to control specific events in target cells with the temporal precision (millisecond-timescale) needed to keep pace with functioning intact biological systems. Optogenetics involves the introduction of fast light-responsive ion channel or pump proteins into the plasma membranes of target cells to allow temporally precise manipulation of membrane potentials while maintaining cell-type resolution through the use of specific targeting mechanisms, such as tissue-specific promoters.
[0004] A major limiting step in optogenetic electrical inhibition is that the existing tools do not cause input resistance changes, and only generate relatively weak photocurrents because the existing ion pump proteins only move one ion per photon. Conversely, a major limiting step in optogenetic excitation is that when exciting a projection of a target cell, such as an axon, retrograde propagating action potentials can return to the cell body and proceed down collateral cell projections, thereby reducing specificity. As such, there is a need for devices, systems and methods that can be used to inhibit and/or intercept action potentials in target cells, thereby expanding the potential uses of optogenetic technology.
SUMMARY
[0005] Aspects of the disclosure include devices, systems and methods for optogenetic modulation of action potentials in target cells. The subject devices include light-generating devices, control devices, and delivery devices for delivering vectors to target cells. The subject systems include light-activated proteins, response proteins, nucleic acids comprising nucleotide sequences encoding these proteins, as well as expression systems that facilitate expression of these proteins in target cells. Also provided are methods of using the subject devices and systems to optogenetically inhibit and intercept action potentials in target cells, e.g., to treat a neurological or psychiatric condition in a human or non-human animal subject.
BRIEF DESCRIPTION OF THE DRAWINGS
[0006] FIG. 1 is a schematic representation of a subject optogenetic system, showing a light-activated protein (eArch3.0) and a response protein (eASIC2a or ASIC2a) present in the membrane of a nerve cell. Also depicted are the membrane current as a function of time after the cell is illuminated with light of the indicated wavelength and the influence of light on evoked action potential spiking (membrane voltage) as a function of time.
[0007] FIG. 2 shows several graphs that depict the influence of light on evoked action potential firing when ASIC2a currents are large. The graphs show examples of membrane voltage of an eArch-ASIC2a expressing nerve cell as a function of time when the nerve cell is illuminated with light of the indicated wavelength, during electrically-evoked action potential spiking
[0008] FIG. 3 shows several graphs that depict the influence of light on evoked action potential firing when ASIC2a currents are large. The graphs show examples of membrane voltage of an eArch-eASIC2a-expressing nerve cell as a function of time when the nerve cell is illuminated with light of the indicated wavelength, during electrically-evoked action potential spiking.
[0009] FIG. 4 shows several graphs that depict the influence of light on evoked action potential firing when the ASIC2a current in small. The graphs show examples of membrane voltage of an eArch-eASIC2a-expressing nerve cell as a function of time when the nerve cell is illuminated with light of the indicated wavelength, during electrically-evoked action potential spiking.
[0010] FIG. 5 shows the nucleotide sequence of an example polynucleotide containing an Arch sequence (Arch), a trafficking sequence (TS), a ribosomal skip sequence (p2A), an ASIC2a sequence (ASIC2a), and a yellow fluorescent protein sequence (EYFP).
[0011] FIG. 6 shows the nucleotide sequence of an example polynucleotide containing an Arch sequence (Arch), a trafficking sequence (TS), a ribosomal skip sequence (p2A), an ASIC2a sequence (ASIC2a), a trafficking sequence (TS), a yellow fluorescent protein sequence (EYFP), and an endoplasmic reticulum export sequence (ER).
[0012] FIG. 7 shows a map of an example vector containing an Arch sequence and an ASIC2a sequence, as well as additional components, such as a CaMKIIa promoter.
[0013] FIG. 8 shows a map of an example vector containing an Arch sequence and an ASIC2a sequence, as well as additional components, such as an hSyn promoter.
[0014] FIG. 9 shows a first example of an optical stimulation system in accordance with embodiments of the present disclosure.
[0015] FIG. 10 shows a second example of an optical stimulation system in accordance with embodiments of the present disclosure.
[0016] FIG. 11 shows a third example of an optical stimulation system in accordance with embodiments of the present disclosure.
[0017] FIG. 12 shows a flow diagram that illustrates the steps of an example method in accordance with embodiments of the present disclosure.
[0018] FIGS. 13A-K provide amino acid sequences of various light-responsive proteins.
[0019] FIGS. 14A-H provide amino acid sequences of exemplary response proteins.
[0020] FIGS. 15A-L depicts the identification and delineation of the bystander effect.
[0021] FIG. 16 depicts traces illustrating the difference in on-kinetics between a ChR2 expressing-cell photocurrent and a ChR2 bystander current (dashed box shows a zoom-in of the first 0.5 s of both traces).
[0022] FIGS. 17A-B depict photocurrent magnitudes and traces for opsin-expressing neurons.
[0023] FIGS. 18A-D depict the functional impact of bystander currents on action potential firing measured as a percentage of successfully evoked spikes during repeated light-off and light-on epochs.
[0024] FIGS. 19A-G depict electrical stimulation-elicited bystander effects and the effects of ASIC antagonist amiloride administration.
[0025] FIG. 20 depicts an exemplary bystander current in response to electrical stimulation of Schaffer collaterals to CA1 region of hippocampus using a tungsten concentric bipolar electrode.
[0026] FIGS. 21A-C depict control experiments pertaining to amiloride administration.
[0027] FIGS. 22A-C depict measures of cell health for bystander neurons.
[0028] FIGS. 23A-D depict optical activation of three acid-sensitive ion channels using the Two Component Optogenetic (TCO) approach.
[0029] FIGS. 24A-E depict photocurrents of Chlorellarhodopsin (CsR) and related current quantification.
[0030] FIGS. 25A-E depict CsR-ASIC1a photocurrents with and without permanent perfusion in Xenopus laevis oocytes and related quantification.
[0031] FIGS. 26A-E depict the effects of various parameters (pH, buffer, light intensity, etc.) on CsR-ASIC2a photocurrents measured by two-electrode voltage clamp (TEVC) in oocytes.
[0032] FIGS. 27A-H depict expression of eArch3.0-ASIC2a (Champ) in in hippocampal neurons, photocurrents in such neurons, and related quantification.
[0033] FIGS. 28A-F depict various measures of the variable presence of the ASIC2a component in cultured hippocampal neurons.
[0034] FIGS. 29A-B depict the effects of light pulse duration on Champ currents and kinetics.
[0035] FIGS. 30A-F depict the effects of HEPES concentration in Tyrode's solution on Champ photocurrents
[0036] FIGS. 31A-B depict Champ-mediated membrane hyperpolarization and depolarization in response to light pulses of increasing duration.
[0037] FIGS. 32A-D depict the effects of increasing molecular distance between components in a head-to-head comparison of four Champ constructs.
[0038] FIGS. 33A-D depict various measures of cell health across 4 different Champ constructs with increasing molecular separation between proton pump and ASIC.
DEFINITIONS
[0039] As used herein, an "individual," "subject," or "patient" can be a mammal, including a human. Mammals include, but are not limited to, ungulates, canines, felines, bovines, ovines, non-human primates, lagomorphs (e.g., rabbits), and rodents (e.g., mice and rats). In one aspect, an individual is a human. In another aspect, an individual is a non-human mammal.
[0040] Amino acid substitutions in a native protein sequence may be "conservative" or "non-conservative" and such substituted amino acid residues may or may not be one encoded by the genetic code. A "conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a chemically similar side chain (i.e., replacing an amino acid possessing a basic side chain with another amino acid with a basic side chain). A "non-conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a chemically different side chain (i.e., replacing an amino acid having a basic side chain with an amino acid having an aromatic side chain). The standard twenty amino acid "alphabet" is divided into chemical families based on chemical properties of their side chains. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and side chains having aromatic groups (e.g., tyrosine, phenylalanine, tryptophan, histidine).
[0041] As used herein, an "effective dosage" or "effective amount" of drug, compound, or pharmaceutical composition is an amount sufficient to effect beneficial or desired results. For prophylactic use, beneficial or desired results include results such as eliminating or reducing the risk, lessening the severity, or delaying the onset of the disease, including biochemical, histological and/or behavioral symptoms of the disease, its complications and intermediate pathological phenotypes presenting during development of the disease. For therapeutic use, beneficial or desired results include clinical results such as decreasing one or more symptoms resulting from the disease, increasing the quality of life of those suffering from the disease, decreasing the dose of other medications required to treat the disease, enhancing effect of another medication such as via targeting, delaying the progression of the disease, and/or prolonging survival. An effective dosage can be administered in one or more administrations. For purposes of this disclosure, an effective dosage of drug, compound, or pharmaceutical composition is an amount sufficient to accomplish prophylactic or therapeutic treatment either directly or indirectly. As is understood in the clinical context, an effective dosage of a drug, compound, or pharmaceutical composition may or may not be achieved in conjunction with another drug, compound, or pharmaceutical composition. Thus, an "effective dosage" may be considered in the context of administering one or more therapeutic agents, and a single agent may be considered to be given in an effective amount if, in conjunction with one or more other agents, a desirable result may be or is achieved.
[0042] As used herein, "treatment" or "treating" is an approach for obtaining beneficial or desired results including clinical results. For purposes of this disclosure, beneficial or desired clinical results include, but are not limited to, one or more of the following: decreasing symptoms resulting from the disease, increasing the quality of life of those suffering from the disease, decreasing the dose of other medications required to treat the disease, delaying the progression of the disease, and/or prolonging survival of individuals.
[0043] Before the present invention is described in greater detail, it is to be understood that this invention is not limited to particular embodiments described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
[0044] Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range, is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges and are also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.
[0045] Certain ranges are presented herein with numerical values being preceded by the term "about" The term "about" is used herein to provide literal support for the exact number that it precedes, as well as a number that is near to or approximately the number that the term precedes. In determining whether a number is near to or approximately a specifically recited number, the near or approximating unrecited number may be a number which, in the context in which it is presented, provides the substantial equivalent of the specifically recited number.
[0046] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present invention, representative illustrative methods and materials are now described.
[0047] All publications and patents cited in this specification are herein incorporated by reference as if each individual publication or patent were specifically and individually indicated to be incorporated by reference and are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided may be different from the actual publication dates which may need to be independently confirmed.
[0048] It is noted that, as used herein and in the appended claims, the singular forms "a", "an", and "the" include plural referents unless the context clearly dictates otherwise. It is further noted that the claims may be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as "solely," "only" and the like in connection with the recitation of claim elements, or use of a "negative" limitation.
[0049] As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present invention. Any recited method can be carried out in the order of events recited or in any other order which is logically possible.
[0050] In further describing various aspects of embodiments of the invention in greater detail, aspects of the systems and devices of various embodiments are reviewed first in greater detail, followed by a discussion of methods and kits according to certain embodiments of the invention.
DETAILED DESCRIPTION
[0051] Aspects of the disclosure include devices, systems and methods for optogenetic modulation of action potentials in target cells. The subject devices include light-generating devices, control devices, and delivery devices for delivering vectors to target cells. The subject systems include light-activated proteins, response proteins, nucleic acids comprising nucleotide sequences encoding these proteins, as well as expression systems that facilitate expression of these proteins in target cells. Also provided are methods of using the subject devices and systems to optogenetically inhibit and intercept action potentials in target cells, e.g., to treat a neurological or psychiatric condition in a human or animal subject.
Systems and Devices
[0052] Aspects of the present disclosure include systems and devices configured for optogenetically modulating action potentials in target cells. The subject systems generally include a light-activated protein, a response protein, and one or more devices for delivering light of an activating wavelength to a target cell. The subject systems further include nucleic acids comprising nucleotide sequences encoding the subject proteins, as well as additional components, such as transcriptional control elements (e.g., promoter sequences, such as tissue-specific or cell type-specific promoter sequences), trafficking sequences, signal sequences, endoplasmic reticulum export sequences, and the like. Also provided are devices for delivering the subject nucleic acids to target cells, and devices for controlling the delivery of light to the target cells. Each of these components is now further described in greater detail.
Light-Activated Proteins
[0053] As summarized above, aspects of the present disclosure include light-activated proteins that allow one or more ions to pass through the plasma membrane of a target cell when the protein is illuminated with light of an activating wavelength. Light-activated proteins may be characterized as ion pump proteins, which facilitate the passage of a small number of ions through the plasma membrane per photon of light, or as ion channel proteins, which allow a stream of ions to freely flow through the plasma membrane when the channel is open. The subject light-activated proteins are in some embodiments specific to a particular species of ion, meaning that the subject light-activated proteins only allow ions of a particular species to pass through the membrane.
[0054] Examples of suitable light-responsive polypeptides include, e.g., the Halorhodopsin family of light-responsive chloride pumps (e.g., NpHR, NpHR2.0, NpHR3.0, NpHR3.1). As another example, the GtR3 proton pump can be used to promote neural cell membrane hyperpolarization in response to light. As another example, eArch (a proton pump) can be used to promote neural cell membrane hyperpolarization in response to light. As another example, an ArchT opsin protein or a Mac opsin protein can be used to promote neural cell membrane hyperpolarization in response to light.
[0055] Examples of suitable light-responsive polypeptides include, e.g., members of the Channelrhodopsin family of light-responsive cation channel proteins (e.g., ChR2, SFOs, SSFOs, C1V1s), which can be used to promote neural cell membrane depolarization or depolarization-induced synaptic depletion in response to a light stimulus.
Enhanced Intracellular Transport Amino Acid Motifs
[0056] The present disclosure provides for the modification of light-responsive opsin proteins expressed in a cell by the addition of one or more amino acid sequence motifs which enhance transport to the plasma membranes of mammalian cells. Light-responsive opsin proteins having components derived from evolutionarily simpler organisms may not be expressed or tolerated by mammalian cells or may exhibit impaired subcellular localization when expressed at high levels in mammalian cells. Consequently, in some embodiments, the light-responsive opsin proteins expressed in a cell can be fused to one or more amino acid sequence motifs selected from the group consisting of a signal peptide, an endoplasmic reticulum (ER) export signal, a membrane trafficking signal, and/or an N-terminal golgi export signal. The one or more amino acid sequence motifs which enhance light-responsive protein transport to the plasma membranes of mammalian cells can be fused to the N-terminus, the C-terminus, or to both the N- and C-terminal ends of the light-responsive protein. Optionally, the light-responsive protein and the one or more amino acid sequence motifs may be separated by a linker. In some embodiments, the light-responsive protein can be modified by the addition of a trafficking signal (ts) which enhances transport of the protein to the cell plasma membrane. In some embodiments, the trafficking signal can be derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1. In other embodiments, the trafficking signal can comprise the amino acid sequence KSRITSEGEYIPLDQIDINV (SEQ ID NO:37).
[0057] Trafficking sequences that are suitable for use can comprise an amino acid sequence having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, amino acid sequence identity to an amino acid sequence such a trafficking sequence of human inward rectifier potassium channel Kir2.1 (e.g., KSRITSEGEYIPLDQIDINV (SEQ ID NO:37)).
[0058] A trafficking sequence can have a length of from about 10 amino acids to about 50 amino acids, e.g., from about 10 amino acids to about 20 amino acids, from about 20 amino acids to about 30 amino acids, from about 30 amino acids to about 40 amino acids, or from about 40 amino acids to about 50 amino acids.
[0059] Signal sequences that are suitable for use can comprise an amino acid sequence having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, amino acid sequence identity to an amino acid sequence such as one of the following:
1) the signal peptide of hChR2 (e.g., MDYGGALSAVGRELLFVTNPVVVNGS (SEQ ID NO:38)) 2) the .beta.2 subunit signal peptide of the neuronal nicotinic acetylcholine receptor (e.g., MAGHSNSMALFSFSLLWLCSGVLGTEF (SEQ ID NO:39)); 3) a nicotinic acetylcholine receptor signal sequence (e.g., MGLRALMLWLLAAAGLVRESLQG (SEQ ID NO:40)); and 4) a nicotinic acetylcholine receptor signal sequence (e.g., MRGTPLLLVVSLFSLLQD (SEQ ID NO:41)).
[0060] A signal sequence can have a length of from about 10 amino acids to about 50 amino acids, e.g., from about 10 amino acids to about 20 amino acids, from about 20 amino acids to about 30 amino acids, from about 30 amino acids to about 40 amino acids, or from about 40 amino acids to about 50 amino acids.
[0061] Endoplasmic reticulum (ER) export sequences that are suitable for use in a modified opsin of the present disclosure include, e.g., VXXSL (where X is any amino acid) (SEQ ID NO:42) (e.g., VKESL (SEQ ID NO:43); VLGSL (SEQ ID NO:44); etc.); NANSFCYENEVALTSK (SEQ ID NO:45); FXYENE (SEQ ID NO:46) (where X is any amino acid), e.g., FCYENEV (SEQ ID NO:47); and the like. An ER export sequence can have a length of from about 5 amino acids to about 25 amino acids, e.g., from about 5 amino acids to about 10 amino acids, from about 10 amino acids to about 15 amino acids, from about 15 amino acids to about 20 amino acids, or from about 20 amino acids to about 25 amino acids.
[0062] In some embodiments, the signal peptide sequence in the protein can be deleted or substituted with a signal peptide sequence from a different protein.
Proton Pump Proteins
[0063] In some embodiments, a light-activated protein is an Archaerhodopsin (Arch) proton pump that can transport one or more protons across the plasma membrane of a cell when the cell is illuminated with light. The light can have a wavelength between about 530 and about 595 nm or can have a wavelength of about 560 nm. In some embodiments, the Arch protein can comprise an amino acid sequence that is at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:1 (Arch). The Arch protein can additionally comprise substitutions, deletions, and/or insertions introduced into a native amino acid sequence to increase or decrease sensitivity to light, increase or decrease sensitivity to particular wavelengths of light, and/or increase or decrease the ability of the Arch protein to transport ions across the plasma membrane of a target cell. Additionally, the Arch protein can contain one or more conservative amino acid substitutions and/or one or more non-conservative amino acid substitutions. The Arch protein comprising substitutions, deletions, and/or insertions introduced into the native amino acid sequence suitably retains the ability to transport ions across the plasma membrane of a target cell in response to light.
[0064] In some embodiments, an Arch protein comprises at least one (such as one, two, three, or more) amino acid sequence motifs that enhance transport to the plasma membranes of target cells selected from the group consisting of a signal peptide, an ER export signal, and a membrane trafficking signal. In some embodiments, the Arch protein comprises an N-terminal signal peptide and a C-terminal ER export signal. In some embodiments, the Arch protein comprises an N-terminal signal peptide and a C-terminal trafficking signal. In some embodiments, the Arch protein comprises an N-terminal signal peptide, a C-terminal ER export signal, and a C-terminal trafficking signal. In some embodiments, the Arch protein comprises a C-terminal ER export signal and a C-terminal trafficking signal. In some embodiments, the C-terminal ER export signal and the C-terminal trafficking signal are linked by a linker. The linker can comprise any of about 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length. The linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein. In some embodiments the ER export signal is more C-terminally located than the trafficking signal. In some embodiments the trafficking signal is more C-terminally located than the ER Export signal.
[0065] In some embodiments, the light-responsive proton pump protein can be responsive to blue light and can be derived from Guillardia theta, wherein the proton pump protein can be capable of mediating a hyperpolarizing current in the cell when the cell is illuminated with blue light. The light can have a wavelength between about 450 and about 495 nm or can have a wavelength of about 490 nm. In another embodiment, the light-responsive proton pump protein can comprise an amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:4 (GtR3). The light-responsive proton pump protein can additionally comprise substitutions, deletions, and/or insertions introduced into a native amino acid sequence to increase or decrease sensitivity to light, increase or decrease sensitivity to particular wavelengths of light, and/or increase or decrease the ability of the light-responsive proton pump protein to regulate the polarization state of the plasma membrane of the cell. Additionally, the light-responsive proton pump protein can contain one or more conservative amino acid substitutions and/or one or more non-conservative amino acid substitutions. The light-responsive proton pump protein comprising substitutions, deletions, and/or insertions introduced into the native amino acid sequence suitably retains the ability to hyperpolarize the plasma membrane of a neuronal cell in response to light.
[0066] In other aspects of the methods disclosed herein, the light-responsive proton pump protein can comprise a core amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:4 and at least one (such as one, two, three, or more) amino acid sequence motifs which enhance transport to the plasma membranes of mammalian cells selected from the group consisting of a signal peptide, an ER export signal, and a membrane trafficking signal. In some embodiments, the light-responsive proton pump protein comprises an N-terminal signal peptide and a C-terminal ER export signal. In some embodiments, the light-responsive proton pump protein comprises an N-terminal signal peptide and a C-terminal trafficking signal. In some embodiments, the light-responsive proton pump protein comprises an N-terminal signal peptide, a C-terminal ER Export signal, and a C-terminal trafficking signal. In some embodiments, the light-responsive proton pump protein comprises a C-terminal ER Export signal and a C-terminal trafficking signal. In some embodiments, the C-terminal ER Export signal and the C-terminal trafficking signal are linked by a linker. The linker can comprise any of about 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length. The linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein. In some embodiments the ER Export signal is more C-terminally located than the trafficking signal. In some embodiments the trafficking signal is more C-terminally located than the ER Export signal.
[0067] Also provided herein are isolated polynucleotides encoding any of the light-responsive proton pump proteins described herein, such as a light-responsive proton pump protein comprising a core amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:4. Also provided herein are expression vectors (such as a viral vector described herein) comprising a polynucleotide encoding the proteins described herein, such as a light-responsive proton pump protein comprising a core amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:4.
[0068] In some embodiments, a light-activated protein is an Oxyrrhis marina (Oxy) proton pump that can transport one or more protons across the plasma membrane of a cell when the cell is illuminated with light. The light can have a wavelength between about 500 and about 560 nm or can have a wavelength of about 530 nm. In some embodiments, the Oxy protein can comprise an amino acid sequence that is at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:5. The Oxy protein can additionally comprise substitutions, deletions, and/or insertions introduced into a native amino acid sequence to increase or decrease sensitivity to light, increase or decrease sensitivity to particular wavelengths of light, and/or increase or decrease the ability of the Oxy protein to transport ions across the plasma membrane of a target cell. Additionally, the Oxy protein can contain one or more conservative amino acid substitutions and/or one or more non-conservative amino acid substitutions. The Oxy protein comprising substitutions, deletions, and/or insertions introduced into the native amino acid sequence suitably retains the ability to transport ions across the plasma membrane of a target cell in response to light.
[0069] In some embodiments, an Oxy protein comprises at least one (such as one, two, three, or more) amino acid sequence motifs that enhance transport to the plasma membranes of target cells selected from the group consisting of a signal peptide, an ER export signal, and a membrane trafficking signal. In some embodiments, the Oxy protein comprises an N-terminal signal peptide and a C-terminal ER export signal. In some embodiments, the Oxy protein comprises an N-terminal signal peptide and a C-terminal trafficking signal. In some embodiments, the Oxy protein comprises an N-terminal signal peptide, a C-terminal ER export signal, and a C-terminal trafficking signal. In some embodiments, the Oxy protein comprises a C-terminal ER export signal and a C-terminal trafficking signal. In some embodiments, the C-terminal ER export signal and the C-terminal trafficking signal are linked by a linker. The linker can comprise any of about 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length. The linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein. In some embodiments the ER export signal is more C-terminally located than the trafficking signal. In some embodiments the trafficking signal is more C-terminally located than the ER Export signal.
[0070] In some embodiments, the light-responsive proton pump protein can be responsive to light and can be derived from Leptosphaeria maculans, wherein the proton pump protein can be capable of pumping protons across the membrane of a cell when the cell is illuminated with 520 nm to 560 nm light. The light can have a wavelength between about 520 nm to about 560 nm. In another embodiment, the light-responsive proton pump protein can comprise an amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:6 or SEQ ID NO:7 (Mac; Mac 3.0). The light-responsive proton pump protein can additionally comprise substitutions, deletions, and/or insertions introduced into a native amino acid sequence to increase or decrease sensitivity to light, increase or decrease sensitivity to particular wavelengths of light, and/or increase or decrease the ability of the light-responsive proton pump protein to regulate the polarization state of the plasma membrane of the cell. Additionally, the light-responsive proton pump protein can contain one or more conservative amino acid substitutions and/or one or more non-conservative amino acid substitutions. The light-responsive proton pump protein comprising substitutions, deletions, and/or insertions introduced into the native amino acid sequence suitably retains the ability to pump protons across the plasma membrane of a neuronal cell in response to light.
[0071] In other aspects of the methods disclosed herein, the light-responsive proton pump protein can comprise a core amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:6 and at least one (such as one, two, three, or more) amino acid sequence motifs which enhance transport to the plasma membranes of mammalian cells selected from the group consisting of a signal peptide, an ER export signal, and a membrane trafficking signal. In some embodiments, the light-responsive proton pump protein comprises an N-terminal signal peptide and a C-terminal ER export signal. In some embodiments, the light-responsive proton pump protein comprises an N-terminal signal peptide and a C-terminal trafficking signal. In some embodiments, the light-responsive proton pump protein comprises an N-terminal signal peptide, a C-terminal ER Export signal, and a C-terminal trafficking signal. In some embodiments, the light-responsive proton pump protein comprises a C-terminal ER Export signal and a C-terminal trafficking signal. In some embodiments, the C-terminal ER Export signal and the C-terminal trafficking signal are linked by a linker. The linker can comprise any of about 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length. The linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein. In some embodiments the ER Export signal is more C-terminally located than the trafficking signal. In some embodiments the trafficking signal is more C-terminally located than the ER Export signal.
[0072] Also provided herein are isolated polynucleotides encoding any of the light-responsive proton pump proteins described herein, such as a light-responsive proton pump protein comprising a core amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:6. Also provided herein are expression vectors (such as a viral vector described herein) comprising a polynucleotide encoding the proteins described herein, such as a light-responsive proton pump protein comprising a core amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:6.
[0073] Further disclosure related to light-activated proton pump proteins can be found in International Patent Application No. PCT/US2011/028893, the disclosure of which is hereby incorporated by reference in its entirety.
Cation Channel Proteins
[0074] In some aspects, the light-responsive cation channel protein can be derived from Chlamydomonas reinhardtii, wherein the cation channel protein can be capable of transporting cations across a cell membrane when the cell is illuminated with light. In another embodiment, the light-responsive cation channel protein can comprise an amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:8. The light used to activate the light-responsive cation channel protein derived from Chlamydomonas reinhardtii can have a wavelength between about 460 and about 495 nm or can have a wavelength of about 480 nm. Additionally, light pulses having a temporal frequency of about 100 Hz can be used to activate the light-responsive protein. In some embodiments, activation of the light-responsive cation channel derived from Chlamydomonas reinhardtii with light pulses having a temporal frequency of about 100 Hz can cause depolarization-induced synaptic depletion of the neurons expressing the light-responsive cation channel. The light-responsive cation channel protein can additionally comprise substitutions, deletions, and/or insertions introduced into a native amino acid sequence to increase or decrease sensitivity to light, increase or decrease sensitivity to particular wavelengths of light, and/or increase or decrease the ability of the light-responsive cation channel protein to regulate the polarization state of the plasma membrane of the cell. Additionally, the light-responsive cation channel protein can contain one or more conservative amino acid substitutions and/or one or more non-conservative amino acid substitutions. The light-responsive proton pump protein comprising substitutions, deletions, and/or insertions introduced into the native amino acid sequence suitably retains the ability to transport cations across a cell membrane. In another embodiment, the light-responsive cation channel protein can comprise an amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the C1C2 amino sequence shown in FIG. 13E, and set forth in SEQ ID NO:29. A crystal structure of C1C2 is presented in Kato et al. (2012) Nature 482:369. In another embodiment, the light-responsive cation channel protein can comprise an amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the ReaChR amino sequence shown in FIG. 13F, and set forth in SEQ ID NO:30.
[0075] In some embodiments, the light-responsive cation channel comprises a T159C substitution of the amino acid sequence set forth in SEQ ID NO:8. In some embodiments, the light-responsive cation channel comprises a L132C substitution of the amino acid sequence set forth in SEQ ID NO:8. In some embodiments, the light-responsive cation channel comprises an E123T substitution of the amino acid sequence set forth in SEQ ID NO:8. In some embodiments, the light-responsive cation channel comprises an E123A substitution of the amino acid sequence set forth in SEQ ID NO:8. In some embodiments, the light-responsive cation channel comprises a T159C substitution and an E123T substitution of the amino acid sequence set forth in SEQ ID NO:8. In some embodiments, the light-responsive cation channel comprises a T159C substitution and an E123A substitution of the amino acid sequence set forth in SEQ ID NO:8. In some embodiments, the light-responsive cation channel comprises a T159C substitution, an L132C substitution, and an E123T substitution of the amino acid sequence set forth in SEQ ID NO:8. In some embodiments, the light-responsive cation channel comprises a T159C substitution, an L132C substitution, and an E123A substitution of the amino acid sequence set forth in SEQ ID NO:8. In some embodiments, the light-responsive cation channel comprises an L132C substitution and an E123T substitution of the amino acid sequence set forth in SEQ ID NO:8. In some embodiments, the light-responsive cation channel comprises an L132C substitution and an E123A substitution of the amino acid sequence set forth in SEQ ID NO:8. In some embodiments, the light-responsive cation channel comprises an H143R amino acid substitution of the amino acid sequence set forth in SEQ ID NO:8.
[0076] In some embodiments, a ChR2 protein comprises at least one (such as one, two, three, or more) amino acid sequence motifs that enhance transport to the plasma membranes of target cells selected from the group consisting of a signal peptide, an ER export signal, and a membrane trafficking signal. In some embodiments, the ChR2 protein comprises an N-terminal signal peptide and a C-terminal ER export signal. In some embodiments, the ChR2 protein comprises an N-terminal signal peptide and a C-terminal trafficking signal. In some embodiments, the ChR2 protein comprises an N-terminal signal peptide, a C-terminal ER export signal, and a C-terminal trafficking signal. In some embodiments, the ChR2 protein comprises a C-terminal ER export signal and a C-terminal trafficking signal. In some embodiments, the C-terminal ER export signal and the C-terminal trafficking signal are linked by a linker. The linker can comprise any of about 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length. The linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein. In some embodiments the ER export signal is more C-terminally located than the trafficking signal. In some embodiments the trafficking signal is more C-terminally located than the ER Export signal.
Step Function Opsins and Stabilized Step Function Opsins
[0077] In other embodiments, the light-responsive cation channel protein can be a step function opsin (SFO) protein or a stabilized step function opsin (SSFO) protein that can have specific amino acid substitutions at key positions throughout the retinal binding pocket of the protein. In some embodiments, the SFO protein can have a mutation at amino acid residue C128 of SEQ ID NO:8. In other embodiments, the SFO protein has a C128A mutation in SEQ ID NO:5. In other embodiments, the SFO protein has a C128S mutation in SEQ ID NO:8. In another embodiment, the SFO protein has a C128T mutation in SEQ ID NO:8. In some embodiments, the SFO protein can comprise an amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:9.
[0078] In some embodiments, the SSFO protein can have a mutation at amino acid residue D156 of SEQ ID NO:8. In other embodiments, the SSFO protein can have a mutation at both amino acid residues C128 and D156 of SEQ ID NO:8. In one embodiment, the SSFO protein has an C128S and a D156A mutation in SEQ ID NO:8. In another embodiment, the SSFO protein can comprise an amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:10. In another embodiment, the SSFO protein can comprise a C128T mutation in SEQ ID NO:8. In some embodiments, the SSFO protein comprises C128T and D156A mutations in SEQ ID NO:8.
[0079] In some embodiments the SFO or SSFO proteins provided herein can be capable of mediating a depolarizing current in the cell when the cell is illuminated with blue light. In other embodiments, the light can have a wavelength of about 445 nm. Additionally, in some embodiments the light can be delivered as a single pulse of light or as spaced pulses of light due to the prolonged stability of SFO and SSFO photocurrents. In some embodiments, activation of the SFO or SSFO protein with single pulses or spaced pulses of light can cause depolarization-induced synaptic depletion of the neurons expressing the SFO or SSFO protein. In some embodiments, each of the disclosed step function opsin and stabilized step function opsin proteins can have specific properties and characteristics for use in depolarizing the membrane of a neuronal cell in response to light.
[0080] Further disclosure related to SFO or SSFO proteins can be found in International Patent Application Publication No. WO 2010/056970, the disclosure of which is hereby incorporated by reference in its entirety.
C1V1 Chimeric Cation Channels
[0081] In other embodiments, the light-responsive cation channel protein can be a C1V1 chimeric protein derived from the VChR1 protein of Volvox carteri and the ChR1 protein from Chlamydomonas reinhardti, wherein the protein comprises the amino acid sequence of VChR1 having at least the first and second transmembrane helices replaced by the first and second transmembrane helices of ChR1; is responsive to light; and is capable of mediating a depolarizing current in the cell when the cell is illuminated with light. In some embodiments, the C1V1 protein can further comprise a replacement within the intracellular loop domain located between the second and third transmembrane helices of the chimeric light responsive protein, wherein at least a portion of the intracellular loop domain is replaced by the corresponding portion from ChR1. In another embodiment, the portion of the intracellular loop domain of the C1V1 chimeric protein can be replaced with the corresponding portion from ChR1 extending to amino acid residue A145 of the ChR1. In other embodiments, the C1V1 chimeric protein can further comprise a replacement within the third transmembrane helix of the chimeric light responsive protein, wherein at least a portion of the third transmembrane helix is replaced by the corresponding sequence of ChR1. In yet another embodiment, the portion of the intracellular loop domain of the C1V1 chimeric protein can be replaced with the corresponding portion from ChR1 extending to amino acid residue W163 of the ChR1. In other embodiments, the C1V1 chimeric protein can comprise an amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:11.
[0082] In some embodiments, the C1V1 protein can mediate a depolarizing current in the cell when the cell is illuminated with green light. In other embodiments, the light can have a wavelength of between about 540 nm to about 560 nm. In some embodiments, the light can have a wavelength of about 542 nm. In some embodiments, the C1V1 chimeric protein is not capable of mediating a depolarizing current in the cell when the cell is illuminated with violet light. In some embodiments, the chimeric protein is not capable of mediating a depolarizing current in the cell when the cell is illuminated with light having a wavelength of about 405 nm. Additionally, in some embodiments, light pulses having a temporal frequency of about 100 Hz can be used to activate the C1V1 protein.
C1V1 Chimeric Mutant Variants
[0083] In some aspects, the present disclosure provides polypeptides comprising substituted or mutated amino acid sequences, wherein the mutant polypeptide retains the characteristic light-activatable nature of the precursor C1V1 chimeric polypeptide but may also possess altered properties in some specific aspects. For example, the mutant light-responsive C1V1 chimeric proteins described herein can exhibit an increased level of expression both within an animal cell or on the animal cell plasma membrane; an altered responsiveness when exposed to different wavelengths of light, particularly red light; and/or a combination of traits whereby the chimeric C1V1 polypeptide possess the properties of low desensitization, fast deactivation, low violet-light activation for minimal cross-activation with other light-responsive cation channels, and/or strong expression in animal cells.
[0084] Accordingly, provided herein are C1V1 chimeric light-responsive opsin proteins that can have specific amino acid substitutions at key positions throughout the retinal binding pocket of the VChR1 portion of the chimeric polypeptide. In some embodiments, the C1V1 protein can have a mutation at amino acid residue E122 of SEQ ID NO:11. In some embodiments, the C1V1 protein can have a mutation at amino acid residue E162 of SEQ ID NO:11. In other embodiments, the C1V1 protein can have a mutation at both amino acid residues E162 and E122 of SEQ ID NO:11. In other embodiments, the C1V1 protein can comprise an amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:12, SEQ ID NO:13, or SEQ ID NO:14.
[0085] In some aspects, the C1V1-E122 mutant chimeric protein is capable of mediating a depolarizing current in the cell when the cell is illuminated with light. In some embodiments the light can be green light. In other embodiments, the light can have a wavelength of between about 540 nm to about 560 nm. In some embodiments, the light can have a wavelength of about 546 nm. In other embodiments, the C1V1-E122 mutant chimeric protein can mediate a depolarizing current in the cell when the cell is illuminated with red light. In some embodiments, the red light can have a wavelength of about 630 nm. In some embodiments, the C1V1-E122 mutant chimeric protein does not mediate a depolarizing current in the cell when the cell is illuminated with violet light. In some embodiments, the chimeric protein does not mediate a depolarizing current in the cell when the cell is illuminated with light having a wavelength of about 405 nm. Additionally, in some embodiments, light pulses having a temporal frequency of about 100 Hz can be used to activate the C1V1-E122 mutant chimeric protein. In some embodiments, activation of the C1V1-E122 mutant chimeric protein with light pulses having a frequency of 100 Hz can cause depolarization-induced synaptic depletion of the neurons expressing the C1V1-E122 mutant chimeric protein.
[0086] In other aspects, the C1V1-E162 mutant chimeric protein is capable of mediating a depolarizing current in the cell when the cell is illuminated with light. In some embodiments the light can be green light. In other embodiments, the light can have a wavelength of between about 535 nm to about 540 nm. In some embodiments, the light can have a wavelength of about 542 nm. In other embodiments, the light can have a wavelength of about 530 nm. In some embodiments, the C1V1-E162 mutant chimeric protein does not mediate a depolarizing current in the cell when the cell is illuminated with violet light. In some embodiments, the chimeric protein does not mediate a depolarizing current in the cell when the cell is illuminated with light having a wavelength of about 405 nm. Additionally, in some embodiments, light pulses having a temporal frequency of about 100 Hz can be used to activate the C1V1-E162 mutant chimeric protein. In some embodiments, activation of the C1V1-E162 mutant chimeric protein with light pulses having a frequency of 100 Hz can cause depolarization-induced synaptic depletion of the neurons expressing the C1V1-E162 mutant chimeric protein.
[0087] In yet other aspects, the C1V1-E122/E162 mutant chimeric protein is capable of mediating a depolarizing current in the cell when the cell is illuminated with light. In some embodiments the light can be green light. In other embodiments, the light can have a wavelength of between about 540 nm to about 560 nm. In some embodiments, the light can have a wavelength of about 546 nm. In some embodiments, the C1V1-E122/E162 mutant chimeric protein does not mediate a depolarizing current in the cell when the cell is illuminated with violet light. In some embodiments, the chimeric protein does not mediate a depolarizing current in the cell when the cell is illuminated with light having a wavelength of about 405 nm. In some embodiments, the C1V1-E122/E162 mutant chimeric protein can exhibit less activation when exposed to violet light relative to C1V1 chimeric proteins lacking mutations at E122/E162 or relative to other light-responsive cation channel proteins. Additionally, in some embodiments, light pulses having a temporal frequency of about 100 Hz can be used to activate the C1V1-E122/E162 mutant chimeric protein. In some embodiments, activation of the C1V1-E122/E162 mutant chimeric protein with light pulses having a frequency of 100 Hz can cause depolarization-induced synaptic depletion of the neurons expressing the C1V1-E122/E162 mutant chimeric protein.
Dunaliella salina Light-Responsive Proteins
[0088] In some embodiments, the light-responsive ion channel protein can be responsive to 470 nm-510 nm light and can be derived from Dunaliella salina, wherein the ion channel protein can be capable of mediating a hyperpolarizing current in the cell when the cell is illuminated with light. The light can have a wavelength between about 470 nm and about 510 nm or can have a wavelength of about 490 nm. In another embodiment, the light-responsive ion channel protein can comprise an amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:15. The light-responsive ion channel protein can additionally comprise substitutions, deletions, and/or insertions introduced into a native amino acid sequence to increase or decrease sensitivity to light, increase or decrease sensitivity to particular wavelengths of light, and/or increase or decrease the ability of the light-responsive ion channel protein to regulate the polarization state of the plasma membrane of the cell. Additionally, the light-responsive ion channel protein can contain one or more conservative amino acid substitutions and/or one or more non-conservative amino acid substitutions. The light-responsive ion channel protein comprising substitutions, deletions, and/or insertions introduced into the native amino acid sequence suitably retains the ability to transport ions across the plasma membrane of a neuronal cell in response to light.
[0089] In other aspects of the methods disclosed herein, the light-responsive ion channel protein can comprise a core amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:15 and at least one (such as one, two, three, or more) amino acid sequence motifs which enhance transport to the plasma membranes of mammalian cells selected from the group consisting of a signal peptide, an ER export signal, and a membrane trafficking signal. In some embodiments, the light-responsive proton ion channel comprises an N-terminal signal peptide and a C-terminal ER export signal. In some embodiments, the light-responsive ion channel protein comprises an N-terminal signal peptide and a C-terminal trafficking signal. In some embodiments, the light-responsive ion channel protein comprises an N-terminal signal peptide, a C-terminal ER Export signal, and a C-terminal trafficking signal. In some embodiments, the light-responsive ion channel protein comprises a C-terminal ER Export signal and a C-terminal trafficking signal. In some embodiments, the C-terminal ER Export signal and the C-terminal trafficking signal are linked by a linker. The linker can comprise any of about 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length. The linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein. In some embodiments the ER Export signal is more C-terminally located than the trafficking signal. In some embodiments the trafficking signal is more C-terminally located than the ER Export signal.
[0090] Also provided herein are isolated polynucleotides encoding any of the light-responsive channel proteins described herein, such as a light-responsive ion channel protein comprising a core amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:15. Also provided herein are expression vectors (such as a viral vector described herein) comprising a polynucleotide encoding the proteins described herein, such as a light-responsive channel protein comprising a core amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:15.
Chloride Ion Pumps
[0091] In some aspects, said one or more light-responsive chloride pump proteins expressed on the plasma membranes of the neurons described above can be derived from Natronomonas pharaonis. In some embodiments, the light-responsive chloride pump proteins can be responsive to amber light as well as red light and can mediate a hyperpolarizing current in the neuron when the light-responsive chloride pump proteins are illuminated with amber or red light. The wavelength of light which can activate the light-responsive chloride pumps can be between about 580 and 630 nm. In some embodiments, the light can be at a wavelength of about 589 nm or the light can have a wavelength greater than about 630 nm (e.g. less than about 740 nm). In another embodiment, the light has a wavelength of around 630 nm. In some embodiments, the light-responsive chloride pump protein can hyperpolarize a neural membrane for at least about 90 minutes when exposed to a continuous pulse of light. In some embodiments, the light-responsive chloride pump protein can comprise an amino acid sequence at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:16. Additionally, the light-responsive chloride pump protein can comprise substitutions, deletions, and/or insertions introduced into a native amino acid sequence to increase or decrease sensitivity to light, increase or decrease sensitivity to particular wavelengths of light, and/or increase or decrease the ability of the light-responsive protein to regulate the polarization state of the plasma membrane of the cell. In some embodiments, the light-responsive chloride pump protein contains one or more conservative amino acid substitutions. In some embodiments, the light-responsive protein contains one or more non-conservative amino acid substitutions. The light-responsive protein comprising substitutions, deletions, and/or insertions introduced into the native amino acid sequence suitably retains the ability to hyperpolarize the plasma membrane of a neuronal cell in response to light.
[0092] Additionally, in other aspects, the light-responsive chloride pump protein can comprise a core amino acid sequence at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:16 and an endoplasmic reticulum (ER) export signal. This ER export signal can be fused to the C-terminus of the core amino acid sequence or can be fused to the N-terminus of the core amino acid sequence. In some embodiments, the ER export signal is linked to the core amino acid sequence by a linker. The linker can comprise any of about 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length. The linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein. In some embodiments, the ER export signal can comprise the amino acid sequence FXYENE (SEQ ID NO:46), where X can be any amino acid. In another embodiment, the ER export signal can comprise the amino acid sequence VXXSL (SEQ ID NO:42), where X can be any amino acid. In some embodiments, the ER export signal can comprise the amino acid sequence FCYENEV (SEQ ID NO:47).
[0093] Endoplasmic reticulum (ER) export sequences that are suitable for use in a modified opsin of the present disclosure include, e.g., VXXSL (where X is any amino acid) (SEQ ID NO:42) (e.g., VKESL (SEQ ID NO:43); VLGSL (SEQ ID NO:44); etc.); NANSFCYENEVALTSK (SEQ ID NO:45); FXYENE (where X is any amino acid) (SEQ ID NO:46), e.g., FCYENEV (SEQ ID NO:47); and the like. An ER export sequence can have a length of from about 5 amino acids to about 25 amino acids, e.g., from about 5 amino acids to about 10 amino acids, from about 10 amino acids to about 15 amino acids, from about 15 amino acids to about 20 amino acids, or from about 20 amino acids to about 25 amino acids.
[0094] In other aspects, the light-responsive chloride pump proteins described herein can comprise a light-responsive protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:16 and a trafficking signal (e.g., which can enhance transport of the light-responsive chloride pump protein to the plasma membrane). The trafficking signal may be fused to the C-terminus of the core amino acid sequence or may be fused to the N-terminus of the core amino acid sequence. In some embodiments, the trafficking signal can be linked to the core amino acid sequence by a linker which can comprise any of about 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length. The linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein. In some embodiments, the trafficking signal can be derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1. In other embodiments, the trafficking signal can comprise the amino acid sequence KSRITSEGEYIPLDQIDINV (SEQ ID NO:37).
[0095] In some aspects, the light-responsive chloride pump protein can comprise a core amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:16 and at least one (such as one, two, three, or more) amino acid sequence motifs which enhance transport to the plasma membranes of mammalian cells selected from the group consisting of an ER export signal, a signal peptide, and a membrane trafficking signal. In some embodiments, the light-responsive chloride pump protein comprises an N-terminal signal peptide, a C-terminal ER Export signal, and a C-terminal trafficking signal. In some embodiments, the C-terminal ER Export signal and the C-terminal trafficking signal can be linked by a linker. The linker can comprise any of about 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length. The linker can also further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein. In some embodiments the ER Export signal can be more C-terminally located than the trafficking signal. In other embodiments the trafficking signal is more C-terminally located than the ER Export signal. In some embodiments, the signal peptide comprises the amino acid sequence MTETLPPVTESAVALQAE (SEQ ID NO:48). In another embodiment, the light-responsive chloride pump protein comprises an amino acid sequence at least 95% identical to SEQ ID NO:17.
[0096] Moreover, in other aspects, the light-responsive chloride pump proteins can comprise a core amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:16, wherein the N-terminal signal peptide of SEQ ID NO:16 is deleted or substituted. In some embodiments, other signal peptides (such as signal peptides from other opsins) can be used. The light-responsive protein can further comprise an ER transport signal and/or a membrane trafficking signal described herein. In some embodiments, the light-responsive chloride pump protein comprises an amino acid sequence at least 95% identical to SEQ ID NO:18.
[0097] In some embodiments, the light-responsive opsin protein is a NpHR opsin protein comprising an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identical to the sequence shown in SEQ ID NO:16. In some embodiments, the NpHR opsin protein further comprises an endoplasmic reticulum (ER) export signal and/or a membrane trafficking signal. For example, the NpHR opsin protein comprises an amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO:16 and an endoplasmic reticulum (ER) export signal. In some embodiments, the amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO:16 is linked to the ER export signal through a linker. In some embodiments, the ER export signal comprises the amino acid sequence FXYENE (SEQ ID NO:46), where X can be any amino acid. In another embodiment, the ER export signal comprises the amino acid sequence VXXSL (SEQ ID NO:42), where X can be any amino acid. In some embodiments, the ER export signal comprises the amino acid sequence FCYENEV (SEQ ID NO:47). In some embodiments, the NpHR opsin protein comprises an amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO:16, an ER export signal, and a membrane trafficking signal. In other embodiments, the NpHR opsin protein comprises, from the N-terminus to the C-terminus, the amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO:16, the ER export signal, and the membrane trafficking signal. In other embodiments, the NpHR opsin protein comprises, from the N-terminus to the C-terminus, the amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO:16, the membrane trafficking signal, and the ER export signal. In some embodiments, the membrane trafficking signal is derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1. In some embodiments, the membrane trafficking signal comprises the amino acid sequence KSRITSEGEYIPLDQIDINV (SEQ ID NO:37). In some embodiments, the membrane trafficking signal is linked to the amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO:16 by a linker. In some embodiments, the membrane trafficking signal is linked to the ER export signal through a linker. The linker may comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length. The linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein. In some embodiments, the light-responsive opsin protein further comprises an N-terminal signal peptide. In some embodiments, the light-responsive opsin protein comprises the amino acid sequence of SEQ ID NO:17. In some embodiments, the light-responsive opsin protein comprises the amino acid sequence of SEQ ID NO:18.
[0098] Also provided herein are polynucleotides encoding any of the light-responsive chloride ion pump proteins described herein, such as a light-responsive protein comprising a core amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:16, an ER export signal, and a membrane trafficking signal. In another embodiment, the polynucleotides comprise a sequence which encodes an amino acid at least 95% identical to SEQ ID NO:17 and SEQ ID NO:18. The polynucleotides may be in an expression vector (such as, but not limited to, a viral vector described herein). The polynucleotides may be used for expression of the light-responsive chloride ion pump proteins.
[0099] Further disclosure related to light-responsive chloride pump proteins can be found in U.S. Patent Application Publication Nos: 2009/0093403 and 2010/0145418 as well as in International Patent Application No: PCT/US2011/028893, the disclosures of each of which are hereby incorporated by reference in their entireties.
Chlorella vulgaris Type 1 Rhodopsin
[0100] In some embodiments, a suitable light-responsive polypeptide is a rhodopsin from Coccomyxa subellipsoidea (Chlorella vulgaris). In some embodiments, a suitable light-responsive polypeptide comprises an amino acid sequence that is at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:62. Additionally, the light-responsive polypeptide can comprise substitutions, deletions, and/or insertions introduced into a native amino acid sequence to increase or decrease sensitivity to light, increase or decrease sensitivity to particular wavelengths of light, and/or increase or decrease the ability of the light-responsive protein to regulate the polarization state of the plasma membrane of the cell. In some embodiments, the light-responsive polypeptide contains one or more conservative amino acid substitutions. In some embodiments, the light-responsive polypeptide contains one or more non-conservative amino acid substitutions. The light-responsive polypeptide comprising substitutions, deletions, and/or insertions introduced into the native amino acid sequence suitably retains the ability to hyperpolarize the plasma membrane of a neuronal cell in response to light.
[0101] In some cases, a suitable light-responsive polypeptide comprises an amino acid sequence that is at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:62; and comprises an ER export signal (e.g., FCYENEV (SEQ ID NO:47)). In some cases, a suitable light-responsive polypeptide comprises an amino acid sequence that is at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:62; and comprises a membrane trafficking signal (e.g., KSRITSEGEYIPLDQIDINV (SEQ ID NO:37)). In some cases, a suitable light-responsive polypeptide comprises an amino acid sequence that is at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:62; and comprises a membrane trafficking signal (e.g., KSRITSEGEYIPLDQIDINV (SEQ ID NO:37)) and an ER export signal (e.g., FCYENEV (SEQ ID NO:47)).
TABLE-US-00001 (SEQ ID NO: 62) MAVHQIGEGGLVMYWVTFGLMAFSALAFAVMTFTRPLNKRSHGYITLAIV TIAAIAYYAMAASGGKALVSNPDGNLRDIYYARYIDWFFTTPLLLLDIIL LTGIPIGVTLWIVLADVAMIMLGLFGALSTNSYRWGYYGVSCAFFFVVLW GLFFPGAKGARARGGQVPGLYFGLAGYLALLWFGYPIVWGLAEGSDYISV TAEAASYAGLDIAAKVVFGWAVMLSHPLIARNQTDGSLLINSTNDPFVAS TTHIPERQGGIFGGLMGKKRGAGTPLATNEGVPRKAAPTAATTTAGNPAT AAEVRTPRELMARL.
Response Proteins
[0102] As summarized above, aspects of the present disclosure include response proteins that allow one or more ions to pass through a membrane when the response protein detects the presence of one or more ions that have passed through a subject light-activated protein. Response proteins may be characterized as ion pump proteins, which facilitate the passage of a small number of ions through the membrane per action cycle, or as ion channel proteins, which allow a stream of ions to freely flow through the membrane. The subject response proteins are specific to a particular species of ion or to a particular group of ions (e.g., cations) meaning that the subject response proteins only allow ions of a particular species or group to pass through the membrane. In some cases, the response protein is a heterologous protein for a given cell, e.g., the response protein is one that is not normally expressed in the cell. In other cases, the response protein is native to a given cell, e.g., the response protein is one that is normally expressed in the cell. A response protein can be a mammalian protein (e.g., a human protein, a non-human protein), a bacterial protein, an archael protein, etc.
[0103] In some embodiments, the response protein is an ion channel. In some cases, the response protein is a cation channel, e.g., a potassium channel or a calcium channel. In some cases, the response protein is an anion channel, e.g., a chloride ion channel or a sodium channel. In other instances, the response protein is a proton pump. Response proteins can be voltage-gated or ligand-gated.
[0104] Non-limiting examples of suitable response proteins include, e.g., a voltage-gated potassium channel (e.g., KVLQT1); a potassium channel (e.g., HERG); an inward rectifier K.sup.+ channel (e.g., Kir2.1); an acid sensing sodium ion channel; and the like. In some cases, the response protein is an ion exchanger (antiporter), e.g. the sodium-calcium exchanger (NCX), the potassium-dependent sodium-calcium exchanger (SLC24) or the sodium-hydrogen exchanger (NhaA). In some cases, the response protein is an ion co-transporter of the symport variety, e.g. the sodium-potassium-chloride co-transporter (NKCC1 and NKCC2) or the sodium-phosphate co-transporter (SLC34A1).
[0105] For example, a suitable response protein can comprise an amino acid sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence identity to a contiguous stretch of from about 100 amino acid (aa) to about 200 aa, from about 200 aa to about 300 aa, from about 300 aa to about 400 aa, from about 400 aa to about 500 aa, from about 500 aa to about 600 aa, from about 600 aa to about 700 aa, from about 700 aa to about 800 aa, from about 800 aa to about 900 aa, from 900 aa to about 1000 aa, from about 1000 aa to about 1100 aa, up to the full length, of the amino acid sequence shown in one of FIGS. 14A-H (SEQ ID NOs:19-28).
Acid Sensing Ion Channel Variant 2a (ASIC2a)
[0106] In some embodiments, a response protein is an Acid Sensing Ion Channel variant 2a (ASIC2a) sodium ion channel protein that allows a plurality of sodium ions to flow across the plasma membrane of a target cell when the ASIC2a protein detects acidic conditions, such as the presence of a plurality of hydrogen ions on or near the external surface of the plasma membrane. In some embodiments, the ASIC2a protein can comprise an amino acid sequence that is at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:19. The ASIC2a protein can additionally comprise substitutions, deletions, and/or insertions introduced into a native amino acid sequence to increase or decrease sensitivity to acidic conditions, and/or increase or decrease the ability of the ASIC2a protein to regulate the flow of sodium ions across the plasma membrane of a target cell. Additionally, the ASIC2a protein can contain one or more conservative amino acid substitutions and/or one or more non-conservative amino acid substitutions. The ASIC2a protein comprising substitutions, deletions, and/or insertions introduced into the native amino acid sequence suitably retains the functionality of the ASIC2a protein.
[0107] In some embodiments, an ASIC2a protein comprises at least one (such as one, two, three, or more) amino acid sequence motifs that enhance transport to the plasma membranes of target cells selected from the group consisting of a signal peptide, an ER export signal, and a membrane trafficking signal. In some embodiments, the ASIC2a protein comprises an N-terminal signal peptide and a C-terminal ER export signal. In some embodiments, the ASIC2a protein comprises an N-terminal signal peptide and a C-terminal trafficking signal. In some embodiments, the ASIC2a protein comprises an N-terminal signal peptide, a C-terminal ER export signal, and a C-terminal trafficking signal. In some embodiments, the ASIC2a protein comprises a C-terminal ER export signal and a C-terminal trafficking signal. In some embodiments, the C-terminal ER export signal and the C-terminal trafficking signal are linked by a linker. The linker can comprise any of about 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length. The linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein. In some embodiments the ER export signal is more C-terminally located than the trafficking signal. In some embodiments the trafficking signal is more C-terminally located than the ER Export signal.
Helicobacter pylori Potassium Channel (HpKchA)
[0108] In some embodiments, a response protein is a Helicobacter pylori potassium ion channel protein (HpKchA) that allows a plurality of potassium ions to flow across the plasma membrane of a target cell when the HpKchA protein detects acidic conditions, such as the presence of a plurality of hydrogen ions on or near the external surface of the plasma membrane. In some embodiments, the HpKchA protein can comprise an amino acid sequence that is at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO:20. The HpKchA protein can additionally comprise substitutions, deletions, and/or insertions introduced into a native amino acid sequence to increase or decrease sensitivity to acidic conditions, and/or increase or decrease the ability of the HpKchA protein to regulate the flow of potassium ions across the plasma membrane of a target cell. Additionally, the HpKchA protein can contain one or more conservative amino acid substitutions and/or one or more non-conservative amino acid substitutions. The HpKchA protein comprising substitutions, deletions, and/or insertions introduced into the native amino acid sequence suitably retains the functionality of the HpKchA protein.
[0109] In some embodiments, an HpKchA protein comprises at least one (such as one, two, three, or more) amino acid sequence motifs that enhance transport to the plasma membranes of target cells selected from the group consisting of a signal peptide, an ER export signal, and a membrane trafficking signal. In some embodiments, the HpKchA protein comprises an N-terminal signal peptide and a C-terminal ER export signal. In some embodiments, the HpKchA protein comprises an N-terminal signal peptide and a C-terminal trafficking signal. In some embodiments, the HpKchA protein comprises an N-terminal signal peptide, a C-terminal ER export signal, and a C-terminal trafficking signal. In some embodiments, the HpKchA protein comprises a C-terminal ER export signal and a C-terminal trafficking signal. In some embodiments, the C-terminal ER export signal and the C-terminal trafficking signal are linked by a linker. The linker can comprise any of about 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length. The linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein. In some embodiments the ER export signal is more C-terminally located than the trafficking signal. In some embodiments the trafficking signal is more C-terminally located than the ER Export signal.
Fusion Proteins
[0110] In some cases, the light-responsive protein and the response protein are present together in a single polypeptide chain, e.g., the light-responsive protein and the response protein are a fusion protein. The present disclosure provides a two-component optogenetic fusion polypeptide comprising a light-responsive polypeptide and a response polypeptide.
[0111] In some embodiments, a subject two-component optogenetic fusion polypeptide comprises, in order from amino terminus to carboxyl terminus: a) a light-responsive polypeptide (as described above); and b) a response protein (as described above). In some embodiments, a subject two-component optogenetic fusion polypeptide comprises, in order from amino terminus to carboxyl terminus: a) a response protein; and b) a light-responsive polypeptide. In some embodiments, a subject two-component optogenetic fusion polypeptide comprises, in order from amino terminus to carboxyl terminus: a) a light-responsive polypeptide; b) a linker peptide; and c) a response protein. In some embodiments, a subject two-component optogenetic fusion polypeptide comprises, in order from amino terminus to carboxyl terminus: a) a light-responsive polypeptide; b) a membrane trafficking signal; and c) a response protein. In some embodiments, a subject two-component optogenetic fusion polypeptide comprises, in order from amino terminus to carboxyl terminus: a) a light-responsive polypeptide; b) a membrane trafficking signal; c) a response protein; and d) a membrane trafficking signal. In some embodiments, a subject two-component optogenetic fusion polypeptide comprises, in order from amino terminus to carboxyl terminus: a) a light-responsive polypeptide; b) a membrane trafficking signal; c) a self-cleaving polypeptide; d) a response protein; and e) a membrane trafficking signal.
[0112] In some embodiments, a subject two-component optogenetic fusion polypeptide comprises, in order from amino terminus to carboxyl terminus: a) a light-responsive polypeptide; b) a membrane trafficking signal; c) a spacer polypeptide; d) a response protein; and d) an ER export signal. In some embodiments, a subject two-component optogenetic fusion polypeptide comprises, in order from amino terminus to carboxyl terminus: a) a light-responsive polypeptide; b) a membrane trafficking signal; c) a spacer polypeptide; d) a response protein; e) a membrane trafficking signal; and f) an ER export signal. In some embodiments, a subject two-component optogenetic fusion polypeptide comprises, in order from amino terminus to carboxyl terminus: a) a light-responsive polypeptide; b) a membrane trafficking signal; c) a response protein; d) a membrane trafficking signal; and e) an ER export signal. In some embodiments, a subject two-component optogenetic fusion polypeptide comprises, in order from amino terminus to carboxyl terminus: a) a light-responsive polypeptide; b) a membrane trafficking signal; c) a self-cleaving polypeptide; d) a response protein; e) a membrane trafficking signal; and f) an ER export signal.
[0113] Suitable self-cleaving polypeptides include, e.g., a 2A peptide such as a P2A peptide: ATNFSLLKQAGDVEENPGP (SEQ ID NO:49); a T2A peptide: EGRGSLLTCGDVEENPGP (SEQ ID NO:50); an E2A peptide: QCTNYALLKLAGDVESNPGP (SEQ ID NO:51); an F2A peptide: VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO:52); and the like. In some cases, the self-cleaving peptide is a P2A peptide: ATNFSLLKQAGDVEENPGP (SEQ ID NO:49). In some cases, a P2A peptide comprises the amino acid sequence GSGATNFSLLKQAGDVEENPGP (SEQ ID NO:61).
[0114] In some embodiments, a subject two-component optogenetic fusion polypeptide comprises, in order from amino terminus to carboxyl terminus: a) an eArch polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the eArch polypeptide amino acid sequence set forth in SEQ ID NO:1; b) a membrane trafficking signal; c) an ASIC2a polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the ASIC2a polypeptide amino acid sequence set forth in SEQ ID NO:19; and d) a membrane trafficking signal. In some cases, the membrane trafficking signal is: KSRITSEGEYIPLDQIDINV (SEQ ID NO:37). In some of these embodiments, the two-component optogenetic fusion polypeptide further comprises an ER export signal (e.g., FCYENEV (SEQ ID NO:47).
[0115] In some embodiments, a subject two-component optogenetic fusion polypeptide comprises, in order from amino terminus to carboxyl terminus: a) an eArch polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the eArch polypeptide amino acid sequence set forth in SEQ ID NO:1; b) a membrane trafficking signal (e.g., KSRITSEGEYIPLDQIDINV (SEQ ID NO:37)); c) a polypeptide linker of from about 5 amino acids to about 100 amino acids, e.g., a polypeptide linker of from about 20 amino acids to about 25 amino acids in length; d) an ASIC2a polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the ASIC2a polypeptide amino acid sequence set forth in SEQ ID NO:19; and e) a membrane trafficking signal (e.g., KSRITSEGEYIPLDQIDINV (SEQ ID NO:37)). In some of these embodiments, the two-component optogenetic fusion polypeptide further comprises an ER export signal (e.g., FCYENEV (SEQ ID NO:47).
[0116] In some embodiments, a subject two-component optogenetic fusion polypeptide comprises, in order from amino terminus to carboxyl terminus: a) an eArch polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the eArch polypeptide amino acid sequence set forth in SEQ ID NO:1; b) a membrane trafficking signal (e.g., KSRITSEGEYIPLDQIDINV (SEQ ID NO:37)); c) a polypeptide linker of from about 5 amino acids to about 100 amino acids, e.g., a polypeptide linker of from about 40 amino acids to about 45 amino acids in length; d) an ASIC2a polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the ASIC2a polypeptide amino acid sequence set forth in SEQ ID NO:19; and e) a membrane trafficking signal (e.g., KSRITSEGEYIPLDQIDINV (SEQ ID NO:37)). In some of these embodiments, the two-component optogenetic fusion polypeptide further comprises an ER export signal (e.g., FCYENEV (SEQ ID NO:47).
[0117] In some embodiments, a subject two-component optogenetic fusion polypeptide comprises, in order from amino terminus to carboxyl terminus: a) an eArch polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the eArch polypeptide amino acid sequence set forth in SEQ ID NO:1; b) a membrane trafficking signal; c) a self-cleaving peptide (e.g., ATNFSLLKQAGDVEENPGP (SEQ ID NO:49)); d) an ASIC2a polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the ASIC2a polypeptide amino acid sequence set forth in SEQ ID NO:19; and e) a membrane trafficking signal. In some cases, the membrane trafficking signal is: KSRITSEGEYIPLDQIDINV (SEQ ID NO:37). In some of these embodiments, the two-component optogenetic fusion polypeptide further comprises an ER export signal (e.g., FCYENEV (SEQ ID NO:47).
[0118] Suitable linkers include "flexible linkers". If present, the linker polypeptide is generally of sufficient length to allow some flexible movement between the polypeptides connected by the linker. Suitable linkers can be readily selected and can be of any of a suitable of different lengths, such as from 5 amino acids to 100 amino acids, e.g., from 5 amino acids (aa) to 10 aa, from 10 aa to 15 aa, from 15 aa to 25 aa, from 25 aa to 40 aa, from 40 aa to 60 aa, from 60 aa to 80 aa, or from 80 aa to 100 aa. In some cases, the polypeptide linker, if present, is from 20 aa to 25 aa in length. In some cases, the polypeptide linker, if present, is from 40 aa to 45 aa in length.
[0119] Exemplary polypeptide linkers include glycine polymers (G).sub.n, glycine-serine polymers (including, for example, (GS).sub.n, (GSGGS).sub.n (SEQ ID NO:53) and (GGGS).sub.n(SEQ ID NO:54), where n is an integer of at least one, e.g., 1, 2, 3, 4, 5, or from 5 to 10), glycine-alanine polymers, alanine-serine polymers, and other polypeptide linkers known in the art. Exemplary flexible linkers include, but are not limited GGSG (SEQ ID NO:55), GGSGG (SEQ ID NO:56), GSGSG (SEQ ID NO:57), GSGGG (SEQ ID NO:58), GGGSG (SEQ ID NO:59), GSSSG (SEQ ID NO:60), and the like. The ordinarily skilled artisan will recognize that design of a linker polypeptide can include linkers that are all or partially flexible, such that the linker can include a flexible linker as well as one or more portions that confer less flexible structure.
[0120] In some cases, a subject two-component optogenetic fusion polypeptide comprises an amino acid sequence having at least 85%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence set forth in SEQ ID NO:31 (Champ 1.0). In some cases, a subject two-component optogenetic fusion polypeptide comprises an amino acid sequence having at least 85%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence set forth in SEQ ID NO:32 (Champ 2.0). In some cases, a subject two-component optogenetic fusion polypeptide comprises an amino acid sequence having at least 85%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence set forth in SEQ ID NO:33 (Champ 3.0). In some cases, a subject two-component optogenetic fusion polypeptide comprises an amino acid sequence having at least 85%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence set forth in SEQ ID NO:34 (Champ 4.0).
[0121] In some cases, a subject two-component optogenetic fusion polypeptide comprises an amino acid sequence having at least 85%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence set forth in SEQ ID NO:31 (Champ 1.0) without the yellow fluorescent protein (eYFP) sequence. In some cases, a subject two-component optogenetic fusion polypeptide comprises an amino acid sequence having at least 85%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence set forth in SEQ ID NO:32 (Champ 2.0) without the yellow fluorescent protein (eYFP) sequence. In some cases, a subject two-component optogenetic fusion polypeptide comprises an amino acid sequence having at least 85%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence set forth in SEQ ID NO:33 (Champ 3.0) without the yellow fluorescent protein (eYFP) sequence. In some cases, a subject two-component optogenetic fusion polypeptide comprises an amino acid sequence having at least 85%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the amino acid sequence set forth in SEQ ID NO:34 (Champ 4.0) without the yellow fluorescent protein (eYFP) sequence.
[0122] The present disclosure provides a nucleic acid comprising a nucleotide sequence encoding a fusion polypeptide as described above. The present disclosure provides a recombinant expression vector comprising a nucleic acid comprising a nucleotide sequence encoding a fusion polypeptide as described above. In some cases, the nucleotide sequence encoding the fusion polypeptide is operably linked to a neuron-specific transcriptional control element. Suitable expression vectors and neuron-specific transcriptional control elements are described herein. The present disclosure provides a cell genetically modified with a recombinant expression vector comprising a nucleic acid comprising a nucleotide sequence encoding a fusion polypeptide as described above. In some embodiments, the cell is a neuron.
Exemplary Systems
[0123] The present disclosure provides various compositions, which include, but are not limited to, the following:
[0124] a) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a proton pump; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is an ion channel, e.g., an anion channel;
[0125] b) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a proton pump; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is a chloride ion channel;
[0126] c) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a proton pump; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is an ion channel, e.g., a cation channel;
[0127] d) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a proton pump; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is a potassium ion channel;
[0128] e) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a proton pump; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is a sodium ion channel;
[0129] f) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a channelrhodopsin; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is an ion channel, e.g., an anion channel;
[0130] g) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a channelrhodopsin; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is a chloride ion channel;
[0131] h) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a channelrhodopsin; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is an ion channel, e.g., a cation channel;
[0132] i) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a channelrhodopsin; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is a potassium channel;
[0133] j) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a channelrhodopsin; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is a sodium channel;
[0134] k) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a channelrhodopsin; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is a proton pump;
[0135] l) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a proton pump; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is a proton pump;
[0136] m) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a chloride ion pump; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is an anion channel;
[0137] n) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a chloride ion pump; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is a cation channel;
[0138] o) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a chloride ion pump; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is a potassium channel;
[0139] p) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a chloride ion pump; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is a sodium channel; and
[0140] q) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a chloride ion pump; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is a proton pump.
[0141] The present disclosure provides various compositions, which include, but are not limited to, the following:
[0142] a) a composition comprising i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light responsive polypeptide is a ion pump or channel, and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein wherein the response protein an ion exchanger, transporter, antiporter, or symport co-transporter;
[0143] b) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a proton pump; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is a sodium-phosphate co-transporter;
[0144] c) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a proton pump; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is a sodium-potassium-chloride co-transporter;
[0145] d) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a proton pump; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is an ion exchanger (antiporter), e.g. a sodium-calcium exchanger, a potassium-dependent sodium-calcium exchanger, or a sodium-hydrogen exchanger;
[0146] e) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a channelrhodopsin; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is a sodium-phosphate co-transporter;
[0147] f) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a channelrhodopsin; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is a sodium-potassium-chloride co-transporter;
[0148] g) a composition comprising: i) a nucleic acid comprising a nucleotide sequence encoding a light-responsive polypeptide, where the light-responsive polypeptide is a channelrhodopsin; and ii) a nucleic acid comprising a nucleotide sequence encoding a response protein, wherein the response protein is an ion exchanger (antiporter), e.g. a sodium-calcium exchanger, a potassium-dependent sodium-calcium exchanger, or a sodium-hydrogen exchanger.
[0149] The present disclosure provides various compositions, which include, but are not limited to, the following:
[0150] a) a composition comprising a nucleic acid comprising a nucleotide sequence encoding a two-component optogenetic fusion polypeptide, as described above;
[0151] b) a composition comprising a nucleic acid comprising a two-component optogenetic fusion polypeptide that comprises, in order from amino terminus to carboxyl terminus: i) a light-responsive polypeptide (as described above); and ii) a response protein (as described above).
[0152] c) a composition comprising a nucleic acid comprising a two-component optogenetic fusion polypeptide that comprises, in order from amino terminus to carboxyl terminus: i) a response protein; and ii) a light-responsive polypeptide.
[0153] d) a composition comprising a nucleic acid comprising a two-component optogenetic fusion polypeptide that comprises, in order from amino terminus to carboxyl terminus: i) a light-responsive polypeptide; ii) a linker peptide; and ii) a response protein.
[0154] e) a composition comprising a nucleic acid comprising a two-component optogenetic fusion polypeptide that comprises, in order from amino terminus to carboxyl terminus: i) a light-responsive polypeptide; ii) a membrane trafficking signal; and iii) a response protein.
[0155] f) a composition comprising a nucleic acid comprising a two-component optogenetic fusion polypeptide that comprises, in order from amino terminus to carboxyl terminus: i) a light-responsive polypeptide; ii) a membrane trafficking signal; iii) a response protein; and iv) a membrane trafficking signal.
[0156] g) a composition comprising a nucleic acid comprising a two-component optogenetic fusion polypeptide that comprises, in order from amino terminus to carboxyl terminus: i) a light-responsive polypeptide; ii) a membrane trafficking signal; iii) a self-cleaving polypeptide; iv) a response protein; and v) a membrane trafficking signal.
[0157] h) a composition comprising a nucleic acid comprising a two-component optogenetic fusion polypeptide that comprises, in order from amino terminus to carboxyl terminus: i) an eArch polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the eArch polypeptide amino acid sequence set forth in SEQ ID NO:1; ii) a membrane trafficking signal; iii) an ASIC2a polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the ASIC2a polypeptide amino acid sequence set forth in SEQ ID NO:19; and iv) a membrane trafficking signal. In some cases, the membrane trafficking signal is: KSRITSEGEYIPLDQIDINV (SEQ ID NO:37). In some of these embodiments, the two-component optogenetic fusion polypeptide further comprises an ER export signal (e.g., FCYENEV (SEQ ID NO:47).
[0158] i) a composition comprising a nucleic acid comprising a two-component optogenetic fusion polypeptide that comprises, in order from amino terminus to carboxyl terminus: i) an eArch polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the eArch polypeptide amino acid sequence set forth in SEQ ID NO:1; ii) a membrane trafficking signal (e.g., KSRITSEGEYIPLDQIDINV (SEQ ID NO:37)); iii) a polypeptide linker of from about 5 amino acids to about 100 amino acids, e.g., a polypeptide linker of from about 20 amino acids to about 25 amino acids in length; iv) an ASIC2a polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the ASIC2a polypeptide amino acid sequence set forth in SEQ ID NO:19; and v) a membrane trafficking signal (e.g., KSRITSEGEYIPLDQIDINV (SEQ ID NO:37)). In some of these embodiments, the two-component optogenetic fusion polypeptide further comprises an ER export signal (e.g., FCYENEV (SEQ ID NO:47).
[0159] j) a composition comprising a nucleic acid comprising a two-component optogenetic fusion polypeptide that comprises, in order from amino terminus to carboxyl terminus: i) an eArch polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the eArch polypeptide amino acid sequence set forth in SEQ ID NO:1; ii) a membrane trafficking signal (e.g., KSRITSEGEYIPLDQIDINV (SEQ ID NO:37)); iii) a polypeptide linker of from about 5 amino acids to about 100 amino acids, e.g., a polypeptide linker of from about 40 amino acids to about 45 amino acids in length; iv) an ASIC2a polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the ASIC2a polypeptide amino acid sequence set forth in SEQ ID NO:19; and v) a membrane trafficking signal (e.g., KSRITSEGEYIPLDQIDINV (SEQ ID NO:37)). In some of these embodiments, the two-component optogenetic fusion polypeptide further comprises an ER export signal (e.g., FCYENEV (SEQ ID NO:47).
[0160] k) a composition comprising a nucleic acid comprising a two-component optogenetic fusion polypeptide that comprises, in order from amino terminus to carboxyl terminus: i) an eArch polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the eArch polypeptide amino acid sequence set forth in SEQ ID NO:1; ii) a membrane trafficking signal; iii) a self-cleaving peptide (e.g., ATNFSLLKQAGDVEENPGP (SEQ ID NO:49)); iv) an ASIC2a polypeptide comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100%, amino acid sequence identity to the ASIC2a polypeptide amino acid sequence set forth in SEQ ID NO:19; and v) a membrane trafficking signal. In some cases, the membrane trafficking signal is: KSRITSEGEYIPLDQIDINV (SEQ ID NO:37). In some of these embodiments, the two-component optogenetic fusion polypeptide further comprises an ER export signal (e.g., FCYENEV (SEQ ID NO:47).
[0161] In some cases, the above-noted nucleic acids are expression vectors comprising a nucleotide sequence encoding a light-responsive protein and/or a response protein. In some cases, a subject composition comprises a first expression vector that comprises a nucleotide sequence encoding a light-responsive protein; and a second expression vector that comprises a nucleotide sequence encoding a response protein. In some cases, a subject composition comprises a single expression vector that includes a nucleotide sequence encoding a light-responsive protein and a nucleotide sequence encoding a response protein. Where the composition comprises a single expression vector, in some cases, the nucleotide sequence encoding the light-responsive protein and the nucleotide sequence encoding the response protein are under transcriptional control (operably linked) to the same transcriptional control element (e.g., promoter). Where the composition comprises a single expression vector, in some cases, the nucleotide sequence encoding the light-responsive protein and the nucleotide sequence encoding the response protein are under transcriptional control (operably linked) to two different promoters.
[0162] The present disclosure provides a system for modulating the membrane potential of a cell, the system comprising: i) a first nucleic acid comprising a nucleotide sequence encoding a light-activated protein that is adapted to allow a first ion to pass through a cell membrane in response to light; ii) a second nucleic acid comprising a nucleotide sequence encoding a response protein that responds to the passage of the first ion through the cell membrane by allowing a second ion to pass through the cell membrane; and iii) a device configured to illuminate a target location with a light. Any of the above-noted combinations of nucleic acids can be included in a subject system.
Polynucleotides and Vectors
[0163] Aspects of the present disclosure include nucleic acids, such as polynucleotides, that comprise a nucleotide sequence that encodes one or more of the subject proteins described herein (e.g., one or more light-activated proteins or response proteins as described above). In some embodiments, a subject polynucleotide comprises an expression cassette, wherein the expression cassette contains a plurality of components (e.g., a plurality of coding sequences) that are utilized to express one or more proteins encoded by the polynucleotide in a target cell.
[0164] In some embodiments, a portion of a polynucleotide encoding a subject protein is operably linked to a promoter sequence. Any suitable promoter that functions in a target cell can be used for expression of the subject polynucleotides. In certain embodiments, a promoter sequence can be a promoter that is specific to a particular target cell type or to a particular tissue type, such as a particular neuron or a pan-neuronal promoter. Initiation control regions of promoters, which are useful to drive expression of polynucleotides in a specific animal cell, are numerous and familiar to those skilled in the art. Virtually any promoter capable of driving expression of the subject polynucleotides can be used. In some embodiments, the promoter used to drive expression of a subject protein can be the Thy1 promoter (See, e.g., Llewellyn, et al., 2010, Nat. Med., 16(10):1161-1166). In some embodiments, the promoter used to drive expression of a subject protein can be a human synapsin (hSyn) promoter, a human elongation factor 1-.alpha. (EF1.alpha.) promoter, a cytomegalovirus (CMV) promoter, a CMV early enhancer/chicken .beta. actin (CAG) promoter, a synapsin-I promoter (e.g., a human synapsin-I promoter), a human synuclein 1 promoter, a human Thy1 promoter, a calcium/calmodulin-dependent kinase II alpha (CAMKII.alpha.) promoter, or any other promoter capable of driving expression of the a subject nucleic acid sequence in a target cell.
[0165] In some embodiments, a promoter may be an inducible promoter. For example, the promoter may be induced by a trans-acting factor that responds to an exogenously administered drug. Examples of inducible promoters include, but are not limited to, tetracycline-on or tetracycline-off promoters, or tamoxifen-inducible CreER.
[0166] In some embodiments, a subject polynucleotide may comprise a ribosomal skip sequence that can be used to generate two separate proteins from the same transcript. In such embodiments, a subject polynucleotide will typically include a coding sequence that encodes a light-activated protein as well as a response protein. In these embodiments, a ribosomal skip sequence may be placed between the two coding sequences to produce two distinct proteins (namely, the light-activated protein and the response protein) from the same transcript.
[0167] Also provided herein are vectors comprising the subject polynucleotides or any variant thereof as described herein. Vectors according to the present disclosure also include vectors comprising a nucleotide sequence that encodes an RNA (e.g., an mRNA) that when transcribed from the polynucleotides of the vector will result in the accumulation of a subject protein on the plasma membranes of target cells. Vectors which may be used include, without limitation, lentiviral, HSV, adenoviral, and adeno-associated viral (AAV) vectors. Lentiviruses include, but are not limited to HIV-1, HIV-2, SIV, FIV and EIAV. Lentiviruses may be pseudotyped with the envelope proteins of other viruses, including, but not limited to VSV, rabies, Mo-MLV, baculovirus and Ebola. Such vectors may be prepared using standard methods in the art.
[0168] In some embodiments, a vector may be a recombinant AAV vector. AAV vectors are DNA viruses of relatively small size that can integrate, in a stable and site-specific manner, into the genome of the cells that they infect. They are able to infect a wide spectrum of cells without inducing any effects on cellular growth, morphology or differentiation, and they do not appear to be involved in human pathologies. The AAV genome has been cloned, sequenced and characterized. It encompasses approximately 4700 bases and contains an inverted terminal repeat (ITR) region of approximately 145 bases at each end, which serves as an origin of replication for the virus. The remainder of the genome is divided into two essential regions that carry the encapsidation functions: the left-hand part of the genome that contains the rep gene involved in viral replication and expression of the viral genes; and the right-hand part of the genome that contains the cap gene encoding the capsid proteins of the virus.
[0169] AAV vectors may be prepared using standard methods in the art. Adeno-associated viruses of any serotype are suitable (see, e.g., Blacklow, pp. 165-174 of "Parvoviruses and Human Disease" J. R. Pattison, ed. (1988); Rose, Comprehensive Virology 3:1, 1974; P. Tattersall "The Evolution of Parvovirus Taxonomy" In Parvoviruses (J R Kerr, S F Cotmore. M E Bloom, R M Linden, C R Parrish, Eds.) p 5-14, Hudder Arnold, London, U K (2006); and D E Bowles, J E Rabinowitz, R J Samulski "The Genus Dependovirus" (J R Kerr, S F Cotmore. M E Bloom, R M Linden, C R Parrish, Eds.) p 15-23, Hudder Arnold, London, UK (2006), the disclosures of each of which are hereby incorporated by reference herein in their entireties). Methods for purifying for vectors may be found in, for example, U.S. Pat. Nos. 6,566,118, 6,989,264, and 6,995,006 and WO/1999/011764 titled "Methods for Generating High Titer Helper-free Preparation of Recombinant AAV Vectors", the disclosures of which are herein incorporated by reference in their entirety. Methods of preparing AAV vectors in a baculovirus system are described in, e.g., WO 2008/024998. AAV vectors can be self-complementary or single-stranded. Preparation of hybrid vectors is described in, for example, PCT Application No. PCT/US2005/027091, the disclosure of which is herein incorporated by reference in its entirety. The use of vectors derived from the AAVs for transferring genes in vitro and in vivo has been described (See e.g., International Patent Application Publication Nos.: 91/18088 and WO 93/09239; U.S. Pat. Nos. 4,797,368, 6,596,535, and 5,139,941; and European Patent No.: 0488528, all of which are hereby incorporated by reference herein in their entireties). These publications describe various AAV-derived constructs in which the rep and/or cap genes are deleted and replaced by a gene of interest, and the use of these constructs for transferring the gene of interest in vitro (into cultured cells) or in vivo (directly into an organism). The replication-defective recombinant AAVs according to the present disclosure can be prepared by co-transfecting a plasmid containing the nucleic acid sequence of interest flanked by two AAV inverted terminal repeat (ITR) regions, and a plasmid carrying the AAV encapsidation genes (rep and cap genes), into a cell line that is infected with a human helper virus (for example an adenovirus). The AAV recombinants that are produced are then purified by standard techniques.
[0170] In some embodiments, the vector(s) for use in the methods of the present disclosure are encapsidated into a virus particle (e.g. AAV virus particle including, but not limited to, AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAV14, AAV15, and AAV16). Accordingly, the present disclosure includes a recombinant virus particle (recombinant because it contains a recombinant polynucleotide) comprising any of the vectors described herein. Methods of producing such particles are known in the art and are described in U.S. Pat. No. 6,596,535, the disclosure of which is hereby incorporated by reference in its entirety.
[0171] FIG. 5 provides an example of a subject polynucleotide. The depicted polynucleotide, from 5' to 3', comprises a light-activated protein sequence (Arch), a trafficking sequence (ts), a ribosomal skip sequence (p2A), a response protein sequence (ASIC2a), and a yellow fluorescent protein sequence (EYFP). FIG. 6 provides an different example of a subject polynucleotide. The depicted polynucleotide, from 5' to 3', comprises a light-activated protein sequence (Arch), a trafficking sequence (ts), a ribosomal skip sequence (p2A), a response protein sequence (ASIC2a), a trafficking sequence (ts), a yellow fluorescent protein sequence (EYFP), and an endoplasmic reticulum export sequence (ER).
[0172] FIG. 7 provides an example of a subject vector. The depicted vector includes, from 5' to 3', a CamKII promoter sequence, an Arch coding sequence, a trafficking sequence (ts), a ribosomal skip sequence (p2A), an ASIC2a coding sequence, a trafficking sequence (ts), a yellow fluorescent protein sequence (EYFP), and an endoplasmic reticulum export sequence (ER). FIG. 8 provides another example of a subject vector. The depicted vector includes, from 5' to 3', an hSyn promoter sequence, an Arch coding sequence, a trafficking sequence (ts), a ribosomal skip sequence (p2A), an ASIC2a coding sequence, and a yellow fluorescent protein sequence (EYFP).
Pharmaceutical Compositions
[0173] Aspects of the present disclosure include pharmaceutical compositions that comprise the subject polynucleotides, vectors, or components thereof. The subject pharmaceutical compositions may be administered to a subject for purposes genetically modifying a target cell so that the target cell expresses one or more subject proteins. A subject pharmaceutical composition may, in some embodiments, comprise a pharmaceutically acceptable excipient. In some embodiments, a pharmaceutical composition may comprise components to facilitate delivery of the subject polynucleotides or vectors to a target cell, including but not limited to transfection reagents or components thereof, such as lipids, polymers, and the like.
[0174] In some embodiments, a subject pharmaceutical composition will be suitable for injection into a subject, e.g., will be sterile. For example, in some embodiments, a subject pharmaceutical composition will be suitable for injection into a subject, e.g., where the composition is sterile and is free of detectable pyrogens and/or other toxins.
[0175] Pharmaceutically acceptable excipients, such as vehicles, adjuvants, carriers or diluents, are readily available to the public. Moreover, pharmaceutically acceptable auxiliary substances, such as pH adjusting and buffering agents, tonicity adjusting agents, stabilizers, wetting agents and the like, are readily available to the public as well, and may be incorporated into the pharmaceutical compositions of the present disclosure without limitation.
Target Cells and Tissues
[0176] As summarized above, aspects of the present disclosure include delivering the subject polynucleotides, or components thereof, to target cells. Target cells are generally cells that carry or transmit electrical impulses, such as nerve cells. In some embodiments, a target cell may be, e.g., a sensory neuron, a motor neuron, or an interneuron. Target cells of the disclosure may include cells of the central nervous system and/or cells of the peripheral nervous system. In some embodiments, a target tissue may include a plurality of nerve fibers, a nerve, a nerve cell ganglion, a neuromuscular junction, a tissue that is innervated by nerves, including but not limited to muscle, skin, or endocrine tissue, or an anatomical region, such as a portion or sub-portion of the brain or spinal cord. In some embodiments, a target tissue may be a portion of an individual cell, such as specific axon of a nerve cell.
[0177] Once the subject polynucleotides have been delivered to a target cell or tissue, the polynucleotides enter the target cells and are expressed. In some embodiments, the subject polynucleotides may contain tissue-specific promoters so that expression only occurs in target cells wherein the tissue-specific promoter is active. In this way, if a subject polynucleotide is delivered to cells other than a target cell, the polynucleotide will not be expressed in the non-target cells because the tissue-specific promoter will be inactive in those cells. In some embodiments, a subject polynucleotide may contain an inducible promoter, such that expression of the polynucleotide only takes place when an exogenously administered drug is present is a sufficient concentration within the cell to activate the promoter.
[0178] In some cases, the present disclosure provides methods for modulating activity of a target cell that expresses a light-responsive protein and a response protein, as described above, where the method involves activating the light-responsive protein with light. In some cases, the present disclosure provides methods for modulating activity of a target cell that is proximal to a cell that expresses a light-responsive protein and a response protein, as described above, where the method involves activating the light-responsive protein with light. Thus, the target cell may not express the light-responsive protein and the response protein, but the activity of the target cell is modulated upon activating with light the light-responsive protein in a cell proximal to the target cell. A target cell that is "proximal" to a cell that expresses a light-responsive protein and a response protein, as described above, includes a cell that is in direct physical contact with the cell that expresses a light-responsive protein and a response protein, as described above. A target cell that is "proximal" to a cell that expresses a light-responsive protein and a response protein, as described above, includes a cell that is not in direct physical contact with the cell that expresses a light-responsive protein and a response protein, as described above, but whose activity is modulated by the cell that expresses a light-responsive protein and a response protein, as described above, e.g., modulated by neurotransmitter produced by the cell that expresses a light-responsive protein and a response protein, as described above; etc.
Devices
[0179] As summarized above, aspects of the present disclosure include various devices that can be used to carry out aspects of the subject methods. Devices that find use in the subject methods include delivery devices that can be used to deliver the subject polynucleotides to target cells and tissues, light-generating devices that can be used to illuminate target cells that express the subject light-activated proteins, and control devices that can be used to control the delivery of light to specific target cells or tissues. Each of these devices is further described below.
Delivery Devices
[0180] Aspects of the present disclosure include delivery devices that can be used to deliver a subject pharmaceutical composition to a target cell. The subject delivery devices may provide regular, irregular, programmed, or clinician- or patient-activated doses of the subject pharmaceutical compositions to one or more target cells to ensure that the target cells continue to express the subject proteins.
[0181] The subject delivery devices may generally include various components, such as reservoirs, pumps, actuators, tubing components, needles, catheters, and any other suitable components for delivering the subject pharmaceutical compositions to a target cell or tissue of a patient. Delivery devices may also include components that facilitate computerized operation, such as a power source, a processor comprising a memory, a user input device, and/or a graphical user interface. In some embodiments, a delivery device may be completely or partially implantable within a patient. In some embodiments, a delivery device may be operated by a caregiver, wherein the device is introduced into a portion of the patient's body, e.g., into the patient's brain, and a subject pharmaceutical composition is delivered to a target tissue, e.g., a portion of the patient's brain. In some embodiments, following delivery of the pharmaceutical composition, the device may be removed. In other embodiments, the device may be kept in place for later delivery of additional pharmaceutical compositions.
Light-Generating Devices
[0182] Aspects of the present disclosure include light-generating devices that can be used to deliver light to target cells that express one or more of the subject proteins. Light-generating devices in accordance with embodiments of the present disclosure can generally produce light of a variety of different wavelengths from one or more light sources on the device. In some embodiments, a light-generating device may include a light cuff or sleeve that can be placed around or near target cells expressing one or more subject proteins. In some embodiments, a portion of the light source or the entire light source may be implantable. The subject light-generating devices may be of any useful configuration for stimulating the light-activated proteins disclosed herein. In some embodiments, for example, a light-generating device may comprise components that facilitate exclusive illumination of a target cell or tissue. For example, in some embodiments, a light-generating device may exclusively direct light to a target cell, a portion of a target cell, e.g., a particular axon of a nerve cell, or a specific anatomical structure, such as, e.g. a bundle of nerve fibers, a target tissue, or a portion of the spinal cord. By "exclusively direct light" is meant that the light-generating device only delivers light to the specific target structure, and does not illuminate other structures. For examples, in some embodiments, a light-generating device may be configured to illuminate an axon of a nerve cell, but not illuminate any other portion of the nerve cell. In this way, the light from the light-generating device only affects light-activated proteins in the specific target structure that is illuminated.
[0183] In some embodiments, a light-generating device may not completely surround the region containing a target cell expressing a light-activated protein, but, rather, can have a U-shape. In some embodiments, a light-generating device can have an attachment arm that can be used to guide the light-generating device to a specific region or target structure, e.g., a specific neuronal region. The attachment arm can be removed following implantation of the light-generating device or can be left in place to fix the position of the light-generating device in proximity to the target cells of interest.
[0184] In some embodiments, the subject light-generating devices may comprise an inner body, the inner body having at least one means for generating light which is connected to a power source. In some embodiments, the power source can be an internal battery for powering the light-generating device. In some embodiments, an implantable light-generating device may comprise an external antenna for receiving wirelessly transmitted electromagnetic energy from an external source for powering device. The wirelessly transmitted electromagnetic energy can be a radio wave, a microwave, or any other electromagnetic energy source that can be transmitted from an external source to power the light-generating device. In some embodiments, the light-generating device is controlled by, e.g., an integrated circuit produced using semiconductor or other processes known in the art.
[0185] In some embodiments, the light-generating device may comprise a light emitting diode (LED). In some embodiments, the LED can generate blue and/or green light. In other embodiments, the LED can generate amber and/or yellow light. In some embodiments, several micro LEDs are embedded into the inner body of the light-generating device. In other embodiments, the light-generating device is a solid state laser diode or any other means capable of generating light. The light-generating device can generate light having a wavelength and intensity sufficient to activate a subject light-activated protein. In some embodiments, a light-generating device produces light having an intensity of any of about 0.05 mW/mm.sup.2, 0.1 mW/mm.sup.2, 0.2 mW/mm.sup.2, 0.3 mW/mm.sup.2, 0.4 mW/mm.sup.2, 0.5 mW/mm.sup.2, about 0.6 mW/mm.sup.2, about 0.7 mW/mm.sup.2, about 0.8 mW/mm.sup.2, about 0.9 mW/mm.sup.2, about 1.0 mW/mm.sup.2, about 1.1 mW/mm.sup.2, about 1.2 mW/mm.sup.2, about 1.3 mW/mm.sup.2, about 1.4 mW/mm.sup.2, about 1.5 mW/mm.sup.2, about 1.6 mW/mm.sup.2, about 1.7 mW/mm.sup.2, about 1.8 mW/mm.sup.2, about 1.9 mW/mm.sup.2, about 2.0 mW/mm.sup.2, about 2.1 mW/mm.sup.2, about 2.2 mW/mm.sup.2, about 2.3 mW/mm.sup.2, about 2.4 mW/mm.sup.2, about 2.5 mW/mm.sup.2, about 3 mW/mm.sup.2, about 3.5 mW/mm.sup.2, about 4 mW/mm.sup.2, about 4.5 mW/mm.sup.2, about 5 mW/mm.sup.2, about 5.5 mW/mm.sup.2, about 6 mW/mm.sup.2, about 7 mW/mm.sup.2, about 8 mW/mm.sup.2, about 9 mW/mm.sup.2, or about 10 mW/mm.sup.2, inclusive, including values in between these numbers. In some embodiments, the light-generating device produces light having an intensity of at least about 10 Hz, such as up to about 25 Hz, such as up to about 50 Hz, such as up to about 75 Hz, such as up to about 100 Hz.
[0186] The subject light-generating devices are generally capable of generating light having a wavelength ranging from about 350 nm, up to about 360 nm, up to about 370 nm, up to about 380 nm, up to about 390 nm, up to about 400 nm, up to about 410 nm, up to about 420 nm, up to about 430 nm, up to about 440 nm, up to about 450 nm, up to about 460 nm, up to about 470 nm, up to about 480 nm, up to about 490 nm, up to about 500 nm, up to about 510 nm, up to about 520 nm, up to about 530 nm, up to about 540 nm, up to about 550 nm, up to about 560 nm, up to about 570 nm, up to about 580 nm, up to about 590 nm, up to about 600 nm, up to about 610 nm, up to about 620 nm, up to about 630 nm, up to about 640 nm, up to about 650 nm, up to about 660 nm, up to about 670 nm, up to about 680 nm, up to about 690 nm, up to about 700 nm, up to about 710 nm, up to about 720 nm, up to about 730 nm, up to about 740 nm, and/or up to about 750 nm.
[0187] In some embodiments, a subject light-generating device may include one or more optical fibers that can transmit light from a light source and deliver the light to a target structure. The optical fibers may comprise plastic or glass materials, and in some embodiments may be suitably flexible to facilitate placement of the light-generating device in locations that could not be accommodated by rigid structures. For example, in some embodiments, a light-generating device may comprise a light source that generates light, as well as one or more optical fibers that can be placed in various locations on or in the patient's body. Light from the light source can pass through the optical fiber, passing around corners and bends in the optical fiber, and emerge at the end of the optical fiber to deliver light to a target structure.
[0188] In some embodiments, the subject light-generating devices may comprise a plurality of light sources that can be used to illuminate a target tissue with different wavelengths of light. For example, in some embodiments, a light-generating device may comprise a first light source that generates light of a first wavelength, e.g., red light, and a second light source that generates light of a second wavelength, e.g., green light. Such light-generating devices may be used to simultaneously illuminate the same target tissue with light of both wavelengths, or may alternately illuminate the target tissue with light of the first wavelength and light of the second wavelength. In some embodiments, such light generating devices may be used to deliver light from the same light source different target tissues. For example, in some embodiments a light-generating device may deliver light of a first wavelength to a first target tissue, and may deliver light of a second wavelength to a different target tissue.
Control Devices
[0189] Aspects of the present disclosure include control devices that can control, or modulate, the amount of light that is emitted from the subject light-generating devices. In some embodiments, a control device may be configured to modulate the wavelength and/or the intensity of light that is delivered to a target tissue from a light-generating device. In some embodiments, a control device may be configured to modulate the frequency and/or duration of light that is delivered to a target tissue from a light-generating device. For example, in some embodiments, a control device may be configured to deliver pulses of light from the light-generating device to a target tissue. The control device can modulate the frequency and/or duration of the light pulses such that the target tissue is illuminated with light from the light-generating device, e.g., at a regular or irregular rate, according to a user input, etc. In some embodiments, a control device can produce pulses of light from the light-generating device that have a duration ranging from about 1 millisecond or less, up to about 1 second, up to about 10 seconds, up to about 20 seconds, up to about 30 seconds, up to about 40 seconds, up to about 50 seconds, up to about 60 seconds or more. In some embodiments, a control device can produce pulses of light from the light-generating device that have a frequency of 1 pulse per millisecond, up to about 1 pulse per second, up about 1 pulse per minute, up to about 1 pulse per 10 minutes, up to about 1 pulse per 20 minutes, up to about 1 pulse per 30 minutes.
[0190] In some embodiments, a subject control device may comprise a power source that can be mounted to a transmitting coil. In some embodiments, a battery can be connected to the power source for providing power thereto. A switch can be connected to the power source, allowing an operator (e.g., a patient or caregiver) to manually activate or deactivate the power source. In some embodiments, upon activation of the switch, the power source can provide power to the light-generating device through electromagnetic coupling between the transmitting coil on the control device and an external antenna of an implantable light-generating device (such as a light cuff or sleeve). The transmitting coil can establish an electromagnetic coupling with the external antenna of the implantable light-generating device when in proximity thereof, for supplying power to the light-generating device and for transmitting one or more control signals to the light-generating device. In some embodiments, the electromagnetic coupling between the transmitting coil of the control device and the external antenna of the implantable light-generating device can be radio-frequency magnetic inductance coupling. When radio-frequency magnetic inductance coupling is used, the operational frequency of the radio wave can be between about 1 and 20 MHz, inclusive, including any values in between these numbers (for example, about 1 MHz, about 2 MHz, about 3 MHz, about 4 MHz, about 5 MHz, about 6 MHz, about 7 MHz, about 8 MHz, about 9 MHz, about 10 MHz, about 11 MHz, about 12 MHz, about 13 MHz, about 14 MHz, about 15 MHz, about 16 MHz, about 17 MHz, about 18 MHz, about 19 MHz, or about 20 MHz). However, other coupling techniques may be used, such as an optical receiver, infrared, or a biomedical telemetry system (See, e.g., Kiourti, "Biomedical Telemetry: Communication between Implanted Devices and the External World, Opticon1826, (8): Spring, 2010).
[0191] Turning now to FIG. 9, a first example of an optical stimulation system 100 is depicted. The optical stimulation system 100 comprises a delivery device 101 for delivering a subject polynucleotide to a target tissue, e.g., brain tissue 107 of a patient. Also provided are a light-generating device 102, a control device 103, and optical fibers 104 for conveying light generated by the light-generating device 102 to a light array 105 positioned on a light cuff 106.
[0192] Turning now to FIG. 10, a second example of an optical stimulation system 110 is depicted. The optical stimulation system 110 comprises a catheter 112 for delivering a subject polynucleotide to a target tissue, e.g., brain tissue 107 of a patient. Also provided are a light-generating device 102, a control device 103, and optical fibers 104 for conveying light generated by the light-generating device 102 to the end of the optical fibers 104.
[0193] Turning now to FIG. 11, a third example of an optical stimulation system 120 is depicted. The optical stimulation system 120 comprises a light-generating device 102, a control device 103, and optical fibers 104 for conveying light generated by the light-generating device 102 to various positions along the spinal cord 121 of the patient.
Methods
[0194] Aspects of the present disclosure include methods for optogenetic modulation of action potentials in target cells. The subject methods generally involve introducing a light-activated protein and a response protein into a target cell and illuminating the target cell with light of an activating wavelength. Illumination of the target cell with light of an activating wavelength causes the light-activated protein to allow one or more of a first species of ions to pass through the plasma membrane of the target cell. The presence of the first species of ions that passed through the light-activated protein causes the response protein to allow a second species of ions to pass through the plasma membrane of the target cell. The passage of the second species of ions through the plasma membrane of the target cell has a desired effect, such as, e.g., modulating the membrane potential of the plasma membrane, activating or inactivating an ion channel, etc. In some embodiments, the passage of the second ion species through the plasma membrane may be used to modulate one or more neurological responses or processes in a patient, and may therefore by used to treat a disease or condition in the patient. As such, in some embodiments, the subject methods involve treating a patient for a condition, such as a neurological condition, using the systems and devices provided herein. The subject methods are now described in greater detail below.
[0195] As discussed above, in some cases, a target cell does not express the light-responsive protein and the response protein, but the activity of the target cell is modulated upon activating with light the light-responsive protein in a cell proximal to the target cell. A target cell that is "proximal" to a cell that expresses a light-responsive protein and a response protein, as described above, includes a cell that is in direct physical contact with the cell that expresses a light-responsive protein and a response protein, as described above. A target cell that is "proximal" to a cell that expresses a light-responsive protein and a response protein, as described above, includes a cell that is not in direct physical contact with the cell that expresses a light-responsive protein and a response protein, as described above, but whose activity is modulated by the cell that expresses a light-responsive protein and a response protein, as described above, e.g., modulated by neurotransmitter produced by the cell that expresses a light-responsive protein and a response protein, as described above; etc.
Modulating Membrane Potentials in Target Cells
[0196] In some embodiments, the subject methods involve modulating membrane potentials in target cells using the subject systems and devices. In some embodiments, a nucleic acid encoding a subject light-activated protein and a subject response protein is introduced into a target cell such that the target cell expresses both the light-activated protein and the response protein. The target cell is then illuminated with light of an activating wavelength using a light-generating device. Illumination of the light-activated protein results in the movement of one or more ions of a first species through the plasma membrane of the cell in response to light. In some embodiments, for example, the light-activated protein is a proton pump, and in response to light moves proteins from the internal side of the plasma membrane to the external side of the plasma membrane.
[0197] Once the first ion species has been moved across the plasma membrane of the target cell, the response protein responds to the presence of the first ion species by transporting a second ion species across the plasma membrane of the target cell. In some embodiments, for example, the response protein is an acid sensing ion channel, such as, e.g., ASIC2a, which detects the presence of acidic conditions, such as the presence of protons on the external side of the plasma membrane, and responds by opening an ion channel, such as a sodium ion channel, that allows ions of a second species to pass through the plasma membrane. The passage of the second species of ions through the plasma membrane modulates the membrane potential of the cell by changing the charge distribution across the plasma membrane. For example, in some embodiments, the passage of the second species of ions through the plasma membrane results in a build-up of positive charge inside the cell, which modulates the membrane potential of the cell. As such, using the subject light-activated proteins in combination with the subject response proteins, the methods of the present disclosure can be used to modulate the membrane potential of a target cell in response to light of an activating wavelength.
Inhibiting Activity of Voltage-Gated Ion Channels
[0198] In some embodiments, the subject methods involve inhibiting the activity of voltage-gated sodium channels (VGSCs) that may be present in a nerve cell. VGSCs are a class of ion channels that are activated by changes in the membrane potential of nerve cells, and are generally involved with rapid, coordinated depolarization of nerve cell membranes in response to a given stimulus. For example, VGSCs are frequently found along the axons of nerve cells, and generally facilitate propagation of an action potential along the axon.
[0199] VGSCs function by allowing sodium ions to flow into the nerve cell from outside the plasma membrane. The flow of positively-charged sodium ions into the nerve cell changes the membrane potential and thereby propagates an action potential along the length of the nerve cell. Following activation, the VGSCs inactivate in a time-dependent manner. Once inactivated, the VGSC remains in a refractory inactivated state until the cell membrane potential repolarizes. As such, inactivation of VGSCs is a powerful technique for controlling nerve cell activity because, once inactivated, the VGSCs cannot regain activity until the nerve cell has repolarized.
[0200] In some embodiments, the subject methods involve inhibiting the activity of VGSCs by introducing into a nerve cell a light-activated protein, such as a light-activated proton pump (e.g., Arch), and a response protein, such as an acid sensing sodium ion channel (e.g., ASIC2a). Polynucleotides encoding these proteins are introduced into the nerve cell, and the proteins are expressed by the nerve cell and inserted into the plasma membrane of the nerve cell. Next, the nerve cell is illuminated with light of an activating wavelength from a light-generating device to cause the light-activated proton pump to transport protons through the plasma membrane from inside the cell to the outside of the cell. When the protons are present on or near the external surface of the plasma membrane, the response protein detects the presence of the protons and responds by opening a sodium ion channel. The sodium ion channel allows sodium ions to pass through the plasma membrane from outside the cell to the inside of the cell.
[0201] Once inside the nerve cell, the sodium ions depolarize the membrane sufficiently to inactivate one or more VGSCs in the plasma membrane. The inactivation of the VGSCs prevents the VGSCs from generating further action potentials in the nerve cell until the membrane repolarizes, which is facilitated by the cessation of light and decay of the response protein current, and the refractory period ends. As such, the propagation of action potentials along the nerve cell is blocked for the duration of the light pulse, the response protein current decay, and the refractory period. Accordingly, the subject methods may be used to block the propagation of an action potential along a nerve cell by introducing the subject proteins into the nerve cell plasma membrane and illuminating the cell with light of an activating wavelength from a light-generating device to inactivate one or more VGSCs in the nerve cell. Since the duration of action potential blockade outlasts the duration of the light pulse, inhibition of action potentials may be achieved using pulsed light delivery, rather than continuous light delivery.
[0202] In some embodiments, the subject methods involve inhibiting the activity of one or more voltage-gated calcium channels (VGCCs) that may be present in a target tissue. For example, in some cells and tissues, voltage-gated calcium channels (VGCCs) play analogous roles to those described above regarding voltage-gated sodium channels (VGSCs), and also exhibit voltage-dependent inactivation. Moreover, VGCCs also mediate neurotransmitter release, modulator and hormone release, and muscle contraction. Accordingly, in some embodiments, the subject methods involve inhibiting the activity of VGCCs by introducing into a target cell a light-activated protein, such as a light-activated proton pump (e.g., Arch), and a response protein, such as an acid sensing sodium ion channel (e.g., ASIC2a). Polynucleotides encoding these proteins are introduced into the target cell, and the proteins are expressed by the target cell and inserted into the plasma membrane of the target cell. Next, the target cell is illuminated with light of an activating wavelength from a light-generating device to cause the light-activated proton pump to transport protons through the plasma membrane from inside the cell to the outside of the cell. When the protons are present on or near the external surface of the plasma membrane, the response protein detects the presence of the protons and responds by opening a sodium ion channel. The sodium ion channel allows sodium ions to pass through the plasma membrane from outside the cell to the inside of the cell.
[0203] Once inside the target cell, the sodium ions depolarize the membrane sufficiently to inactivate one or more VGCCs in the plasma membrane. The inactivation of the VGCCs prevents the VGCCs from, e.g., generating further action potentials in the target cell; mediating the release of neurotransmitters, modulators, or hormones; mediating muscle contraction; and the like until the membrane repolarizes, which is facilitated by the cessation of light and decay of the response protein current, and the refractory period ends. As such, various functions of the VGCCs in the target cell are blocked for the duration of the light pulse, the response protein current decay, and the refractory period. Accordingly, the subject methods may be used to block various functions of VGCCs in a target cell by introducing the subject proteins into the target cell plasma membrane and illuminating the cell with light of an activating wavelength from a light-generating device to inactivate one or more VGCCs in the target cell. Since the duration of the VGCC blockade outlasts the duration of the light pulse, inhibition of VGCCs may be achieved using pulsed light delivery, rather than continuous light delivery.
Inhibiting and/or Blocking Retrograde Action Potentials in Nerve Cells
[0204] In some embodiments, the subject methods involve inhibiting and/or blocking the propagation of a retrograde action potential along a portion of a nerve cell (e.g., along an axon of a nerve cell) using the subject systems and devices. For example, in some embodiments, the subject methods involve introducing into a nerve cell a light-activated protein, such as a light-activated proton pump (e.g., Arch), and a response protein, such as an acid sensing sodium ion channel (e.g., ASIC2a). Polynucleotides encoding the proteins are introduced into the nerve cell, and the proteins are expressed by the nerve cell and inserted into the plasma membrane of the nerve cell.
[0205] Next, a light-generating device is positioned such that only a target portion of the nerve cell (e.g., only the axon, or only a portion of the axon, of the nerve cell) is illuminated with light of an activating wavelength when the light-generating device is activated. Next, the light-generating device is activated to deliver light to the desired portion of the nerve cell to cause the light-activated proton pump to transport protons through the plasma membrane from inside the cell to the outside of the cell. When the protons are present on or near the external surface of the plasma membrane, the response protein detects the presence of the protons and responds by opening a sodium ion channel. The sodium ion channel allows sodium ions to pass through the plasma membrane from outside the cell to the inside of the cell.
[0206] Once inside the cell, the sodium ions depolarize the membrane sufficiently to inactivate one or more VGSCs in the plasma membrane in the portion of the cell that is illuminated with light from the light-generating device. The inactivation of the VGSCs in the designated area of the nerve cell prevents the VGSCs from generating further action potentials in the nerve cell until the membrane repolarizes, which is facilitated by the cessation of light and decay of the response protein current, and the refractory period ends. As such, the propagation of action potentials along the nerve cell in the illuminated area is blocked for the duration of the light pulse, the response protein current decay and the refractory period. Accordingly, the subject methods may be used to block the propagation of an action potential along a particular portion of a nerve cell by introducing the subject proteins into the nerve cell plasma membrane and illuminating only a specific portion of the nerve cell with light of an activating wavelength from a light-generating device to inactivate one or more VGSCs in the illuminated portion of nerve cell or axon. Since the duration of action blockade outlasts the duration of the light pulse, inhibition of action potentials may be achieved using pulsed light delivery, rather than continuous light delivery. Accordingly, the subject methods may be used to block or inhibit the propagation of action potentials along a particular portion of a nerve cell or axon by delivering light of an activating wavelength to the specific portion of the nerve cell. Importantly, action potentials may still propagate through other portions of the nerve cell or axon that are not illuminated with light of a wavelength that activates the subject light-activated protein. In this way, specificity is achieved for restricting action potential propagation (anterograde and/or orthograde, and elicited naturally, optically, or electrically) to subdomains of the axonal arborization or cell.
Methods of Treatment
[0207] In some embodiments, the subject methods may be used to treat a patient for a condition or disorder, such as a neurological condition or disorder, by optogenetically modulating the action potentials of target cells within the patient. In some embodiments, the subject methods involve introducing a light-activated protein, such as such as a light-activated proton pump (e.g., Arch), and a response protein, such as an acid sensing sodium ion channel (e.g., ASIC2a) in a target tissue within the patient. In some embodiments, introduction of the subject proteins into the target tissue is accomplished using a subject delivery device. The polynucleotides encoding the subject proteins are introduced into the target tissue, and the proteins are expressed by nerve cells in the target tissue and inserted into the plasma membrane of the nerve cells.
[0208] Next, a light-generating device is positioned to illuminate the target tissue with light of an activating wavelength when the light-generating device is activated. The light-generating device is activated (either by the patient or by a caregiver) to deliver light to the target tissue to cause the light-activated proton pump to transport protons through the plasma membrane from inside a cell in the target tissue to the outside of the cell. When the protons are present on or near the external surface of the plasma membrane, the response protein detects the presence of the protons and responds by opening a sodium ion channel. The sodium ion channel allows sodium ions to pass through the plasma membrane from outside the cell to the inside of the cell.
[0209] Once inside the cell, the sodium ions depolarize the membrane sufficiently to inactivate one or more VGSCs in the plasma membrane in the portion of the cell that is illuminated with light from the light-generating device. The inactivation of the VGSCs in the designated area of the nerve cell prevents the VGSCs from generating further action potentials in the nerve cell until the membrane repolarizes, which is facilitated by the cessation of light and decay of the response protein current, and the refractory period ends. As such, the propagation of action potentials along the nerve cell is blocked for the duration of the light pulse, the response protein current decay and the refractory period. Accordingly, the subject methods may be used to block the propagation of an action potential in a nerve cell by introducing the subject proteins into the nerve cell plasma membrane and illuminating the nerve cell with light of an activating wavelength from a light-generating device to inactivate one or more VGSCs in the illuminated portion of nerve cell. As the duration of action blockade outlasts the duration of the light pulse, inhibition of action potentials may be achieved using pulsed light delivery, rather than continuous light delivery.
[0210] In some embodiments, the subject methods involve treating a subject for a disorder by inhibiting the activity of one or more voltage-gated calcium channels (VGCCs) that may be present in a target tissue. For example, in some cells and tissues, voltage-gated calcium channels (VGCCs) play analogous roles to those described above regarding voltage-gated sodium channels (VGSCs), and also exhibit voltage-dependent inactivation. Moreover, VGCCs also mediate neurotransmitter release, modulator and hormone release, and muscle contraction. Accordingly, in some embodiments, the subject methods involve treating a subject by inhibiting the activity of VGCCs by introducing into a target cell a light-activated protein, such as a light-activated proton pump (e.g., Arch), and a response protein, such as an acid sensing sodium ion channel (e.g., ASIC2a). Polynucleotides encoding these proteins are introduced into the target cell, and the proteins are expressed by the target cell and inserted into the plasma membrane of the target cell. Next, the target cell is illuminated with light of an activating wavelength from a light-generating device to cause the light-activated proton pump to transport protons through the plasma membrane from inside the cell to the outside of the cell. When the protons are present on or near the external surface of the plasma membrane, the response protein detects the presence of the protons and responds by opening a sodium ion channel. The sodium ion channel allows sodium ions to pass through the plasma membrane from outside the cell to the inside of the cell.
[0211] Once inside the target cell, the sodium ions depolarize the membrane sufficiently to inactivate one or more VGCCs in the plasma membrane. The inactivation of the VGCCs prevents the VGCCs from, e.g., generating further action potentials in the target cell; mediating the release of neurotransmitters, modulators, or hormones; mediating muscle contraction; and the like until the membrane repolarizes, which is facilitated by the cessation of light and decay of the response protein current, and the refractory period ends. As such, various functions of the VGCCs in the target cell are blocked for the duration of the light pulse, the response protein current decay, and the refractory period. Accordingly, the subject methods may be used to treat a subject for a disorder by blocking various functions of VGCCs in a target cell by introducing the subject proteins into the target cell plasma membrane and illuminating the cell with light of an activating wavelength from a light-generating device to inactivate one or more VGCCs in the target cell. Since the duration of the VGCC blockade outlasts the duration of the light pulse, inhibition of VGCCs may be achieved using pulsed light delivery, rather than continuous light delivery.
[0212] Accordingly, the subject methods may be used to treat any disease or condition in which blocking or inhibiting the propagation of an action potential along an excitable or nerve cell, or along a particular portion of an excitable or nerve cell, would have a therapeutic effect for the patient, or wherein blocking the function of a VGCC would have a therapeutic effect for the patient. Examples of therapeutic applications of the subject methods include, without limitation, therapy for cardiac rhythm disorders, such as pacing, cardioversion, defibrillation, resynchronization, or other cardiac-related conditions; gastrointestinal therapy, such as therapy to address obesity, motility disorders (e.g., gastroparesis), dyspepsia, or other therapies, therapy for pelvic floor tissue (e.g., sacral or pudendal nerve tissue) to support pelvic floor therapy such as pain therapy, urinary or fecal incontinence therapy, sexual dysfunction, or other therapies; cranial nerve therapy, such as therapy to relieve occipital neuralgia, trigeminal neuralgia, facial pain, migraine headaches; therapy for the treatment of pain, such as nociceptive pain or neuropathic pain; therapy for neurological and/or psychiatric conditions; therapy for endocrine conditions; or the like.
[0213] Specificity can be achieved as above for restricting action potential propagation (anterograde and/or orthograde, and elicited naturally, optically, or electrically) to subdomains of the axonal arborization or cell.
Combination Treatment Methods
[0214] In some embodiments, the subject methods involve combination treatments that involve activating or initiating an action potential in a first tissue, and also involve blocking or inhibiting the propagation of an action potential within a second tissue. For example, in some embodiments, the subject methods involve introducing a first light-activated protein into a first tissue, such as a nerve cell, by introducing into the cell a polynucleotide that encodes a first light-activated protein. The first light-activated protein is capable of transporting one or more ions across the plasma membrane of cells in the target tissue to trigger an action potential in the first tissue in response to light of an activating wavelength.
[0215] Simultaneously, a second light-activated protein, such as a light-activated proton pump (e.g., Arch), and a response protein, such as an acid sensing sodium ion channel (e.g., ASIC2a) are also introduced into the tissue. Next, a light-generating device is positioned near the target tissue to illuminate the target tissue. The light-generating device comprises a plurality of light sources, such that the target tissue, or portions thereof, can be illuminated with light of different wavelengths. A portion of the light-generating device is positioned to exclusively illuminate a portion of the target tissue in which it is desirable to block or inhibit action potentials. For example, a portion of the light-generating device, such as a particular light cuff or sleeve, may be positioned to exclusively illuminate, e.g., a particular portion of a nerve cell, such as an axon of the nerve cell, with a particular wavelength of light.
[0216] Next, the light-generating device is activated to deliver light of a wavelength that activates the first light-activated protein in the target tissue. This illumination generates an action potential in the target tissue that propagates through nerve cells in the target tissue. Simultaneously, the light-generating device is activated to deliver light of a wavelength that activates the second light-activated protein to the specific portion of the target tissue in which it is desirable to block or inhibit action potentials. This illumination causes the light-activated proton pump to transport protons through the plasma membrane from inside the cell to the outside of the cell. When the protons are present on or near the external surface of the plasma membrane, the response protein detects the presence of the protons and responds by opening a sodium ion channel. The sodium ion channel allows sodium ions to pass through the plasma membrane from outside the cell to the inside of the cell depolarizing the cell sufficiently to render native voltage-gated sodium channels inactive, a phenomenon known as depolarization block.
[0217] The voltage-dependent inactivation of the VGSCs in the designated portion of the target tissue prevents the VGSCs from generating further action potentials in the nerve cell until the membrane repolarizes, which is facilitated by the cessation of light and decay of the response protein current, and the refractory period ends. As such, the propagation of action potentials along the nerve cell in the specified area is profoundly blocked for the duration of the light pulse, the decay of the response protein current, and the refractory period. Accordingly, the subject methods may be used to control the flow of action potentials through a target tissue by initiating an action potential in a target tissue using light of a first activating wavelength, and simultaneously blocking or inhibiting the propagation of the action potential through a specific portion of the target tissue by inactivating VGSCs in the specific portion of the target tissue. Additionally, since the duration of action blockade outlasts the duration of the light pulse, inhibition of action potentials may be achieved using pulsed light delivery, rather than continuous light delivery. In this way, the subject methods provide for directing and controlling the flow of action potentials through a target tissue using the subject systems and devices. FIG. 12 provides a flow diagram that illustrates the steps of an example of the subject methods.
Kits
[0218] Also provided are kits that at least include the subject systems and devices or components thereof, e.g., as described above, and instructions for how to use the subject systems and/or devices to optogenetically modulate action potentials in a target tissue. In some embodiments, a kit may include one or more of the subject polynucleotides, vectors, or pharmaceutical compositions. Kits in accordance with embodiments of the present disclosure may also include one or more devices, such as one or more delivery devices, one or more light-generating device, and/or one or more control devices.
[0219] The instructions for using the systems and devices as discussed above are generally recorded on a suitable recording medium. For example, the instructions may be printed on a substrate, such as paper or plastic, etc. As such, the instructions may be present in the kits as a package insert, in the labeling of the container of the kit or components thereof (i.e. associated with the packaging or sub-packaging) etc. In other embodiments, the instructions are present as an electronic storage data file present on a suitable computer-readable storage medium, e.g., a digital storage medium, e.g., a CD-ROM, diskette, etc. The instructions may take any form, including complete instructions for how to use the systems and devices or as a website address with which instructions posted on the Internet may be accessed.
EXAMPLES
Example 1: Inhibition of Action Potentials Using eArch3.0 and AS1C2a in a Nerve Cell
[0220] A nerve cell was transfected with a polynucleotide that encodes a light-activated proton pump protein (eArch3.0) and an acid sensing sodium ion channel response protein (ASIC2a). The proteins were expressed in the nerve cell and were present in the plasma membrane of the nerve cell. A pulse of 560 nm light activated eArch3.0, causing a fast outward proton current, resulting in early hyperpolarization of the plasma membrane. The extracellular protons then activated an inward cation current carried by ASIC2a resulting in sustained membrane depolarization and subsequent inactivation of native voltage-gated sodium channels, causing depolarization block and suppression of evoked spiking. Results are shown in FIG. 1.
Example 2: Strong Inhibition of Action Potentials Using AS1C2a
[0221] A hippocampal cultured neuron was transfected with a polynucleotide that encodes an acid sensing sodium ion channel response protein (ASIC2a). The protein was expressed in the nerve cell and was present in the plasma membrane of the nerve cell. A 1000 pA current was injected into the cell at 10 Hz, and whole cell patch clamp recordings were collected. In response to the 1000 pA current pulse injections, the outward current component inhibited spiking. During 2000 pA current pulse injections, however, only the depolarization block caused by the ASIC component was sufficient to inhibit spiking. The results are shown in FIG. 2. Insets show the voltage-clamp trace of each cell in response to a 1 second green light pulse.
Example 3: ASIC2a-Mediated Inhibition of Action Potentials
[0222] A nerve cell was transfected with a polynucleotide that encodes a light-activated proton pump protein (eArch3.0) and an acid sensing sodium ion channel response protein (ASIC2a). The proteins were expressed in the nerve cell and were present in the plasma membrane of the nerve cell. Spikes were evoked at baseline using suprathreshold (high reliability spiking) current pulse injections at 10 Hz. When light was applied, the eArch3.0-mediated hyperpolarization was insufficient to inhibit spiking, whereas the ASIC2a-mediated depolarization strongly suppressed spiking throughout the remainder of the light pulse, due to depolarization block. The insets to the right show the voltage-clamp response of the same neurons to a 1 second pulse of 560 nm light, with the amplitude of outward and inward currents provided. Results are shown in FIG. 3.
Example 4: Weak ASIC2a-Mediated Inhibition of Action Potentials
[0223] A nerve cell was transfected with a polynucleotide that encodes a light-activated proton pump protein (eArch3.0) and an acid sensing sodium ion channel response protein (ASIC2a). The proteins were expressed in the nerve cell and were present in the plasma membrane of the nerve cell. In this example, the inward:outward current ratio was small (.apprxeq.1), therefore the depolarization caused by the ASIC component was insufficient to cause depolarization block and overcome the evoked spiking. Results are shown in FIG. 4.
Example 5: Volumetric Modulation of Excitability by Extracellular Protons
[0224] In this example, it is described how extracellular ions, in particular protons, can influence local neural activity in non-cell-autonomous fashion through activation of acid-sensitive membrane proteins. An approach for manipulating cellular function, which couples light-sensitive proton pumps to acid-sensitive ion channels, permitting longer lasting, ion-specific regulation of transmembrane currents with many possible permutations for flexible neural control, is described.
Methods
Bystander Experiments
[0225] All experiments were conducted under protocols approved by the Stanford Administrative Panel on Laboratory Animal Care.
[0226] Stereotactic Injections:
[0227] For expression of ChR2(H134R), eArch3.0 or eNpHR3.0 in CamKII-positive neurons, adeno-associated virus (AAV) serotype 2/5 was produced by the University of North Carolina Chapel Hill Vector Core at a genomic titer of .about.4-16.times.10.sup.12 pfu mL.sup.-1. 1 .mu.L of virus was stereotactically injected at two sites unilaterally into the CA1 region of the hippocampus of 3-4 week-old mice. Coordinates for all animals at injection site #1 were -2.2 anteroposterior, 1.5 mediolateral (left side) and -1.3 dorsoventral (in mm from bregma) and for injection site #2 were -1.7 anteroposterior, 1.25 mediolateral (left side) and -1.5 dorsoventral (in mm from bregma). For cortical bystander experiments, Thy1::ChR2 (line 18) mice (Arenkiel et al, 2007) were used (bred in-house).
[0228] Acute Slice Electrophysiology Recordings:
[0229] Acute brain slices were prepared from mice at 4-8 weeks post virus injection, or at 4 weeks of age for transgenic mice. After lethal anesthesia, transcardial perfusion was performed prior to decapitation, followed by rapid brain extraction and submersion of the brain in ice-cold sucrose-based slicing solution (234 mM sucrose, 11 mM glucose, 10 mM MgSO.sub.4.7H.sub.20, 2.5 KCl, 1.25 mM NaH.sub.2PO.sub.4.H.sub.2O, 0.5 mM CaCl.sub.2.2H.sub.20). 300 .mu.m thick slices of hippocampus were cut on a Leica vibratome (Leica VT1000S). After cutting, slices were submerged in a hypertonic recovery solution (artificial cerebrospinal fluid (ACSF) at an 8% increased concentration) at 33.degree. C. for 15 mins before being transferred to standard ACSF (123 mM NaCl, 26 mM NaHCO.sub.3, 11 mM glucose, 3 mM KCl, 2 mM CaCl.sub.2.2H.sub.20, 1.25 mM NaH.sub.2PO.sub.4.H.sub.20, 1 mM MgCl.sub.2.6H.sub.2O) for a further 45 mins at 33.degree. C., at which point they were transferred to room temperature.
[0230] Whole cell patch clamp recordings on cortical and hippocampus neurons were performed on an upright Leica DM-LFSA microscope. Slices were continually perfused in warmed (33.degree. C.) ACSF at a rate of 7 ml min.sup.-1. Patching was performed in the presence of synaptic transmission blockers 6-cyano-7-nitroquinoxaline-2,3-dione (CNQX, 50 .mu.M) and D(-)-2-amino-5-phosphonovaleric acid (APV, 25 .mu.M) and gabazine (25 .mu.M) (Tocris Bioscience) except for during testing of electrically-evoked synaptic responses. For amiloride experiments, amiloride was added to the ACSF at a concentration of 500 .mu.M (Tocris). Borosilicate glass (Sutter Instruments) pipette resistances were pulled to 3-6 M.OMEGA. and filled with potassium gluconate intracellular solution (130 mM K Gluconate, 10 mM KCl, 10 mM HEPES, 10 mM EGTA, 2 mM MgCl.sub.2, pH adjusted with KOH to 7.3). Voltage and current clamp electrophysiological recordings and manipulations were performed using pClamp (Axon Instruments). Cells were held at -70 mV for all experiments. Cells with leak current greater than -300 pA or pipette resistance greater than 30 M.OMEGA. were excluded. Light (full-field illumination) was emitted from a 300 W DG-4 lamp (Sutter Instruments, Novato, Calif., USA) fitted with a Lambda 10-3 filter wheel (Sutter Instruments) with a 10-position wheel for filters of different wavelengths, or external filters (wavelength in nm/bandwidth in nm: 470/20; 560/25; 590/20). Light pulses were delivered through a 40.times., 0.8 NA water-immersion objective at 4-7 mW/mm.sup.2 light power density. Extracellular electrical stimulation was performed using a concentric bipolar electrode of platinum iridium (FHC, Bowdoin, ME, USA) or tungsten (World Precision Instruments, Sarasota, Fla. USA). Electrical pulses were delivered using a stimulus isolator (ISO-Flex, A.M.P.I) controlled by pClamp to deliver 200 .mu.s square pulses at intensities ranging from 500 .mu.A-2.5 mA and frequencies of 5-10 Hz.
[0231] Immunohistochemistry:
[0232] For identification of bystanders in slice preparations, 0.3% biocytin was added to the intracellular pipette solution and following recording slices were fixed in 4% paraformaldehyde perfusion fix solution (Electron Microscopy Services, Hatfield, Pa., USA) for 24 hours then transferred to 1.times. phophate buffered saline (Gibco, Life Technologies). Biocytin was stained with fluorescent streptavidin (Alexa Fluor 546 conjugate, Invitrogen, over 3 hours. For YFP staining, slices were incubated in anti-GFP primary antibody (Invitrogen, 1:500 dilution) for 24 hours. Cy5 secondary antibody (Jackson Laboratories, West Grove, Pa., 1:500 dilution) was applied in 2% NDS for 1 hour at room temperature for 3 hours followed by DAPI (1:50,000) for 30 mins, then mounted, and coverslipped with PVA-DABCO (Sigma). Images were obtained on a Leica confocal microscope (DM600B) at 1024.times.1024 pixel resolution using 5.times. and 10.times. dry objectives and 20.times., 40.times. and 63.times. oil objectives.
[0233] Data Analysis:
[0234] Analysis of all of physiological results was performed using Clampfit software (Axon Instruments). Pipette (access) resistance (R.sub.a) and membrane resistance (R.sub.m) were monitored at 5 minute intervals to ensure stability of the recording and data was only included when leak current was less than 300 pA and R.sub.a less than 30 M.OMEGA. with less than 25% change in R.sub.a for the duration of periods of drug application and between sequential membrane tests. Reversal potentials were corrected for an estimated liquid junction potential of 14 mV. Statistical analysis was performed using GraphPad Prism 6.0 for Mac OS X. For comparisons between YFP controls and opsin or electrical stimulation groups we performed non-parametric unpaired 2-tailed Mann Whitney tests to compare mean ranks between groups, without assuming a Gaussian distribution. For comparison of the functional impact of light on bystander neuron spiking, we compared successive light-on vs light-off epochs for each opsin, using a non-parametric, paired Wilcoxin signed rank test, again without assuming a Gaussian distribution. Significance thresholds were set at p<0.05 (*), p<0.01 (**), p<0.001 (***) and p<0.0001 (****).
[0235] Two-Component Optogenetics Experiments.
[0236] Construct design and expression in Xenopus laevis oocytes: The coding sequences for rat ASICs (in pRSSP6009) were provided by Stefan Grander (Aachen). The pRSSP6009 plasmid coding for ASICs and the pGEM plasmid coding for Coccomyxa subellipsoidea C-169 Rhodopsin CsR.sub.T46N were linearized by Mull site in pRSSP 6009 and by NheI in pGEM. After transcription into RNA using T7 (pGEM) or SP6 (pRSSP6009) mMessage mMachine Kit (Ambion Inc, Texas, USA) 32 ng of capped RNA encoding CsR pump and one type of ASIC were co-injected into Xenopus leavis oocytes with a molar ratio of 1:1 pump: channel for ASIC1 and ASIC2a and a molar ratio of 1:2 for ASIC3. Oocytes were incubated for 3 days at 18.degree. C. in ORI solution with 1 .mu.M all-trans retinal (Tsunoda & Hegemann, 2009).
[0237] Two-Electrode Voltage Clamp Measurements:
[0238] TEVC measurements on X. laevis oocytes were performed using a GeneClamp 500 amplifier (Axon Instruments, Union City). Data acquisition, buffer exchange and light triggering were controlled with pClamp software via a Digidata 1322A interface (Molecular Devices, Sunnyvale). The light supplied by a 75 W Xenon lamp (Jena-Instruments, Jena, Germany) was passed through a K55 filter (Balzers, Liechtenstein) and applied to the oocytes using a light guide (diameter of 2 mm). The light intensity was 8.5.times.10.sup.20 photons s.sup.-1 m.sup.-2 at the surface of the oocyte. The bulk buffer (chamber volume 300 .mu.l) was continuously perfused at a flow rate of 1.8.+-.0.2 ml min.sup.-1. Data was acquired at 1 kHz and filtered at 0.5 kHz. If not otherwise specified the extracellular buffer was composed of 100 mM NaCl, 1 mM KCl, 1 mM MgCl.sub.2, 0.1 mM CaCl.sub.2 and 0.1 to 5 mM MOPS at pH 7.5. For pH titration, buffer solutions were adjusted with 5 mM MOPS/MES/Citrate over the range of pH 8.0 to 4.0, and were subsequently compared with photocurrents measured at 0.1 mM MOPS at pH 7.5
[0239] Construct Design for Hippocampal Neurons:
[0240] The protein sequence of rat ASIC2a (Genbank accession number NM 001034014.1) was human codon optimized and synthesized by Genscript. eArch3.0 and ASIC-YFP fusions were cloned into an AAV2 backbone either under a CaMKII.alpha. or human synapsin promoter. The trafficking signal (TS) and endoplasmic reticulum export signal (ER) sequences were appropriately added to enhance membrane trafficking. All maps and sequence details are on the website: www(dot)optogenetics(dot)org.
[0241] Hippocampal Neuron Culture and Calcium Phosphate Transfection (as Per Mattis et al. (Nat Methods 2011; 9: 159-72)).
[0242] Primary cultured hippocampal neurons were prepared from P0 Sprague-Dawley rat pups (Charles River). CA1 and CA3 were isolated, digested with 0.4 mg ml.sup.-1 papain (Worthington), and plated onto glass coverslips precoated with 1:30 Matrigel (Becton Dickinson Labware). Cultures were maintained in a 5% CO.sub.2 humid incubator with Neurobasal-A medium (Invitrogen) containing 1.25% FBS (HyClone), 4% B-27 supplement (Gibco), 2 mM Glutamax (Gibco) and 2 mg ml.sup.-1 fluorodeoxyuridine (FUDR) (Sigma), and grown on coverslips in a 24-well plate at a density of 65,000 cells per well. For each well, a DNA-CaCl.sub.2 mix was prepared with 2 .mu.g DNA (Qiagen endotoxin-free preparation) and 1.875 .mu.l 2 M CaCl.sub.2 (final Ca.sup.2+ concentration 250 mM) in 15 .mu.l H.sub.2O. To DNA-CaCl.sub.2 was added 15 .mu.l of 2.times.HEPES-buffered saline (pH 7.05). After 20 min at room temperature (20-22.degree. C.), the mix was added dropwise into each well (from which the growth medium had been removed and replaced with pre-warmed minimal essential medium (MEM)) and transfection proceeded for 45-60 min at 37.degree. C., after which each well was washed with 3.times.1 ml warm MEM before the original growth medium was returned.
[0243] Electrophysiological Recordings in Cultured Hippocampal Neurons:
[0244] Whole cell patch clamp recordings were performed on cultured hippocampal neurons 4-8 days post-transfection on an upright Leica DM-LFSA microscope (Mattis et al, 2011). Cells were continuously perfused in standard extracellular Tyrode's solution (NaCl: 125 mM, KCl 2 mM, CaCl.sub.2 2 mM, MgCl.sub.2 2 mM, glucose 30 mM, HEPES 25 mM, titrated to pH 7.3-7.4 with NaOH, 320 mOsm) or in low HEPES Tyrode's solution (NaCl: 125 mM, KCl 2 mM, CaCl.sub.2 2 mM, MgCl.sub.2 2 mM, glucose 55 mM, HEPES 0.1 mM, titrated to pH 7.3-7.4, 320 mOsm) at a rate of 1-2 ml min.sup.-1, in the presence of synaptic transmission blockers 6-cyano-7-nitroquinoxaline-2,3-dione (CNQX), D(-)-2-amino-5-phosphonovaleric acid (APV) and gabazine (25 .mu.M; Tocris Bioscience). Patch pipette borosilicate glass electrodes (Sutter Instruments) with tip resistance of 3-6 M.OMEGA. were filled with a potassium gluconate intracellular solution (K-gluconate 130 mM, KCl 10 mM, HEPES 10 mM, EGTA 10 mM, MgCl.sub.2 2 mM, titrated to pH 7.3 with KOH, 300 mOsm). Data acquisition, current and light manipulations were controlled using pClamp (Axon Instruments) via a Digidata 1440A interface and analyzed using ClampFit software (Axon Instruments). Cells were held at -70 mV for all voltage-clamp experiments. Resting membrane potentials were corrected for an estimated liquid junction potential of 16 mV. Full-field illumination for activation of optogenetic tools was delivered by a 300 W DG-4 lamp (Sutter instruments) via a 40.times., 0.8 numerical aperture (NA) water-immersion objective. The light was first passed through a 560/25 nm filter within a Lambda 10-3 filter wheel (Sutter Instruments). Light power density was .about.5 mWmm.sup.-2 for all experiments. All experiments were performed at room temperature (24-25.degree. C.).
[0245] Confocal Images of Cultured Neurons:
[0246] Confocal images were obtained by staining glass coverslips of transfected neurons with DAPI (1:50,000) which were then imaged using a Leica confocal microscope (DM600B) as 1,025.times.1,024 pixel resolution, at 40.times. magnification, 1.25 NA (oil). Excitation/emission wavelengths for eYFP were 488 nm/500-545 nm.
Results
Electrophysiological Characterization of the Bystander Effect
[0247] The existence of "bystander neurons", defined here as neurons indirectly exposed to, but not direct expressors of, optogenetically-mediated changes in neural activity was tested. Two optogenetic targeting strategies were employed: first, an optogenetic construct containing one of CHR2(H134R), eArch3.0, eNpHR3.0 or a YFP control, driven by the calmodulin kinase II.alpha. promoter (AAV5-CamKII-(opsin)-eYFP), was injected unilaterally in the CA1 region of hippocampus. Due to the contralateral axonal projections of these neurons, one could then record from non-expressing neurons (bystander neurons) surrounded by opsin-expressing axons in the contralateral CAL (FIGS. 15A and 15C). Bystander responses to the depolarizing opsin CHR2(H134R) (from now on referred to as ChR2), two hyperpolarizing opsins (enhanced for membrane targeted expression)--the proton pump archeorhodopsin (eArch3.0) and the chloride pump halorhodopsin (eNpHR3.0), and a YFP-control were compared in the hippocampal preparation, under matched experimental conditions. A second category of bystander neuron was identified using the transgenic mouse strain Thy1-ChR2 (line 18), where ChR2 is expressed in layer V cortical neurons and bystander neurons are located in superficial cortical layers, where they are surrounded by ChR2-expressing membrane processes but not expressing ChR2 themselves (FIGS. 15B and 15D).
[0248] Whole cell recordings from bystander neurons in the presence of ionotropic synaptic transmission blockers were performed in acute brain slices. In response to a 15 s blue light pulse, hippocampal ChR2 bystander neurons exhibited a depolarizing membrane current (mean=-155 pA) (FIG. 15E) with onset-kinetics several orders of magnitude slower (.about.2 s) than a direct ChR2 photocurrent (FIG. 15J and FIG. 16). Cortical Thy1-ChR2 bystander neurons displayed a smaller inward current (mean=-27 pA) consistent with the smaller direct ChR2 photocurrent magnitude in Thy1-ChR2-expressing neurons (FIG. 17). These inward currents corresponded to a mean membrane depolarization of 6.1 mV for hippocampal ChR2 bystanders and 2.7 mV for cortical Thy1-ChR2 bystanders (FIG. 15F). AAV5-YFP control bystanders did not exhibit a change in membrane current or voltage. Given that pulsed-light paradigms are commonly used for depolarizing optogenetic applications, we examined bystander responses to 20 and 10 Hz light pulse trains, and again observed similar slow inward currents (mean=-73 pA for 20 Hz and -29 pA for 10 Hz) (FIG. 15G).
[0249] We next examined the impact of hyperpolarizing optogenetic tools on hippocampal bystander neurons. During a 30 s light pulse, AAV5-eArch3.0 bystanders exhibited a slow (.about.5 s) hyperpolarizing current (mean=21 pA), several orders of magnitude slower than a direct eArch3.0 photocurrent and AAV5-eNpHR3.0 bystanders exhibited a smaller (mean=10 pA) and even slower (.about.8 s) hyperpolarizing current (FIGS. 15H and 15J). These outward currents corresponded to a small mean membrane hyperpolarization of -3.3 mV for eArch3.0 and -1.1 mV for eNpHR3.0 whereas no change in membrane current or voltage was observed for AAV5-YFP control bystanders under matched experimental conditions (FIG. 15I).
[0250] During the application of light, ChR2 bystander neurons experienced a 24% mean decrease in membrane resistance, whereas eArch3.0-bystander neurons experienced a 9% increase in membrane resistance and eNpHR3.0 a 2% increase. YFP controls showed a 3% decrease in membrane resistance (FIG. 15L). Current-voltage relationships demonstrated a significantly positive slope for depolarizing bystanders and significantly negative slope for hyperpolarizing bystanders converging at a reversal potential between -10 to -40 mV (FIG. 15K). Functional and mechanistic investigation of the bystander effect.
[0251] FIGS. 15A-L. Identification and delineation of the bystander effect. A Unilateral injection of AAV5-CamKII-(opsin)-eYFP into CA1 of hippocampus yielded non-expressing bystander neurons in the contralateral hippocampus. Confocal image showing YFP expression and location of bystander neurons (star) (5.times., scale bar 1 mm). B Cortical bystander neurons in superficial layers of cortex of Thy1-ChR2 (line 18) transgenic mice. Confocal image showing YFP expression and location of bystander neurons (star) (10.times., scale bar 100 .mu.m). C Biocytin-filled hippocampal bystander neurons labeled with streptavidin in CA1 (scale bars 100 .mu.m and 20 .mu.m). D Biocytin-filled cortical bystander neuron labeled with streptavidin, surrounded by but not overlapping with YFP fluorescence confirmed by anti-YFP antibody staining (scale bars 50 .mu.m and 20 .mu.m). E Depolarizing bystander currents in response to 15 s 470 nm light pulses for AAV5-ChR2 hippocampal bystanders (mean+/-SEM=-155+/-32 pA, n=11, p<0.0001 compared to YFP), Thy1-ChR2 cortical bystanders (-27+/-6 pA, n=6, p<0.001 compared to AAV5-YFP) and AAV5-YFP controls (0.7+/-0.7 pA, n=10), Example voltage clamp traces shown below summary plot. F Depolarizing bystander potentials for AAV5-ChR2 hippocampal bystanders (6.1+/-1.4 mV, n=11, p<0.0001), Thy1-ChR2 bystanders (2.7+/-0.6 mV, n=3, p<0.01) and AAV5-YFP controls (0.02+/-0.07 mV, n=9). Example current clamp traces shown below summary plot. G Bystander currents in response to 470 nm light pulse trains at 20 Hz (-73+/-18 pA, n=12) and 10 Hz (-29+/-6 pA, n=11). Example voltage clamp traces shown below summary plot. H Hyperpolarizing bystander currents in response to 30 s 560 nm light for AAV5-eArch3.0 (21+/-4 pA, n=12, p<0.0001), 590 nm for AAV5-eNpHR3.0 (10+/-2 pA, n=14, p<0.0001) and AAV5-YFP controls (1.3+/-0.8 pA, n=10, 560 nm light). Example voltage clamp traces shown below summary plot. I Hyperpolarizing bystander potentials for AAV5-eArch3.0 (-3.3+/-1.1 mV, n=12, p<0.0001), AAV5-eNpHR3.0 (-1.1+/-0.2 mV, n=12, p<0.001) and AAV5-YFP controls (-0.1+/-0.2 mV, n=9). Example current clamp traces shown below the summary plot. J Onset kinetics (.tau..sub.on) for depolarizing (ChR2: 1800+/-200 ms, n=8) and hyperpolarizing (eArch3.0: 4800+/-710 ms n=10, eNpHR3.0: 8300+/-850 ms, n=7) bystanders. K Current-voltage relationships for depolarizing ChR2 bystander currents (R.sup.2 for slope (difference from 0)=0.71, p<0.0001)) and hyperpolarizing bystander currents (eArch3.0: R.sup.2 for slope=0.43, p<0.0001, eNpHR3.0: R.sup.2 for slope=0.26, p=0.0001) (n=5-12). L Change in membrane resistance from baseline in response to 30 s pulse of light for ChR2 (470 nm, 24% decrease in membrane resistance, n=8, p<0.001), eArch3.0 (560 nm, 9% increase in membrane resistance, n=12, p<0.0001) eNpHR3.0 (590 nm, 2% increase in membrane resistance, n=11, p<0.01) and YFP control bystanders (560 nm, 3% decrease in membrane resistance, n=11). All bar charts indicate mean values and error bars represent standard error of the mean (SEM). Individual data points indicate results from single cells. All statistical comparisons are between test (opsin) groups and YFP controls using the Mann Whitney (non-parametric) paired t-test.
[0252] FIG. 16: Kinetics of Photocurrents and Bystanders.
[0253] Example traces illustrating the difference in on-kinetics between a ChR2 expressing-cell photocurrent and a ChR2 bystander current in response to a 470 nm light pulse (0.5 s and 15 s respectively). Dashed box shows a zoom-in of the first 0.5 s of both traces.
[0254] FIGS. 17A and 17B: Photocurrent Magnitudes.
[0255] A Steady state photocurrent magnitudes (in response to 1 s light) for opsin-expressing neurons present in same preparations as bystander neurons: AAV-ChR2 (n=20, 470 nm), Thy1-ChR2 (n=6, 470 nm), AAV-eArch3.0 (n=14, 560 nm), AAV-eNpHR3.0 (n=16, 590 nm). Bars indicate mean and SEM, filled circles indicate individual cell photocurrents. B Example photocurrent traces for AAV5-ChR2 (blue), AAV-eArch3.0 (green) and AAV-eNpHR3.0 (amber) expressing neurons.
[0256] The influence of the bystander effect on evoked action potential firing was investigated (FIG. 18). During epochs of illumination (470 nm, 560 nm or 590 nm), the proportion of action potentials evoked in bystander neurons was modulated in a bidirectional manner, approximately doubling in the case of AAV5-ChR2 bystanders and halving in the case of AAV5-eArch3.0 bystanders (FIGS. 18A and 18B). AAV5-eNpHR3.0 bystanders also experienced a modest but significant reduction in spiking success during illumination whereas no modulation by light epochs was observed in AAV5-YFP controls (FIGS. 18C and 18D).
[0257] FIGS. 18A-D.
[0258] Functional impact of bystander currents on action potential firing. Spikes were evoked in the bystander neuron by intracellular injection of electrical current pulses at 10 Hz titrated to achieve a .about.50% success rate at baseline. Light pulses were applied and the change in evoked spiking was recorded. Plots show percentage of successfully evoked spikes during repeated light-off and light-on epochs for A AAV-ChR2 (n=4-10), B AAV-eArch3.0 (n=13-14), C AAV-eNpHR3.0 (n=9-14) and D AAV-YFP control bystander neurons Summary plots and individual cell data are shown with example traces. Dashed box shows zoom-in of the center light-off/light-on epochs. Bar charts indicate mean values and error bars represent SEM. All statistical comparisons (Wilcoxon matched pairs signed rank test) are between the light-on epoch and the preceding light-off epoch.
[0259] Having observed that the bystander effect tracked the direction of change in local neural activity we questioned whether the effect could be observed during manipulation of neural activity using electrical stimulation. Although electrical stimulation is not constrained to a genetically specified cell type or projection, we endeavored to create "electrical bystanders" by stimulating axonal inputs (Schaffer collaterals) to the CA1 region of hippocampus (FIG. 19A). The ability of the stimulation paradigm to induce synaptic release (FIG. 19B) was confirmed, then ionotropic synaptic transmission blockers were applied to isolate the impact of electrical axonal stimulation on the extracellular milieu. To mimic the intensity of the optogenetic manipulations, high amplitude (0.5-2.5 mA) extracellular current pulses at a frequency of 10 Hz for a period of 20 s were used (FIG. 19C). Electrical artifacts challenged the assessment of whole-cell current responses during stimulation, however the mean change in holding current immediately post-stimulation compared to baseline was significantly more negative than the YFP control group (-11 pA) (FIG. 19D), displaying a slow recovery comparable to the ChR2 optogenetic bystander currents. The possibility of a unique electrochemical reaction between the electrode metal and the extracellular fluid was controlled for by performing the experiments using both tungsten and platinum-iridium electrodes; similar effects were found with both electrode-types (FIG. 20).
[0260] It was hypothesized that the bystander effect could be driven by changes in local extracellular pH. Neural activity and synaptic release can modulate extracellular pH and many membrane proteins are modulated by extracellular protons such as acid-sensing ion channels (ASICs), which may be partially open at rest and are plentiful in the brain. The contribution of ASICs to the ChR2 bystander current was tested by using pharmacological blockade by the ASIC inhibitor, amiloride. A bystander current (15 s light pulse) was evoked in hippocampal ChR2 bystander neurons every 5 minutes for up to 75 minutes. Following two baseline measurements, 500 .mu.M amiloride was applied for 20 minutes, then returned to ACSF alone for a "washout" period. During amiloride application, an increase in membrane resistance (in the absence of any illumination) (FIG. 15E) was observed, with a concurrent reduction in the magnitude of the light-evoked bystander current to -50% of the baseline value, which slowly recovered during the washout period (FIGS. 15F and 15G). To control for the effect of holding cells in whole-cell patch clamp configuration for long periods, the experiment was repeated in the absence of amiloride application and no consistent reduction in bystander current magnitude over time was seen (FIG. 21C). Measures of cell health confirmed the integrity of the pipette access and cell membrane for the duration of the recordings (FIGS. 22A and 22B).
Coupling Proton Pumps to Acid-Sensing Ion Channels
[0261] The response of acid-sensing ion channels to extracellular protons was exploited through a concept that we term "two-component optogenetics" (TCO). A modular system was devised, in which a light-sensitive protein such as a proton pump (e.g. Coccomyxa subellipsoidea C-169 (CsR) or Archaerhodopsin (Arch)) is co-expressed with a secondary-coupled ion channel, such as an acid-sensing ion channel (ASIC), to evoke a light-triggered secondary current carried by a specific ionic species, as illustrated in FIG. 23A.
[0262] Oocytes: To test this approach in Xenopus laevis oocytes, we chose a light-driven proton pump of the arctic green alga Coccomyxa subellipsoidea C-169 (CsR) (Blanc et al, 2012), which has improved expression in oocytes compared to the well-characterized bacteriorhodopsin or archaerhodopsin, used for hyperpolarization of neurons. The CsR mutant T46N was used, which exhibits less voltage dependence than the wild type, with large photocurrents at negative voltages (FIG. 24).
[0263] In Xenopus laevis oocytes we co-expressed CsR with each of three different rat acid-sensing ion channels ASIC1a, ASIC2a or ASIC3. These channels are characterized by a steep pH-dependence of the proton-activated currents, more or less below the physiological pH Immediately after light onset a small outward current carried by proton pumping of CsR was observed, followed by a large inward current carried by the co-expressed acid-sensing ion channel (FIGS. 23B-D). For both ASIC1.alpha. and ASIC3, the secondary activated inward current peaked within 1-2 s after light onset then rapidly decayed to the initial pump current, due to the high proton sensitivity and fast desensitization of ASIC1.alpha. and ASIC3 as described previously (Zhang & Canessa, 2002) (FIGS. 23B and 23D). In contrast ASIC2a mediated a long-lasting light activated inward current (FIG. 23C). The rise of the ASIC2a current was multiphasic at all voltages, a property not observed in previous studies in which the channel was directly activated by acidification of the bulk solution. This is possibly due to the indirect activation of the channel by the proton pump. In accordance with a low pH.sub.50 of 5 and the reported slow and incomplete desensitization of ASIC2a (Zhang & Canessa 2002), the light-induced currents decayed only very slowly during illumination. Following light offset the current decayed to zero within .about.20 seconds and could be reactivated by illumination any time (FIG. 25A).
[0264] FIGS. 23A-D.
[0265] Optical activation of three acid-sensitive ion channels. A Principle of the Two Component Optogenetic (TCO) approach. Upon illumination the light-activated proton pump may moderately acidify the local extracellular medium and activate acid-sensitive ion channels, ASICs, via their proton-sensing domain. This results in a remote but large sodium influx that can be used for sustained cell depolarization at moderate light intensities. In Xenopus oocytes, a light-driven proton pump of Coccomyxa subellipsoidea (CsR) was used. B-D Macroscopic currents of CsR.sub.T46N coexpressed with rat ASIC1a, rat ASIC2a or rat ASIC3 in oocytes at a molar RNA ratio of 1:1 (for ASIC3 of 2:1). Cells were illuminated with 560 nm light at different holding voltages at 0.1 mM MOPS and pH 7.5 under constant perfusion. The small outward directed pump currents (CsR) triggers large inward sodium currents (ASIC). Inset zooming to the initial pump activity directly after starting to illuminate CsR.sub.T46N-ASIC1a with green light. Note that ASIC1a and ASIC3 show strong inactivation in sustained light, whereas ASIC2a shows moderate to no inactivation at all.
[0266] FIGS. 24A-E. Photocurrents of Chlorellarhodopsin (CsR).
[0267] A, B Light induced pump currents of CsR WT (A) and T46N (B) in Xenopus oocytes. The T46N mutant exhibits greater currents at negative membrane voltage compared to WT. C Current-voltage relationships, I(E), and D action spectra with maxima at 545 nm. E Comparison of CsR photocurrents (545 nm excitation) with those of bacteriorhodopsin (BR, 570 nm excitation) expressed under identical conditions. Current amplitudes of CsR are on average 10 fold greater than those of BR.
[0268] FIGS. 25A-D. Characterization of CsR-AS1C1a with and without Permanent Perfusion in Xenopus laevis Oocytes.
[0269] In "perfusion" conditions a measuring chamber of 300 .mu.l was continuously perfused with 1.8.+-.0.2 ml/min of standard measuring buffer containing 100 mM NaCl, 1 mM KCl, 1 mM MgCl.sub.2, 0.1 mM CaCl.sub.2, 0.1 mM MOPS (pH 7.5). In measurements "without perfusion" the buffer supply was disconnected and the peristaltic pump switched off A Representative CsR.sub.T46N-ASIC2a photocurrents at 40 s light pulses of 560 nm in a succession of conditions "without perfusion", with continuous "perfusion" and "without perfusion" at different voltages. Insets: Repetitive photocurrent "without perfusion" and with "continuous perfusion" at -40 mV. B Comparison of normalized peak photocurrent with "perfusion" (open circles) and "without perfusion" (squares). Empty squares describe the response to the first light pulse and filled squares to the third light pulse (see A). C Normalized peak photocurrent at -40 mV in dependence on the initial CsR.sub.T46N pump current in "perfusion" condition and "without perfusion" for 1.sup.st light pulse empty for 3.sup.rd light pulse (see A and B)). All currents were normalized to ASIC2a current at pH4 and -40 mV (see FIG. 5). D CsR.sub.T46N-ASIC2a on-kinetics quantified by the time to reach the half maximal photocurrent t.sub.1/2,on with perfusion (circles) and without perfusion (filled and empty squares, see B and C) E CsR.sub.T46N-ASIC2a off-kinetics quantified by the time to reduce the photocurrent by half after light switched off t.sub.1/2,off with perfusion (circles) and without perfusion (filled and empty squares, see B and C). Inset: Description of t.sub.1/2,on and t.sub.1/2,off (red) on a representative photocurrent at -40 mV.
[0270] The observed light activated inward currents were inversely proportional to the membrane voltage due to the increased driving force for Na.sup.+ at negative voltages and voltage independent gating and permeability of ASIC2a (Zhang & Canessa, 2002) (FIG. 23A; FIG. 26A). Changing the concentration of the major extracellular cation from Na.sup.+ to K.sup.+ or choline shifted the reversal potential and greatly decreased the magnitude of the inward current component, confirming the Na.sup.+ selectivity of the ASIC2a response as a major feature of the TCO pair (FIG. 26A).
[0271] To determine the fraction of ASIC2a channels that are activated by light, we titrated the ASIC2a currents by rapid buffer exchange. It was found that the maximal current (when holding the membrane potential at -60 mV) was only reached at pH 4 (FIG. 26B). Normalization of light-activated currents to this value revealed that approximately 25% of ASICs are activated by CsR-mediated acidification (FIGS. 26B-D) and allowed an approximation of the acidification sensed by ASICs at the cell surface (FIG. 26B green bar). It was also noticed that at pH values of 5.5 or below, ASIC2a inactivates more severely than at pH 6. Thus for neuronal applications, the degree of inactivation may serve as a useful indicator for the external pH value that may have been reached.
[0272] ASIC activation strongly depended on the number of active proton pumps as probed by application of light at different intensities (FIG. 26E). Furthermore efficient activation was expected to depend on the external buffering capacity for protons, namely buffer strength and extracellular volume. Indeed increasing the buffer strength from 0.1 mM to 5 mM strongly decreased the ASIC2a mediated inward current (FIG. 26C) and correspondingly the fraction of light activated ASIC2a channels from .about.25% at 0.1 mM MOPS to .about.2% at 5 mM MOPS (FIG. 26D). In contrast the extracellular bulk volume seemed of low importance. Consecutive exchange of the bulk medium during illumination by continuous perfusion only slightly decreased the light activated ASIC2a current compared to conditions with a constant bulk phase (FIG. 25).
[0273] FIG. 26A-E. Characterization of CsR-ASIC2a by two-electrode voltage clamp (TEVC) in oocytes. A Current-voltage dependency of normalized photocurrents in 100 mM NaCl, 100 mM KCl or 100 mM CholineC1 extracellular medium (all media contained additionally 1 mM NaCl/KCl, 1 mM MgCl.sub.2, 0.1 mM CaCl.sub.2 and 0.1 mM MOPS, pH 7.5, n=5, normalized to ASIC2a current activated by pH 4). B ASIC2a currents measured during pH titration in darkness and comparison with photocurrents measured at pH 7.5. The boxed region highlights the percent activation of ASIC2a by illumination with green light at 0.1 mM MOPS (data shown in FIG. 5B). Inset: representative pH activated current trace of ASIC2a at -40 mV. C Macroscopic currents of CsR.sub.T46N-ASIC2a activated by pH 4 or green light at different buffer concentrations (5 mM MOPS, 1 mM MOPS and 0.1 mM MOPS, -40 mV, constant perfusion) D Percent activation of ASIC2a by the light driven proton pump CsR.sub.T46N in different buffer concentrations (5 mM MOPS, 1 mM MOPS and 0.1 mM MOPS, -40 mV, n=9, 100% activation taken as the peak ASIC current produced by pH 4). E Normalized ASIC2a and CsR.sub.T46N photocurrents measured at different light intensities (0.1 mM MOPS, -40 mV, n=5, normalized to ASIC2a current activated by pH 4). Inset: representative current traces at -40 mV.
[0274] Neurons:
[0275] For application to neuroscience, ASIC2a was tested in cultured hippocampal neurons. The channels were co-expressed with the light-driven proton pump eArch3.0, one of the highest-expressing pumps in neurons (Chow et al, 2010, Mattis et al, 2011). A single eArch3.0-ASIC2a construct was developed, termed Champ (Channel/pump), fusing the proton pump and ASIC2a channel at the DNA level, separating the two genes only by a linker sequence (FIG. 27A). The combination of eArch3.0-ASIC2a (Champ1.0) was enhanced for better membrane localization (Champ2.0) via trafficking signal (TS) and endoplasmic reticulum (ER) export motifs (Gradinaru et al, 2010) (FIGS. 27A and 27B). We performed whole-cell patch clamp recordings from cultured hippocampal pyramidal neurons, expressing the constructs under the human synapsin (hSyn) or calmodulin kinase II.alpha. (CamKII.alpha.) promoters and saw a characteristic biphasic membrane current in response to 560 nm light in voltage-clamp recordings (FIG. 27C). The mean current magnitudes were 246 pA for the outward proton pump-mediated component and -950 pA for the inward ASIC-mediated component (FIG. 27D). The biphasic current was observed in 48% of YFP-positive neurons (FIGS. 28A and 28B) and there was no evidence of adverse effects on cell health in neurons expressing the dual component construct (FIGS. 28C-F). The inward current magnitude was linearly related to the magnitude of the outward proton pump current (FIG. 27E). Peak inward and outward current magnitude did not vary significantly with the duration of light pulses (1 s to 15 s) in a HEPES buffered solution (FIGS. 29A and 29B), suggesting that maximal currents were achievable within 1 s, however off-kinetics, as fitted by a two-term exponential, increased with increasing light pulse duration (FIGS. 29C and 29D). For longer light pulses (15 s), a clear decay in the inward current magnitude over the course of the light pulse to approximately 80% of the initial value was observed (FIG. 27C and FIG. 30B), which may be explained by increases in extracellular acidity under sustained light conditions.
[0276] In a separate experiment we tested the effect of decreasing the concentration of HEPES buffer in the extracellular Tyrode's solution (from 25 mM to 0.1 mM) on the magnitude of the currents (FIG. 30). In a low (0.1 mM) HEPES solution, 7/11 (.about.60%) neurons exhibited the characteristic biphasic membrane response (compared to 5/10 (50%) neurons in standard (25 mM) Tyrode's under otherwise matched conditions). There was a trend towards an increase in current magnitude in low HEPES solution, particularly during longer light pulses (15 s) (FIG. 30D-F) however this was accompanied by a decrease in the stability of the response with greater decay of the peak inward current over the duration of the light pulse (FIGS. 30A and 30B), likely due to the larger drop in extracellular pH in the weakly buffered solution.
[0277] Current clamp recordings of membrane potential responses of TCO-expressing neurons revealed that 560 nm light evoked an initial hyperpolarization (-33 mV) of the membrane potential, followed by a subsequent depolarization (87 mV) (FIGS. 27F and 27G) which was sufficient to generate action potentials (.about.9 spikes) and persisted beyond the termination of the light pulse (FIGS. 27F and 27H). The extent of ASIC-mediated depolarization was proportional to the initial pump-mediated hyperpolarization (FIG. 31B), echoing the linear relationship between the inward and outward current components seen in voltage-clamp recordings. The light pulse duration did not significantly alter the magnitude of membrane potential change beyond 1 s light (FIG. 31).
[0278] FIGS. 27A-H. eArch3.0-ASIC2a (Champ) expression in hippocampal neurons. A Confocal images of yellow fluorescent protein (YFP) fluorescence from cultured hippocampal neurons expressing ASIC2a labeled with YFP in combination with the enhanced light-driven proton pump Arch3.0 at 40.times. magnification. Scale bars represent 30 .mu.m. The construct expressed well under both the CamKII.alpha. and human synapsin (hSyn) promoter. B Cartoon illustration of the two-component construct containing eArch (enhanced by trafficking sequence, TS) and ASIC2a, separated by a linker sequence and labeled with YFP. C Representative voltage clamp traces of the Champ current (eArch3.0-ASIC2a current in response to 1 s, 5 s and 15 s pulses of 560 nm light (timing of light pulse is indicated by horizontal line). Regions of the trace used to measure outward and inward current components and off-kinetics are indicated by dashed lines and arrows. D Magnitude of outward (mean+/-SEM=246+/-27 pA) and inward (-950+/-172 pA) components of the Champ current in response to a 1 s pulse of 560 nm light (n=21). E Relationship between the inward and outward components of the current response to 1 s pulse of 560 nm light (n=21). Linear regression analysis yields R.sup.2=0.33, p<0.01 for difference of slope from zero. F Examples of a variety of membrane potential responses to 1 s pulses of 560 nm light (light pulse timing indicated by horizontal lines) from 4 different eArch-ASIC2a (Champ) expressing cells recorded in current clamp. Regions of the trace used to measure hyperpolarizing and depolarizing components of the response are indicated. G Magnitude of hyperpolarizing (eArch3.0-mediated, -33+/-3 mV) and depolarizing (ASIC2a-mediated, 87+/-6 mV) components of the light response (n=13) H Number of spikes evoked in response to 1 s (n=17), 5 s (n=15) and 15 s (n=4) light pulses.
[0279] FIGS. 28A-F. Variable presence of the ASIC2a component in cultured hippocampal neurons. A Example of an eArch3.0-ASIC2a current when the ASIC2a component is small (upper trace) and example of an ASIC negative current, in which only the eArch3.0 (outward) component is present, with no inward ASIC2a component (lower trace). B Magnitude of outward current components for ASIC negative cells (eArch3.0 component present only, n=23) and ASIC positive cells (both outward (eArch3.0) and inward (ASIC2a) components present, n=21). C Leak current for all ASIC negative (n=23) and ASIC positive (n=21) cells. D Resting membrane potential for all ASIC negative (n=11) and ASIC positive (n=13) cells. E Pipette (access) resistance for all ASIC negative (n=23) and ASIC positive (n=21) cells. F Membrane resistance for all ASIC negative (n=23) and ASIC positive (n=21) cells.
[0280] FIGS. 29A and 29B.
[0281] Champ currents and kinetics in response to light pulses of increasing duration. A Magnitude of outward and inward current components in response to 1 s (n=21), 5 s (n=14) and 15 s (n=10) light pulses. B Off-kinetics of Champ current in response to 1 s (n=18), 5 s (n=9) and 15 s (n=7) light pulses. The off-response is fitted by an exponential with a fast and slow term.
[0282] FIGS. 30A-F.
[0283] Champ currents in low HEPES Tyrode's solution. A Example of an eArch3.0-ASIC2a (Champ) photocurrent in 0.1 mM HEPES, illustrating the rapid decay of the peak current over the duration of the 15 s light pulse. Regions of the trace used for measurement of peak and final currents are indicated. B Ratio of the peak: final current for cells patched in 25 mM HEPES (n=5) and 0.1 mM HEPES (n=6) in response to 15 s light pulses. C Magnitude of inward and outward current components in response to 15 s light pulses in 0.1 mM HEPES (n=6). D Inward current magnitude in 25 mM and 0.1 mM HEPES during 1 s and 15 s light pulses (n=5-7) under otherwise matched conditions. E & F Outward and inward membrane currents during 1 s and 15 s light pulses in 0.1 mM HEPES.
[0284] FIGS. 31A and 31B.
[0285] Champ potentials in response to light pulses of increasing duration and relationship between Champ-mediated hyperpolarization and depolarization. A Magnitude of membrane hyperpolarization and depolarization in response to 1 s (n=13), 5 s, (n=10) and 15 s (n=4) light pulses. B Linear regression analysis for the relationship between Champ-mediated membrane hyperpolarization and depolarization yields R.sup.2=0.47, p<0.01 for difference of slope from zero.
[0286] The impact of the proximity of the proton pump and ASIC components in generating the characteristic biphasic TCO response was explored. The molecular separation of the two components was systematically increased by interspersing a linker sequence of DNA of increasing length between the two genes: first, a short linker consisting of a 69 base pair trafficking sequence which closely fuses the two proteins (Champ3.0), second, a long (123 base pair) linker sequence that still tethers the two proteins but with a longer intervening peptide chain (Champ2.0), third, a ribosomal p2a skip sequence which cleaves the two proteins during translation (Szymczak-Workman et al. (Cold Spring Harbor Protocols 2012; 2012: 199-204); Prakash et al. (Nat Methods 2012; 9: 1171-1179)). Finally, the neurons were transfected simultaneously using two separate constructs (CamKII-Arch3.0-mCherry and CamKII-ASIC2a-YFP) co-expressing them but without generating a fusion construct. The 4 constructs and a CamKII-eArch3.0-YFP control were tested in a head-to-head comparison under matched experimental conditions (FIG. 32).
[0287] It was found that all four approaches resulted in good YFP expression, indicating successful expression of the ASIC construct. In the co-expression experiment good co-localization of mCherry fluorescence was observed, confirming expression of both constructs within single cells (FIGS. 32A-D). It was found that increasing the molecular separation between the constructs resulted in a lower probability of observing the inward current component of the TCO response, with the short linker sequence (TS) construct (Champ3.0) exhibiting the most reliable and largest inward ASIC-mediated currents at 0.1 mM buffer (mean inward current=-599 pA, mean outward current=150 pA) (FIG. 32A). We occasionally saw large ASIC currents with the separated (p2a split) construct; however these occurred less reliably (FIG. 32D). The co-expressed constructs generated eArch3.0 photocurrents (outward component) only, which were closer in magnitude (mean=377 pA) to the Arch3.0 control (mean=575 pA) than the fusion or p2a split constructs. The observed dependence of TCO function on the physical proximity of the proton pump and ASIC channel highlights the importance of nano-environment ion sensing in the interaction between the two components on the membrane.
[0288] FIGS. 32A-D. Head-to-head comparison of four Champ constructs: effect of increasing molecular distance. All electrophysiological recordings were performed in low HEPES (0.1 mM) Tyrode's solution. For each construct: a cartoon illustrates the structure of the two-component construct, confocal images demonstrate fluorescence expression in culture and graphs show the relative magnitude of the peak outward current and the current at the end of the light pulse. A more negative current at the end of the light pulse indicates a larger ASIC component. Insets: representative traces of the current responses to a 1 s pulse of 560 nm light for each two-component construct (timing of light pulse indicated by horizontal line). A Champ3.0: eArch3.0 and ASIC2a are fused by a short linker sequence consisting of a 69 base pair membrane trafficking signal (TS) (n=16). B Champ2.0: eArch3.0 and ASIC2a are fused by a longer (123 base pair) sequence (n=17). C Champ4.0: eArch3.0 and ASIC2a are separated during protein translation by the ribosomal skip sequence, p2A (n=14). D Co-transfection of eArch3.0 and ASIC2a: eArch3.0 is labeled with mCherry and ASIC2a is labeled with YFP to allow identification of both components in a single cell. Electrophysiological characterization of outward and end-of-light pulse currents for the co-transfected construct and an eArch3.0-only control (n=9 and n=9 respectively).
[0289] FIGS. 33A-D. Measures of cell health across 4 different Champ constructs with increasing molecular separation between proton pump and ASIC. There were no significant differences in any cell health measures across the 5 groups: Champ3.0, Champ2.0, Champ4.0, co-transfection of eArch3.0 and ASIC2a and eArch3.0 only (one-way ANOVA, F=1.56-2.27, p>0.05, n=9-17) A Leak current B Membrane resistance C Pipette resistance D Resting membrane potential.
REFERENCES
[0290] Anastassiou C A, Perin R, Markram H, Koch C. Nat Neurosci 2011; 14: 217-223. Ephaptic coupling of cortical neurons.
[0291] Arenkiel B R, Peca J, Davison I G, Feliciano C, Deisseroth K, Augustine G J, Ehlers M D, Feng G. Neuron 2007; 205-218. In vivo light-induced activation of neural circuitry in transgenic mice expressing channelrhodopsin-2.
[0292] Askwith C C, Wemmie J A, Price M P, Rokhlina T, Welsh M J. J Biol Chem 2004; 279: 18296-18305. Acid-sensing ion channel 2 (ASIC2) modulates ASIC H.sup.+-activated currents in hippocampal neurons.
[0293] Babini E, Paukert M, Geisler H S, Grunder S. J Biol Chem 2002; 277: 41597-603. Alternative splicing and interaction with di- and polyvalent cations control the dynamic range of acid-sensing ion channel1 (ASIC1).
[0294] Babinski K, Catarsi S, Biagini G, Seguela P. J Biol Chem 2000; 275: 28519-28525. Mammalian ASIC2a and ASIC3 subunits co-assemble into heteromeric proton-gated channels sensitive to Gd.sup.3+.
[0295] Baburin I, Beyl S, Hering S. Pflugers Archiv 2006; 453.1: 117-123. Automated fast perfusion of Xenopus oocytes for drug screening.
[0296] Bamann C, Gueta R, Kleinlogel S, Nagel G, Bamberg E. Biochemistry 2010; 49: 267-278. Structural guidance of the photocycle of channelrhodopsin-2 by an interhelical hydrogen bond.
[0297] Baron A, Waldmann R, Lazdunski M. J Physiol 2002; 539: 485-494. ASIC-like, proton-activated currents in rat hippocampal neurons.
[0298] Bassilana F, Champigny G, Waldmann R, de Weille J R, Heurteaux C, Lazdunski M. J Biol Chem 1997; 272: 28819-28822. The acid-sensitive ionic channel subunit ASIC and the mammalian degenerin MDEG form a heteromultumeric H.sup.+-gated Na.sup.+ channel with novel properties.
[0299] Baylor D A & Nicholls J G. J Physiol 1969; 203: 555-569. Changes in extracellular potassium concentration produced by neuronal activity in the central nervous system of the leech.
[0300] Berndt A, Yizhar O, Gunaydin L A, Hegemann P, Deisseroth K. Nat Neurosci 2009; 12: 229-234. Bistable neural state switches.
[0301] Bevan S, Yeats J. J Physiol 1991; 433: 145-161. Protons activate a cation conductance in a sub-population of rat dorsal root ganglion neurones.
[0302] Blanc G, Agarkova I, Grimwood J, Kuo A, Brueggeman A, Dunigan D D, Gurnon J, Ladunga I, Linguist E, Lucas S, Pangilinan J, Proschold T, Salamov A, Schmutz J, Weeks D, Yamada T, Lomsadze A, Borodovsky M, Claverie J M, Grigoriev I V, Van Etten J L. Genome Biology 2012; 13: R39. http://genomebiology.com/2012/15/5/R39
[0303] Bolshakov K V, Essin K V, Buldakova S L, Dorofeeva N A, Skatchkov S N, Eaton M J, Tikhonov D B, Magazanik L G. Neuroscience 2002; 110: 723-730. Characterization of acid-sensitive ion channels in freshly isolated rat brain neurons.
[0304] Bruun S, Naumann H, Kuhlmann U, Schulz C, Stehfest K, Hegemann P, Hildebrandt P. FEBS Lett 2011; 585: 3998-4001. The chromophore structure of the long-lived intermediate of the C128T channelrhodopsin-2 variant.
[0305] Chen C C, England S, Akopian A, Wood J N. Proc Natl Acad Sci USA 1998; 95: 10240-10245. A sensory neuron-specific, proton-gated ion channel.
[0306] Chesler M & Kalia K. TINS 1992; 15: 396-402. Modulation of pH by neuronal activity. Chow B Y, Han X, Dobry A S, Qian X, Chuong A S, Li M, Henninger M A, Belfort G M, Lin Y,
[0307] Monahan P E, Boyden E S. Nature 2010; 463: 98-102. High-performance genetically targetable optical neural silencing by light-driven proton pumps.
[0308] Deval E, Gasull X, Noel J, Salinas M, Baron A, Diochot S, Lingueglia E. Pharmacol Ther 2010; 128: 549-558. Acid-sensing ion channels (ASICs): pharmacology and implication in pain.
[0309] Ferenczi E, Deisseroth K. Nat Neurosci 2012; 15: 1058-1060. When the electricity (and the lights) go out: transient changes in excitability.
[0310] Goldin, A L. 2006. Expression of Ion Channels in Xenopus Oocytes. Expression and Analysis of Recombinant Ion Channels: From Structural Studies to Pharmacological Screening.
[0311] Gutman M, Nachliel E, Friedman R. Biochim Biophys Acta 2006 1757: 931-41. The mechanism of proton transfer between adjacent sites on the molecular surface.
[0312] Gradinaru V, Thompson K R, Deisseroth K. Brain Cell Biol 2008; 36:129-39. eNpHR: a Natronomonas halorhodopsin enhanced for optogenetic applications.
[0313] Gradinaru V, Zhang F, Ramakrishnan C, Mattis J, Prakash R, Diester I, Goshen I, Thompson K R, Deisseroth K. Cell 2010; 141: 154-165. Molecular and cellular approaches for diversifying and extending optogenetics.
[0314] Gruender S, Chen X. Int J Physiol Pathophysiol Pharmacol 2010; 2: 73-94. Structure, function and pharmacology of acid-sensing ion channels (ASICs): focus on ASIC1a.
[0315] Heberle J, Riesle J, Thiedemann G, Oesterhelt D, Dencher N A. Nature 1994; 370: 379-382. Proton migration along the membrane surface and retarded surface to bulk transfer.
[0316] Hodgkin A L & Huxley A F. J Physiol 1952; 117, 500-544. A quantitative description of membrane current and its application to conduction and excitation in nerve.
[0317] Hodgkin A L & Katz B. J Physiol 1949; 108: 37-77. The effect of sodium ions on the electrical activity of the giant axon of the squid.
[0318] Jasti J, Furukawa H, Gonzales E B, Gouaux E. Nature 2007; 449: 316-323. Structure of acid-sensing ion channel 1 at 1.9 A resolution and low pH.
[0319] Jordt S E, Tominaga M, Julius D. Proc Natl Acad Sci USA 2000; 97: 8134-8139. Acid potentiation of the capsaicin receptor determined by a key extracellular site.
[0320] Katz B, Schmitt O H. J Physiol 1940; 97: 471-488. Electric interaction between two adjacent nerve fibers.
[0321] Krishtal O. TINS 2003; 26: 477-483. The ASICs: signaling molecules? modulators?
[0322] Krishtal O A, Osipchuk Yu V, Shelest T N, Smirnoff S V. Brain Res 1987; 436: 352-356. Rapid extracellular pH transients related to synaptic transmission in rat hippocampal slices.
[0323] Krishtal O A, Pidoplichko V I. Neuroscience 1980; 5: 2325-2327. A receptor for protons in the nerve cell membrane.
[0324] Krishtal O A, Pidoplichko V I. Neurosci Lett 1981; 6: 2599-2601. A `receptor` for protons in small neurons of trigeminal ganglia: possible role in nociception.
[0325] Lindemann B. Nature 2001; 413: 219-225. Receptors and transduction in taste.
[0326] Liske H, Xiang Q, Anikeeva P, Deisseroth K, Delp S. Optical control of neuronal excitation and inhibition using a single opsin protein. Scientific Reports 2013; 3: 3110.
[0327] Mattis J, Tye K M, Ferenczi E A, Ramakrishnan C, O'Shea D J, Prakash R, Gunaydin L A, Hyun M, Fenno L E, Gradinaru V, Yizhar O, Deisseroth K. Nat Methods 2011; 9: 159-72. Principles for applying optogenetic tools derived from direct comparative analysis of microbial opsins.
[0328] Nagel G, Szellas T, Huhn W, Kateriya S, Adeishvili N, Berthold P, Ollig D, Hegemann P, Bamberg E. Proc Natl Acad Sci USA 2003; 100: 13940-13945.
[0329] Paukert M, Chen X, Polleichtner G, Schindelin H, Grunder S. J Biol Chem 2008; 283: 572-581. Candidate amino acids involved in H.sup.+ gating of acid-sensing ion channel 1a.
[0330] Poolos N P, Mauk M D, Kocsis J D. J Neurophysiol 1987; 58: 404-416. Activity-evoked increases in extracellular potassium modulate presynaptic excitability in the CA1 region of the hippocampus.
[0331] Prakash R, Yizhar O, Grewe B, Ramakrishnan C, Wang N, Goshen I, Packer A M, Peterka D S, Yuste R, Schnitzer M J, Deisseroth K. Nat Methods 2012; 9: 1171-1179. Two-photon optogenetic toolbox for fast inhibition, excitation and bistable modulation.
[0332] Raimondo J V, Kay L, Ellender T J, Akerman C J. Nat Neurosci 2012; 15: 1102-4. Optogenetic silencing strategies differ in their effects on inhibitory synaptic transmission.
[0333] Ritter E, Piwowarski P, Hegemann P, Barti F J. J Biol Chem 2013; 288: 10451-10458. Light-dark adaptation of channelrhodopsin C128T mutant.
[0334] Schoenenberger P, Gerosa D, Oertner T G. PLos One 2009; 4: e8185. Temporal control of immediate early gene induction by light.
[0335] Sherwood T W, Lee K G, Gormley M G, Askwith C C. J Neurosci 2011; 31: 9723-9734. Heteromeric acid-sensing ion channels (ASICs) composed of ASIC2b and ASIC1.alpha. display novel channel properties and contribute to acidosis-induced neuronal death.
[0336] Stehfest K, Hegemann P. Chemphyschem 2010; 11: 1120-1126. Evolution of the channelrhodopsin photocycle model.
[0337] Shuba Y M, Dietrich C J, Oermann E, Cleemann L, Morad M. Cell Calcium 2008; 44: 220-229. Local extracellular acidification caused by Ca.sup.2+-dependent exocytosis in PC12 cells.
[0338] Szymczak-Workman A L, Vignali K M, Vignali D A. Cold Spring Harb Protoc 2012; 2012: 199-204. Design and construction of 2A peptide-linked multicistronic vectors.
[0339] Torborg C L, Berg A P, Jeffries B W, Bayliss D A, McBain C J. J Neurosci 2006; 26: 7362-7367. TASK-like conductances are present within hippocampal CA1 stratum oriens interneuron subpopulations.
[0340] Towne C, Montgomery K L, Iyer S M, Deisseroth K, Delp S L. Optogenetic Control of Targeted Peripheral Axons in Freely Moving Animals. PLoS ONE 2013; 8: e72691
[0341] Waldmann R, Champigny G, Bassilana F, Heurteaux C, Lazdunski M. A proton-gated cation channel involved in acid-sensing. Nature 1997; 386: 173-177.
[0342] Wang H, Sugiyama Y, Hikima T, Sugano E, Tomita H, Takahashi T, Ishizuka T, Yawo H. Molecular determinants differentiating photocurrent properties of two channelrhodopsins from chlamydomonas. J Biol Chem 2009; 284: 5685-96.
[0343] Wang T-M, Holzhausen L C, Kramer R H. Imaging an optogenetic pH sensor reveals that protons mediate lateral inhibition in the retina. Nature Neuroscience 2014; 17: 262-268.
[0344] Welch J M, Simon S A, Reinhart P H. Proc Natl Acad Sci USA 2000; 97: 13889-13894. The activation mechanism of rat vanilloid receptor 1 by capsaicin involves the pore domain and differs from the activation by either acid or heat.
[0345] Wemmie J A, Taugher R J, Kreple C J. Nat Rev Neurosci 2013; 14: 461-471. Acid sensing ion channels in pain and disease.
[0346] Weng J Y, Lin Y C, Lien C C. J Neurosci 2010; 30: 6548-58. Cell type-specific expression of acid-sensing ion channels in hippocampal interneurons.
[0347] Xiong Z Q, Stringer J L. J Neurophysiol 2000; 83: 3519-3524. Extracellular pH responses in CA1 and the dentate gyrus during electrical stimulation, seizure discharges, and spreading depression.
[0348] Yizhar O, Fenno L E, Davidson T J, Mogri M, Deisseroth K. Neuron 2011; 72: 9-34. Optogenetics in Neural Systems.
[0349] Yermolaieva O, Leonard A S, Schnizler M K, Abboud F M, Welsh K T. Proc Natl Acad Sci USA 2004; 101: 6752-6757. Extracellular acidosis increases neuronal cell calcium by activating acid-sensing ion channel 1a.
[0350] Yizhar O, Fenno L E, Prigge M, Schneider F, Davidson T J, O'Shea D J, Sohal V S, Goshen I, Finkelstein J, Paz J T, Stehfest K, Fudim R, Ramakrishnan C, Huguenard J R, Hegemann P, Deisseroth K. Nature 2011; 477: 171-178. Neocortical excitation/inhibition balance in information processing and social dysfunction.
[0351] Zha X M, Wemmie J A, Green S H, Welsh M J. Proc Natl Acad Sci USA 2006; 103: 16556-16561. Acid-sensing ion channel 1a is a postsynaptic proton receptor that affects the density of dendritic spines.
[0352] Zhang F, Vierock J, Yizhar O, Fenno L E, Tsunoda S, Kianianmomeni A, Prigge M, Berndt A, Cushman J, Polle J, Magnuson J, Hegemann P, Deisseroth K. Cell 2011; 147: 1446-1457. The microbial opsin family of optogenetic tools.
[0353] Zhang F, Wang L P, Brauner M, Liewald J F, Kay K, Watzke N, Wood P G, Bamberg E, Nagel G, Gottschalk A, Deisseroth K. Nature 2007; 446: 633-639. Multimodal fast optical interrogation of neural circuitry.
[0354] Zhang P, Canessa C M. J Gen Physiol 2002; 120: 553-566. Single channel properties of rat acid-sensitive ion channel-1alpha, -2a, and -3 expressed in Xenopus oocytes.
[0355] Ziemann A E, Schnizler M K, Albert G W, Severson M A, Howard III M A, Welsh M J, Wemmie J A. Nat Neurosci 2008; 11: 816-822. Seizure termination by acidosis depends on ASIC1a.
[0356] Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it is readily apparent to those of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims.
[0357] Accordingly, the preceding merely illustrates the principles of the invention. It will be appreciated that those skilled in the art will be able to devise various arrangements which, although not explicitly described or shown herein, embody the principles of the invention and are included within its spirit and scope. Furthermore, all examples and conditional language recited herein are principally intended to aid the reader in understanding the principles of the invention and the concepts contributed by the inventors to furthering the art, and are to be construed as being without limitation to such specifically recited examples and conditions. Moreover, all statements herein reciting principles, aspects, and embodiments of the invention as well as specific examples thereof, are intended to encompass both structural and functional equivalents thereof. Additionally, it is intended that such equivalents include both currently known equivalents and equivalents developed in the future, i.e., any elements developed that perform the same function, regardless of structure. The scope of the present invention, therefore, is not intended to be limited to the exemplary embodiments shown and described herein. Rather, the scope and spirit of present invention is embodied by the appended claims.
Sequence CWU
1
1
621258PRTHalorubrum sodomense 1Met Asp Pro Ile Ala Leu Gln Ala Gly Tyr Asp
Leu Leu Gly Asp Gly1 5 10
15Arg Pro Glu Thr Leu Trp Leu Gly Ile Gly Thr Leu Leu Met Leu Ile
20 25 30Gly Thr Phe Tyr Phe Leu Val
Arg Gly Trp Gly Val Thr Asp Lys Asp 35 40
45Ala Arg Glu Tyr Tyr Ala Val Thr Ile Leu Val Pro Gly Ile Ala
Ser 50 55 60Ala Ala Tyr Leu Ser Met
Phe Phe Gly Ile Gly Leu Thr Glu Val Thr65 70
75 80Val Gly Gly Glu Met Leu Asp Ile Tyr Tyr Ala
Arg Tyr Ala Asp Trp 85 90
95Leu Phe Thr Thr Pro Leu Leu Leu Leu Asp Leu Ala Leu Leu Ala Lys
100 105 110Val Asp Arg Val Thr Ile
Gly Thr Leu Val Gly Val Asp Ala Leu Met 115 120
125Ile Val Thr Gly Leu Ile Gly Ala Leu Ser His Thr Ala Ile
Ala Arg 130 135 140Tyr Ser Trp Trp Leu
Phe Ser Thr Ile Cys Met Ile Val Val Leu Tyr145 150
155 160Phe Leu Ala Thr Ser Leu Arg Ser Ala Ala
Lys Glu Arg Gly Pro Glu 165 170
175Val Ala Ser Thr Phe Asn Thr Leu Thr Ala Leu Val Leu Val Leu Trp
180 185 190Thr Ala Tyr Pro Ile
Leu Trp Ile Ile Gly Thr Glu Gly Ala Gly Val 195
200 205Val Gly Leu Gly Ile Glu Thr Leu Leu Phe Met Val
Leu Asp Val Thr 210 215 220Ala Lys Val
Gly Phe Gly Phe Ile Leu Leu Arg Ser Arg Ala Ile Leu225
230 235 240Gly Asp Thr Glu Ala Pro Glu
Pro Ser Ala Gly Ala Asp Val Ser Ala 245
250 255Ala Asp2534PRTArtificial sequencesynthetic amino
acid sequence 2Met Asp Pro Ile Ala Leu Gln Ala Gly Tyr Asp Leu Leu Gly
Asp Gly1 5 10 15Arg Pro
Glu Thr Leu Trp Leu Gly Ile Gly Thr Leu Leu Met Leu Ile 20
25 30Gly Thr Phe Tyr Phe Leu Val Arg Gly
Trp Gly Val Thr Asp Lys Asp 35 40
45Ala Arg Glu Tyr Tyr Ala Val Thr Ile Leu Val Pro Gly Ile Ala Ser 50
55 60Ala Ala Tyr Leu Ser Met Phe Phe Gly
Ile Gly Leu Thr Glu Val Thr65 70 75
80Val Gly Gly Glu Met Leu Asp Ile Tyr Tyr Ala Arg Tyr Ala
Asp Trp 85 90 95Leu Phe
Thr Thr Pro Leu Leu Leu Leu Asp Leu Ala Leu Leu Ala Lys 100
105 110Val Asp Arg Val Thr Ile Gly Thr Leu
Val Gly Val Asp Ala Leu Met 115 120
125Ile Val Thr Gly Leu Ile Gly Ala Leu Ser His Thr Ala Ile Ala Arg
130 135 140Tyr Ser Trp Trp Leu Phe Ser
Thr Ile Cys Met Ile Val Val Leu Tyr145 150
155 160Phe Leu Ala Thr Ser Leu Arg Ser Ala Ala Lys Glu
Arg Gly Pro Glu 165 170
175Val Ala Ser Thr Phe Asn Thr Leu Thr Ala Leu Val Leu Val Leu Trp
180 185 190Thr Ala Tyr Pro Ile Leu
Trp Ile Ile Gly Thr Glu Gly Ala Gly Val 195 200
205Val Gly Leu Gly Ile Glu Thr Leu Leu Phe Met Val Leu Asp
Val Thr 210 215 220Ala Lys Val Gly Phe
Gly Phe Ile Leu Leu Arg Ser Arg Ala Ile Leu225 230
235 240Gly Asp Thr Glu Ala Pro Glu Pro Ser Ala
Gly Ala Asp Val Ser Ala 245 250
255Ala Asp Arg Pro Val Val Ala Val Ser Lys Ala Ala Ala Lys Ser Arg
260 265 270Ile Thr Ser Glu Gly
Glu Tyr Ile Pro Leu Asp Gln Ile Asp Ile Asn 275
280 285Val Val Ser Lys Gly Glu Glu Leu Phe Thr Gly Val
Val Pro Ile Leu 290 295 300Val Glu Leu
Asp Gly Asp Val Asn Gly His Lys Phe Ser Val Ser Gly305
310 315 320Glu Gly Glu Gly Asp Ala Thr
Tyr Gly Lys Leu Thr Leu Lys Phe Ile 325
330 335Cys Thr Thr Gly Lys Leu Pro Val Pro Trp Pro Thr
Leu Val Thr Thr 340 345 350Phe
Gly Tyr Gly Leu Gln Cys Phe Ala Arg Tyr Pro Asp His Met Lys 355
360 365Gln His Asp Phe Phe Lys Ser Ala Met
Pro Glu Gly Tyr Val Gln Glu 370 375
380Arg Thr Ile Phe Phe Lys Asp Asp Gly Asn Tyr Lys Thr Arg Ala Glu385
390 395 400Val Lys Phe Glu
Gly Asp Thr Leu Val Asn Arg Ile Glu Leu Lys Gly 405
410 415Ile Asp Phe Lys Glu Asp Gly Asn Ile Leu
Gly His Lys Leu Glu Tyr 420 425
430Asn Tyr Asn Ser His Asn Val Tyr Ile Met Ala Asp Lys Gln Lys Asn
435 440 445Gly Ile Lys Val Asn Phe Lys
Ile Arg His Asn Ile Glu Asp Gly Ser 450 455
460Val Gln Leu Ala Asp His Tyr Gln Gln Asn Thr Pro Ile Gly Asp
Gly465 470 475 480Pro Val
Leu Leu Pro Asp Asn His Tyr Leu Ser Tyr Gln Ser Ala Leu
485 490 495Ser Lys Asp Pro Asn Glu Lys
Arg Asp His Met Val Leu Leu Glu Phe 500 505
510Val Thr Ala Ala Gly Ile Thr Leu Gly Met Asp Glu Leu Tyr
Lys Phe 515 520 525Cys Tyr Glu Asn
Glu Val 5303248PRTArtificial sequencesynthetic amino acid sequence
3Met Asp Pro Ile Ala Leu Gln Ala Gly Tyr Asp Leu Leu Gly Asp Gly1
5 10 15Arg Pro Glu Thr Leu Trp
Leu Gly Ile Gly Thr Leu Leu Met Leu Ile 20 25
30Gly Thr Phe Tyr Phe Ile Val Lys Gly Trp Gly Val Thr
Asp Lys Glu 35 40 45Ala Arg Glu
Tyr Tyr Ser Ile Thr Ile Leu Val Pro Gly Ile Ala Ser 50
55 60Ala Ala Tyr Leu Ser Met Phe Phe Gly Ile Gly Leu
Thr Glu Val Thr65 70 75
80Val Ala Gly Glu Val Leu Asp Ile Tyr Tyr Ala Arg Tyr Ala Asp Trp
85 90 95Leu Phe Thr Thr Pro Leu
Leu Leu Leu Asp Leu Ala Leu Leu Ala Lys 100
105 110Val Asp Arg Val Ser Ile Gly Thr Leu Val Gly Val
Asp Ala Leu Met 115 120 125Ile Val
Thr Gly Leu Ile Gly Ala Leu Ser His Thr Pro Leu Ala Arg 130
135 140Tyr Ser Trp Trp Leu Phe Ser Thr Ile Cys Met
Ile Val Val Leu Tyr145 150 155
160Phe Leu Ala Thr Ser Leu Arg Ala Ala Ala Lys Glu Arg Gly Pro Glu
165 170 175Val Ala Ser Thr
Phe Asn Thr Leu Thr Ala Leu Val Leu Val Leu Trp 180
185 190Thr Ala Tyr Pro Ile Leu Trp Ile Ile Gly Thr
Glu Gly Ala Gly Val 195 200 205Val
Gly Leu Gly Ile Glu Thr Leu Leu Phe Met Val Leu Asp Val Thr 210
215 220Ala Lys Val Gly Phe Gly Phe Ile Leu Leu
Arg Ser Arg Ala Ile Leu225 230 235
240Gly Asp Thr Glu Ala Pro Glu Pro
2454223PRTArtificial sequencesynthetic amino acid sequence 4Ala Ser Ser
Phe Gly Lys Ala Leu Leu Glu Phe Val Phe Ile Val Phe1 5
10 15Ala Cys Ile Thr Leu Leu Leu Gly Ile
Asn Ala Ala Lys Ser Lys Ala 20 25
30Ala Ser Arg Val Leu Phe Pro Ala Thr Phe Val Thr Gly Ile Ala Ser
35 40 45Ile Ala Tyr Phe Ser Met Ala
Ser Gly Gly Gly Trp Val Ile Ala Pro 50 55
60Asp Cys Arg Gln Leu Phe Val Ala Arg Tyr Leu Asp Trp Leu Ile Thr65
70 75 80Thr Pro Leu Leu
Leu Ile Asp Leu Gly Leu Val Ala Gly Val Ser Arg 85
90 95Trp Asp Ile Met Ala Leu Cys Leu Ser Asp
Val Leu Met Ile Ala Thr 100 105
110Gly Ala Phe Gly Ser Leu Thr Val Gly Asn Val Lys Trp Val Trp Trp
115 120 125Phe Phe Gly Met Cys Trp Phe
Leu His Ile Ile Phe Ala Leu Gly Lys 130 135
140Ser Trp Ala Glu Ala Ala Lys Ala Lys Gly Gly Asp Ser Ala Ser
Val145 150 155 160Tyr Ser
Lys Ile Ala Gly Ile Thr Val Ile Thr Trp Phe Cys Tyr Pro
165 170 175Val Val Trp Val Phe Ala Glu
Gly Phe Gly Asn Phe Ser Val Thr Phe 180 185
190Glu Val Leu Ile Tyr Gly Val Leu Asp Val Ile Ser Lys Ala
Val Phe 195 200 205Gly Leu Ile Leu
Met Ser Gly Ala Ala Thr Gly Tyr Glu Ser Ile 210 215
2205262PRTOxyrrhis marina 5Met Ala Pro Leu Ala Gln Asp Trp
Thr Tyr Ala Glu Trp Ser Ala Val1 5 10
15Tyr Asn Ala Leu Ser Phe Gly Ile Ala Gly Met Gly Ser Ala
Thr Ile 20 25 30Phe Phe Trp
Leu Gln Leu Pro Asn Val Thr Lys Asn Tyr Arg Thr Ala 35
40 45Leu Thr Ile Thr Gly Ile Val Thr Leu Ile Ala
Thr Tyr His Tyr Phe 50 55 60Arg Ile
Phe Asn Ser Trp Val Ala Ala Phe Asn Val Gly Leu Gly Val65
70 75 80Asn Gly Ala Tyr Glu Val Thr
Val Ser Gly Thr Pro Phe Asn Asp Ala 85 90
95Tyr Arg Tyr Val Asp Trp Leu Leu Thr Val Pro Leu Leu
Leu Val Glu 100 105 110Leu Ile
Leu Val Met Lys Leu Pro Ala Lys Glu Thr Val Cys Leu Ala 115
120 125Trp Thr Leu Gly Ile Ala Ser Ala Val Met
Val Ala Leu Gly Tyr Pro 130 135 140Gly
Glu Ile Gln Asp Asp Leu Ser Val Arg Trp Phe Trp Trp Ala Cys145
150 155 160Ala Met Val Pro Phe Val
Tyr Val Val Gly Thr Leu Val Val Gly Leu 165
170 175Gly Ala Ala Thr Ala Lys Gln Pro Glu Gly Val Val
Asp Leu Val Ser 180 185 190Ala
Ala Arg Tyr Leu Thr Val Val Ser Trp Leu Thr Tyr Pro Phe Val 195
200 205Tyr Ile Val Lys Asn Ile Gly Leu Ala
Gly Ser Thr Ala Thr Met Tyr 210 215
220Glu Gln Ile Gly Tyr Ser Ala Ala Asp Val Thr Ala Lys Ala Val Phe225
230 235 240Gly Val Leu Ile
Trp Ala Ile Ala Asn Ala Lys Ser Arg Leu Glu Glu 245
250 255Glu Gly Lys Leu Arg Ala
2606313PRTLeptosphaeria maculans 6Met Ile Val Asp Gln Phe Glu Glu Val Leu
Met Lys Thr Ser Gln Leu1 5 10
15Phe Pro Leu Pro Thr Ala Thr Gln Ser Ala Gln Pro Thr His Val Ala
20 25 30Pro Val Pro Thr Val Leu
Pro Asp Thr Pro Ile Tyr Glu Thr Val Gly 35 40
45Asp Ser Gly Ser Lys Thr Leu Trp Val Val Phe Val Leu Met
Leu Ile 50 55 60Ala Ser Ala Ala Phe
Thr Ala Leu Ser Trp Lys Ile Pro Val Asn Arg65 70
75 80Arg Leu Tyr His Val Ile Thr Thr Ile Ile
Thr Leu Thr Ala Ala Leu 85 90
95Ser Tyr Phe Ala Met Ala Thr Gly His Gly Val Ala Leu Asn Lys Ile
100 105 110Val Ile Arg Thr Gln
His Asp His Val Pro Asp Thr Tyr Glu Thr Val 115
120 125Tyr Arg Gln Val Tyr Tyr Ala Arg Tyr Ile Asp Trp
Ala Ile Thr Thr 130 135 140Pro Leu Leu
Leu Leu Asp Leu Gly Leu Leu Ala Gly Met Ser Gly Ala145
150 155 160His Ile Phe Met Ala Ile Val
Ala Asp Leu Ile Met Val Leu Thr Gly 165
170 175Leu Phe Ala Ala Phe Gly Ser Glu Gly Thr Pro Gln
Lys Trp Gly Trp 180 185 190Tyr
Thr Ile Ala Cys Ile Ala Tyr Ile Phe Val Val Trp His Leu Val 195
200 205Leu Asn Gly Gly Ala Asn Ala Arg Val
Lys Gly Glu Lys Leu Arg Ser 210 215
220Phe Phe Val Ala Ile Gly Ala Tyr Thr Leu Ile Leu Trp Thr Ala Tyr225
230 235 240Pro Ile Val Trp
Gly Leu Ala Asp Gly Ala Arg Lys Ile Gly Val Asp 245
250 255Gly Glu Ile Ile Ala Tyr Ala Val Leu Asp
Val Leu Ala Lys Gly Val 260 265
270Phe Gly Ala Trp Leu Leu Val Thr His Ala Asn Leu Arg Glu Ser Asp
275 280 285Val Glu Leu Asn Gly Phe Trp
Ala Asn Gly Leu Asn Arg Glu Gly Ala 290 295
300Ile Arg Ile Gly Glu Asp Asp Gly Ala305
3107321PRTLeptosphaeria maculans 7Met Ile Val Asp Gln Phe Glu Glu Val Leu
Met Lys Thr Ser Gln Leu1 5 10
15Phe Pro Leu Pro Thr Ala Thr Gln Ser Ala Gln Pro Thr His Val Ala
20 25 30Pro Val Pro Thr Val Leu
Pro Asp Thr Pro Ile Tyr Glu Thr Val Gly 35 40
45Asp Ser Gly Ser Lys Thr Leu Trp Val Val Phe Val Leu Met
Leu Ile 50 55 60Ala Ser Ala Ala Phe
Thr Ala Leu Ser Trp Lys Ile Pro Val Asn Arg65 70
75 80Arg Leu Tyr His Val Ile Thr Thr Ile Ile
Thr Leu Thr Ala Ala Leu 85 90
95Ser Tyr Phe Ala Met Ala Thr Gly His Gly Val Ala Leu Asn Lys Ile
100 105 110Val Ile Arg Thr Gln
His Asp His Val Pro Asp Thr Tyr Glu Thr Val 115
120 125Tyr Arg Gln Val Tyr Tyr Ala Arg Tyr Ile Asp Trp
Ala Ile Thr Thr 130 135 140Pro Leu Leu
Leu Leu Asp Leu Gly Leu Leu Ala Gly Met Ser Gly Ala145
150 155 160His Ile Phe Met Ala Ile Val
Ala Asp Leu Ile Met Val Leu Thr Gly 165
170 175Leu Phe Ala Ala Phe Gly Ser Glu Gly Thr Pro Gln
Lys Trp Gly Trp 180 185 190Tyr
Thr Ile Ala Cys Ile Ala Tyr Ile Phe Val Val Trp His Leu Val 195
200 205Leu Asn Gly Gly Ala Asn Ala Arg Val
Lys Gly Glu Lys Leu Arg Ser 210 215
220Phe Phe Val Ala Ile Gly Ala Tyr Thr Leu Ile Leu Trp Thr Ala Tyr225
230 235 240Pro Ile Val Trp
Gly Leu Ala Asp Gly Ala Arg Lys Ile Gly Val Asp 245
250 255Gly Glu Ile Ile Ala Tyr Ala Val Leu Asp
Val Leu Ala Lys Gly Val 260 265
270Phe Gly Ala Trp Leu Leu Val Thr His Ala Asn Leu Arg Glu Ser Asp
275 280 285Val Glu Leu Asn Gly Phe Trp
Ala Asn Gly Leu Asn Arg Glu Gly Ala 290 295
300Ile Arg Ile Gly Glu Asp Asp Gly Ala Arg Pro Val Val Ala Val
Ser305 310 315
320Lys8310PRTChlamydomonas reinhardtii 8Met Asp Tyr Gly Gly Ala Leu Ser
Ala Val Gly Arg Glu Leu Leu Phe1 5 10
15Val Thr Asn Pro Val Val Val Asn Gly Ser Val Leu Val Pro
Glu Asp 20 25 30Gln Cys Tyr
Cys Ala Gly Trp Ile Glu Ser Arg Gly Thr Asn Gly Ala 35
40 45Gln Thr Ala Ser Asn Val Leu Gln Trp Leu Ala
Ala Gly Phe Ser Ile 50 55 60Leu Leu
Leu Met Phe Tyr Ala Tyr Gln Thr Trp Lys Ser Thr Cys Gly65
70 75 80Trp Glu Glu Ile Tyr Val Cys
Ala Ile Glu Met Val Lys Val Ile Leu 85 90
95Glu Phe Phe Phe Glu Phe Lys Asn Pro Ser Met Leu Tyr
Leu Ala Thr 100 105 110Gly His
Arg Val Gln Trp Leu Arg Tyr Ala Glu Trp Leu Leu Thr Cys 115
120 125Pro Val Ile Leu Ile His Leu Ser Asn Leu
Thr Gly Leu Ser Asn Asp 130 135 140Tyr
Ser Arg Arg Thr Met Gly Leu Leu Val Ser Asp Ile Gly Thr Ile145
150 155 160Val Trp Gly Ala Thr Ser
Ala Met Ala Thr Gly Tyr Val Lys Val Ile 165
170 175Phe Phe Cys Leu Gly Leu Cys Tyr Gly Ala Asn Thr
Phe Phe His Ala 180 185 190Ala
Lys Ala Tyr Ile Glu Gly Tyr His Thr Val Pro Lys Gly Arg Cys 195
200 205Arg Gln Val Val Thr Gly Met Ala Trp
Leu Phe Phe Val Ser Trp Gly 210 215
220Met Phe Pro Ile Leu Phe Ile Leu Gly Pro Glu Gly Phe Gly Val Leu225
230 235 240Ser Val Tyr Gly
Ser Thr Val Gly His Thr Ile Ile Asp Leu Met Ser 245
250 255Lys Asn Cys Trp Gly Leu Leu Gly His Tyr
Leu Arg Val Leu Ile His 260 265
270Glu His Ile Leu Ile His Gly Asp Ile Arg Lys Thr Thr Lys Leu Asn
275 280 285Ile Gly Gly Thr Glu Ile Glu
Val Glu Thr Leu Val Glu Asp Glu Ala 290 295
300Glu Ala Gly Ala Val Pro305 3109310PRTArtificial
sequencesynthetic amino acid sequence 9Met Asp Tyr Gly Gly Ala Leu Ser
Ala Val Gly Arg Glu Leu Leu Phe1 5 10
15Val Thr Asn Pro Val Val Val Asn Gly Ser Val Leu Val Pro
Glu Asp 20 25 30Gln Cys Tyr
Cys Ala Gly Trp Ile Glu Ser Arg Gly Thr Asn Gly Ala 35
40 45Gln Thr Ala Ser Asn Val Leu Gln Trp Leu Ala
Ala Gly Phe Ser Ile 50 55 60Leu Leu
Leu Met Phe Tyr Ala Tyr Gln Thr Trp Lys Ser Thr Cys Gly65
70 75 80Trp Glu Glu Ile Tyr Val Cys
Ala Ile Glu Met Val Lys Val Ile Leu 85 90
95Glu Phe Phe Phe Glu Phe Lys Asn Pro Ser Met Leu Tyr
Leu Ala Thr 100 105 110Gly His
Arg Val Gln Trp Leu Arg Tyr Ala Glu Trp Leu Leu Thr Ser 115
120 125Pro Val Ile Leu Ile His Leu Ser Asn Leu
Thr Gly Leu Ser Asn Asp 130 135 140Tyr
Ser Arg Arg Thr Met Gly Leu Leu Val Ser Asp Ile Gly Thr Ile145
150 155 160Val Trp Gly Ala Thr Ser
Ala Met Ala Thr Gly Tyr Val Lys Val Ile 165
170 175Phe Phe Cys Leu Gly Leu Cys Tyr Gly Ala Asn Thr
Phe Phe His Ala 180 185 190Ala
Lys Ala Tyr Ile Glu Gly Tyr His Thr Val Pro Lys Gly Arg Cys 195
200 205Arg Gln Val Val Thr Gly Met Ala Trp
Leu Phe Phe Val Ser Trp Gly 210 215
220Met Phe Pro Ile Leu Phe Ile Leu Gly Pro Glu Gly Phe Gly Val Leu225
230 235 240Ser Val Tyr Gly
Ser Thr Val Gly His Thr Ile Ile Asp Leu Met Ser 245
250 255Lys Asn Cys Trp Gly Leu Leu Gly His Tyr
Leu Arg Val Leu Ile His 260 265
270Glu His Ile Leu Ile His Gly Asp Ile Arg Lys Thr Thr Lys Leu Asn
275 280 285Ile Gly Gly Thr Glu Ile Glu
Val Glu Thr Leu Val Glu Asp Glu Ala 290 295
300Glu Ala Gly Ala Val Pro305 31010310PRTArtificial
sequencesynthetic amino acid sequence 10Met Asp Tyr Gly Gly Ala Leu Ser
Ala Val Gly Arg Glu Leu Leu Phe1 5 10
15Val Thr Asn Pro Val Val Val Asn Gly Ser Val Leu Val Pro
Glu Asp 20 25 30Gln Cys Tyr
Cys Ala Gly Trp Ile Glu Ser Arg Gly Thr Asn Gly Ala 35
40 45Gln Thr Ala Ser Asn Val Leu Gln Trp Leu Ala
Ala Gly Phe Ser Ile 50 55 60Leu Leu
Leu Met Phe Tyr Ala Tyr Gln Thr Trp Lys Ser Thr Cys Gly65
70 75 80Trp Glu Glu Ile Tyr Val Cys
Ala Ile Glu Met Val Lys Val Ile Leu 85 90
95Glu Phe Phe Phe Glu Phe Lys Asn Pro Ser Met Leu Tyr
Leu Ala Thr 100 105 110Gly His
Arg Val Gln Trp Leu Arg Tyr Ala Glu Trp Leu Leu Thr Ser 115
120 125Pro Val Ile Leu Ile His Leu Ser Asn Leu
Thr Gly Leu Ser Asn Asp 130 135 140Tyr
Ser Arg Arg Thr Met Gly Leu Leu Val Ser Ala Ile Gly Thr Ile145
150 155 160Val Trp Gly Ala Thr Ser
Ala Met Ala Thr Gly Tyr Val Lys Val Ile 165
170 175Phe Phe Cys Leu Gly Leu Cys Tyr Gly Ala Asn Thr
Phe Phe His Ala 180 185 190Ala
Lys Ala Tyr Ile Glu Gly Tyr His Thr Val Pro Lys Gly Arg Cys 195
200 205Arg Gln Val Val Thr Gly Met Ala Trp
Leu Phe Phe Val Ser Trp Gly 210 215
220Met Phe Pro Ile Leu Phe Ile Leu Gly Pro Glu Gly Phe Gly Val Leu225
230 235 240Ser Val Tyr Gly
Ser Thr Val Gly His Thr Ile Ile Asp Leu Met Ser 245
250 255Lys Asn Cys Trp Gly Leu Leu Gly His Tyr
Leu Arg Val Leu Ile His 260 265
270Glu His Ile Leu Ile His Gly Asp Ile Arg Lys Thr Thr Lys Leu Asn
275 280 285Ile Gly Gly Thr Glu Ile Glu
Val Glu Thr Leu Val Glu Asp Glu Ala 290 295
300Glu Ala Gly Ala Val Pro305 31011349PRTArtificial
sequencesynthetic amino acid sequence 11Met Ser Arg Arg Pro Trp Leu Leu
Ala Leu Ala Leu Ala Val Ala Leu1 5 10
15Ala Ala Gly Ser Ala Gly Ala Ser Thr Gly Ser Asp Ala Thr
Val Pro 20 25 30Val Ala Thr
Gln Asp Gly Pro Asp Tyr Val Phe His Arg Ala His Glu 35
40 45Arg Met Leu Phe Gln Thr Ser Tyr Thr Leu Glu
Asn Asn Gly Ser Val 50 55 60Ile Cys
Ile Pro Asn Asn Gly Gln Cys Phe Cys Leu Ala Trp Leu Lys65
70 75 80Ser Asn Gly Thr Asn Ala Glu
Lys Leu Ala Ala Asn Ile Leu Gln Trp 85 90
95Ile Thr Phe Ala Leu Ser Ala Leu Cys Leu Met Phe Tyr
Gly Tyr Gln 100 105 110Thr Trp
Lys Ser Thr Cys Gly Trp Glu Glu Ile Tyr Val Ala Thr Ile 115
120 125Glu Met Ile Lys Phe Ile Ile Glu Tyr Phe
His Glu Phe Asp Glu Pro 130 135 140Ala
Val Ile Tyr Ser Ser Asn Gly Asn Lys Thr Val Trp Leu Arg Tyr145
150 155 160Ala Glu Trp Leu Leu Thr
Cys Pro Val Leu Leu Ile His Leu Ser Asn 165
170 175Leu Thr Gly Leu Lys Asp Asp Tyr Ser Lys Arg Thr
Met Gly Leu Leu 180 185 190Val
Ser Asp Val Gly Cys Ile Val Trp Gly Ala Thr Ser Ala Met Cys 195
200 205Thr Gly Trp Thr Lys Ile Leu Phe Phe
Leu Ile Ser Leu Ser Tyr Gly 210 215
220Met Tyr Thr Tyr Phe His Ala Ala Lys Val Tyr Ile Glu Ala Phe His225
230 235 240Thr Val Pro Lys
Gly Ile Cys Arg Glu Leu Val Arg Val Met Ala Trp 245
250 255Thr Phe Phe Val Ala Trp Gly Met Phe Pro
Val Leu Phe Leu Leu Gly 260 265
270Thr Glu Gly Phe Gly His Ile Ser Pro Tyr Gly Ser Ala Ile Gly His
275 280 285Ser Ile Leu Asp Leu Ile Ala
Lys Asn Met Trp Gly Val Leu Gly Asn 290 295
300Tyr Leu Arg Val Lys Ile His Glu His Ile Leu Leu Tyr Gly Asp
Ile305 310 315 320Arg Lys
Lys Gln Lys Ile Thr Ile Ala Gly Gln Glu Met Glu Val Glu
325 330 335Thr Leu Val Ala Glu Glu Glu
Asp Ser Glu Gln Ile Asp 340
34512344PRTArtificial sequencesynthetic amino acid sequence 12Met Ser Arg
Arg Pro Trp Leu Leu Ala Leu Ala Leu Ala Val Ala Leu1 5
10 15Ala Ala Gly Ser Ala Gly Ala Ser Thr
Gly Ser Asp Ala Thr Val Pro 20 25
30Val Ala Thr Gln Asp Gly Pro Asp Tyr Val Phe His Arg Ala His Glu
35 40 45Arg Met Leu Phe Gln Thr Ser
Tyr Thr Leu Glu Asn Asn Gly Ser Val 50 55
60Ile Cys Ile Pro Asn Asn Gly Gln Cys Phe Cys Leu Ala Trp Leu Lys65
70 75 80Ser Asn Gly Thr
Asn Ala Glu Lys Leu Ala Ala Asn Ile Leu Gln Trp 85
90 95Ile Thr Phe Ala Leu Ser Ala Leu Cys Leu
Met Phe Tyr Gly Tyr Gln 100 105
110Thr Trp Lys Ser Thr Cys Gly Trp Glu Thr Ile Tyr Val Ala Thr Ile
115 120 125Glu Met Ile Lys Phe Ile Ile
Glu Tyr Phe His Glu Phe Asp Glu Pro 130 135
140Ala Val Ile Tyr Ser Ser Asn Gly Asn Lys Thr Val Trp Leu Arg
Tyr145 150 155 160Ala Glu
Trp Leu Leu Thr Cys Pro Val Leu Leu Ile His Leu Ser Asn
165 170 175Leu Thr Gly Leu Lys Asp Asp
Tyr Ser Lys Arg Thr Met Gly Leu Leu 180 185
190Val Ser Asp Val Gly Cys Ile Val Trp Gly Ala Thr Ser Ala
Met Cys 195 200 205Thr Gly Trp Thr
Lys Ile Leu Phe Phe Leu Ile Ser Leu Ser Tyr Gly 210
215 220Met Tyr Thr Tyr Phe His Ala Ala Lys Val Tyr Ile
Glu Ala Phe His225 230 235
240Thr Val Pro Lys Gly Ile Cys Arg Glu Leu Val Arg Val Met Ala Trp
245 250 255Thr Phe Phe Val Ala
Trp Gly Met Phe Pro Val Leu Phe Leu Leu Gly 260
265 270Thr Glu Gly Phe Gly His Ile Ser Pro Tyr Gly Ser
Ala Ile Gly His 275 280 285Ser Ile
Leu Asp Leu Ile Ala Lys Asn Met Trp Gly Val Leu Gly Asn 290
295 300Tyr Leu Arg Val Lys Ile His Glu His Ile Leu
Leu Tyr Gly Asp Ile305 310 315
320Arg Lys Lys Gln Lys Ile Thr Ile Ala Gly Gln Glu Met Glu Val Glu
325 330 335Thr Leu Val Ala
Glu Glu Glu Asp 34013349PRTArtificial sequencesynthetic amino
acid sequence 13Met Ser Arg Arg Pro Trp Leu Leu Ala Leu Ala Leu Ala Val
Ala Leu1 5 10 15Ala Ala
Gly Ser Ala Gly Ala Ser Thr Gly Ser Asp Ala Thr Val Pro 20
25 30Val Ala Thr Gln Asp Gly Pro Asp Tyr
Val Phe His Arg Ala His Glu 35 40
45Arg Met Leu Phe Gln Thr Ser Tyr Thr Leu Glu Asn Asn Gly Ser Val 50
55 60Ile Cys Ile Pro Asn Asn Gly Gln Cys
Phe Cys Leu Ala Trp Leu Lys65 70 75
80Ser Asn Gly Thr Asn Ala Glu Lys Leu Ala Ala Asn Ile Leu
Gln Trp 85 90 95Ile Thr
Phe Ala Leu Ser Ala Leu Cys Leu Met Phe Tyr Gly Tyr Gln 100
105 110Thr Trp Lys Ser Thr Cys Gly Trp Glu
Glu Ile Tyr Val Ala Thr Ile 115 120
125Glu Met Ile Lys Phe Ile Ile Glu Tyr Phe His Glu Phe Asp Glu Pro
130 135 140Ala Val Ile Tyr Ser Ser Asn
Gly Asn Lys Thr Val Trp Leu Arg Tyr145 150
155 160Ala Thr Trp Leu Leu Thr Cys Pro Val Leu Leu Ile
His Leu Ser Asn 165 170
175Leu Thr Gly Leu Lys Asp Asp Tyr Ser Lys Arg Thr Met Gly Leu Leu
180 185 190Val Ser Asp Val Gly Cys
Ile Val Trp Gly Ala Thr Ser Ala Met Cys 195 200
205Thr Gly Trp Thr Lys Ile Leu Phe Phe Leu Ile Ser Leu Ser
Tyr Gly 210 215 220Met Tyr Thr Tyr Phe
His Ala Ala Lys Val Tyr Ile Glu Ala Phe His225 230
235 240Thr Val Pro Lys Gly Ile Cys Arg Glu Leu
Val Arg Val Met Ala Trp 245 250
255Thr Phe Phe Val Ala Trp Gly Met Phe Pro Val Leu Phe Leu Leu Gly
260 265 270Thr Glu Gly Phe Gly
His Ile Ser Pro Tyr Gly Ser Ala Ile Gly His 275
280 285Ser Ile Leu Asp Leu Ile Ala Lys Asn Met Trp Gly
Val Leu Gly Asn 290 295 300Tyr Leu Arg
Val Lys Ile His Glu His Ile Leu Leu Tyr Gly Asp Ile305
310 315 320Arg Lys Lys Gln Lys Ile Thr
Ile Ala Gly Gln Glu Met Glu Val Glu 325
330 335Thr Leu Val Ala Glu Glu Glu Asp Ser Glu Gln Ile
Asp 340 34514349PRTArtificial
sequencesynthetic amino acid sequence 14Met Ser Arg Arg Pro Trp Leu Leu
Ala Leu Ala Leu Ala Val Ala Leu1 5 10
15Ala Ala Gly Ser Ala Gly Ala Ser Thr Gly Ser Asp Ala Thr
Val Pro 20 25 30Val Ala Thr
Gln Asp Gly Pro Asp Tyr Val Phe His Arg Ala His Glu 35
40 45Arg Met Leu Phe Gln Thr Ser Tyr Thr Leu Glu
Asn Asn Gly Ser Val 50 55 60Ile Cys
Ile Pro Asn Asn Gly Gln Cys Phe Cys Leu Ala Trp Leu Lys65
70 75 80Ser Asn Gly Thr Asn Ala Glu
Lys Leu Ala Ala Asn Ile Leu Gln Trp 85 90
95Ile Thr Phe Ala Leu Ser Ala Leu Cys Leu Met Phe Tyr
Gly Tyr Gln 100 105 110Thr Trp
Lys Ser Thr Cys Gly Trp Glu Thr Ile Tyr Val Ala Thr Ile 115
120 125Glu Met Ile Lys Phe Ile Ile Glu Tyr Phe
His Glu Phe Asp Glu Pro 130 135 140Ala
Val Ile Tyr Ser Ser Asn Gly Asn Lys Thr Val Trp Leu Arg Tyr145
150 155 160Ala Thr Trp Leu Leu Thr
Cys Pro Val Leu Leu Ile His Leu Ser Asn 165
170 175Leu Thr Gly Leu Lys Asp Asp Tyr Ser Lys Arg Thr
Met Gly Leu Leu 180 185 190Val
Ser Asp Val Gly Cys Ile Val Trp Gly Ala Thr Ser Ala Met Cys 195
200 205Thr Gly Trp Thr Lys Ile Leu Phe Phe
Leu Ile Ser Leu Ser Tyr Gly 210 215
220Met Tyr Thr Tyr Phe His Ala Ala Lys Val Tyr Ile Glu Ala Phe His225
230 235 240Thr Val Pro Lys
Gly Ile Cys Arg Glu Leu Val Arg Val Met Ala Trp 245
250 255Thr Phe Phe Val Ala Trp Gly Met Phe Pro
Val Leu Phe Leu Leu Gly 260 265
270Thr Glu Gly Phe Gly His Ile Ser Pro Tyr Gly Ser Ala Ile Gly His
275 280 285Ser Ile Leu Asp Leu Ile Ala
Lys Asn Met Trp Gly Val Leu Gly Asn 290 295
300Tyr Leu Arg Val Lys Ile His Glu His Ile Leu Leu Tyr Gly Asp
Ile305 310 315 320Arg Lys
Lys Gln Lys Ile Thr Ile Ala Gly Gln Glu Met Glu Val Glu
325 330 335Thr Leu Val Ala Glu Glu Glu
Asp Ser Glu Gln Ile Asp 340
34515365PRTDunaliella salina 15Met Arg Arg Arg Glu Ser Gln Leu Ala Tyr
Leu Cys Leu Phe Val Leu1 5 10
15Ile Ala Gly Trp Ala Pro Arg Leu Thr Glu Ser Ala Pro Asp Leu Ala
20 25 30Glu Arg Arg Pro Pro Ser
Glu Arg Asn Thr Pro Tyr Ala Asn Ile Lys 35 40
45Lys Val Pro Asn Ile Thr Glu Pro Asn Ala Asn Val Gln Leu
Asp Gly 50 55 60Trp Ala Leu Tyr Gln
Asp Phe Tyr Tyr Leu Ala Gly Ser Asp Lys Glu65 70
75 80Trp Val Val Gly Pro Ser Asp Gln Cys Tyr
Cys Arg Ala Trp Ser Lys 85 90
95Ser His Gly Thr Asp Arg Glu Gly Glu Ala Ala Val Val Trp Ala Tyr
100 105 110Ile Val Phe Ala Ile
Cys Ile Val Gln Leu Val Tyr Phe Met Phe Ala 115
120 125Ala Trp Lys Ala Thr Val Gly Trp Glu Glu Val Tyr
Val Asn Ile Ile 130 135 140Glu Leu Val
His Ile Ala Leu Val Ile Trp Val Glu Phe Asp Lys Pro145
150 155 160Ala Met Leu Tyr Leu Asn Asp
Gly Gln Met Val Pro Trp Leu Arg Tyr 165
170 175Ser Ala Trp Leu Leu Ser Cys Pro Val Ile Leu Ile
His Leu Ser Asn 180 185 190Leu
Thr Gly Leu Lys Gly Asp Tyr Ser Lys Arg Thr Met Gly Leu Leu 195
200 205Val Ser Asp Ile Gly Thr Ile Val Phe
Gly Thr Ser Ala Ala Leu Ala 210 215
220Pro Pro Asn His Val Lys Val Ile Leu Phe Thr Ile Gly Leu Leu Tyr225
230 235 240Gly Leu Phe Thr
Phe Phe Thr Ala Ala Lys Val Tyr Ile Glu Ala Tyr 245
250 255His Thr Val Pro Lys Gly Gln Cys Arg Asn
Leu Val Arg Ala Met Ala 260 265
270Trp Thr Tyr Phe Val Ser Trp Ala Met Phe Pro Ile Leu Phe Ile Leu
275 280 285Gly Arg Glu Gly Phe Gly His
Ile Thr Tyr Phe Gly Ser Ser Ile Gly 290 295
300His Phe Ile Leu Glu Ile Phe Ser Lys Asn Leu Trp Ser Leu Leu
Gly305 310 315 320His Gly
Leu Arg Tyr Arg Ile Arg Gln His Ile Ile Ile His Gly Asn
325 330 335Leu Thr Lys Lys Asn Lys Ile
Asn Ile Ala Gly Asp Asn Val Glu Val 340 345
350Glu Glu Tyr Val Asp Ser Asn Asp Lys Asp Ser Asp Val
355 360 36516273PRTNatronomonas
pharaonis 16Val Thr Gln Arg Glu Leu Phe Glu Phe Val Leu Asn Asp Pro Leu
Leu1 5 10 15Ala Ser Ser
Leu Tyr Ile Asn Ile Ala Leu Ala Gly Leu Ser Ile Leu 20
25 30Leu Phe Val Phe Met Thr Arg Gly Leu Asp
Asp Pro Arg Ala Lys Leu 35 40
45Ile Ala Val Ser Thr Ile Leu Val Pro Val Val Ser Ile Ala Ser Tyr 50
55 60Thr Gly Leu Ala Ser Gly Leu Thr Ile
Ser Val Leu Glu Met Pro Ala65 70 75
80Gly His Phe Ala Glu Gly Ser Ser Val Met Leu Gly Gly Glu
Glu Val 85 90 95Asp Gly
Val Val Thr Met Trp Gly Arg Tyr Leu Thr Trp Ala Leu Ser 100
105 110Thr Pro Met Ile Leu Leu Ala Leu Gly
Leu Leu Ala Gly Ser Asn Ala 115 120
125Thr Lys Leu Phe Thr Ala Ile Thr Phe Asp Ile Ala Met Cys Val Thr
130 135 140Gly Leu Ala Ala Ala Leu Thr
Thr Ser Ser His Leu Met Arg Trp Phe145 150
155 160Trp Tyr Ala Ile Ser Cys Ala Cys Phe Leu Val Val
Leu Tyr Ile Leu 165 170
175Leu Val Glu Trp Ala Gln Asp Ala Lys Ala Ala Gly Thr Ala Asp Met
180 185 190Phe Asn Thr Leu Lys Leu
Leu Thr Val Val Met Trp Leu Gly Tyr Pro 195 200
205Ile Val Trp Ala Leu Gly Val Glu Gly Ile Ala Val Leu Pro
Val Gly 210 215 220Val Thr Ser Trp Gly
Tyr Ser Phe Leu Asp Ile Val Ala Lys Tyr Ile225 230
235 240Phe Ala Phe Leu Leu Leu Asn Tyr Leu Thr
Ser Asn Glu Ser Val Val 245 250
255Ser Gly Ser Ile Leu Asp Val Pro Ser Ala Ser Gly Thr Pro Ala Asp
260 265 270Asp17559PRTArtificial
sequencesynthetic amino acid sequence 17Met Thr Glu Thr Leu Pro Pro Val
Thr Glu Ser Ala Val Ala Leu Gln1 5 10
15Ala Glu Val Thr Gln Arg Glu Leu Phe Glu Phe Val Leu Asn
Asp Pro 20 25 30Leu Leu Ala
Ser Ser Leu Tyr Ile Asn Ile Ala Leu Ala Gly Leu Ser 35
40 45Ile Leu Leu Phe Val Phe Met Thr Arg Gly Leu
Asp Asp Pro Arg Ala 50 55 60Lys Leu
Ile Ala Val Ser Thr Ile Leu Val Pro Val Val Ser Ile Ala65
70 75 80Ser Tyr Thr Gly Leu Ala Ser
Gly Leu Thr Ile Ser Val Leu Glu Met 85 90
95Pro Ala Gly His Phe Ala Glu Gly Ser Ser Val Met Leu
Gly Gly Glu 100 105 110Glu Val
Asp Gly Val Val Thr Met Trp Gly Arg Tyr Leu Thr Trp Ala 115
120 125Leu Ser Thr Pro Met Ile Leu Leu Ala Leu
Gly Leu Leu Ala Gly Ser 130 135 140Asn
Ala Thr Lys Leu Phe Thr Ala Ile Thr Phe Asp Ile Ala Met Cys145
150 155 160Val Thr Gly Leu Ala Ala
Ala Leu Thr Thr Ser Ser His Leu Met Arg 165
170 175Trp Phe Trp Tyr Ala Ile Ser Cys Ala Cys Phe Leu
Val Val Leu Tyr 180 185 190Ile
Leu Leu Val Glu Trp Ala Gln Asp Ala Lys Ala Ala Gly Thr Ala 195
200 205Asp Met Phe Asn Thr Leu Lys Leu Leu
Thr Val Val Met Trp Leu Gly 210 215
220Tyr Pro Ile Val Trp Ala Leu Gly Val Glu Gly Ile Ala Val Leu Pro225
230 235 240Val Gly Val Thr
Ser Trp Gly Tyr Ser Phe Leu Asp Ile Val Ala Lys 245
250 255Tyr Ile Phe Ala Phe Leu Leu Leu Asn Tyr
Leu Thr Ser Asn Glu Ser 260 265
270Val Val Ser Gly Ser Ile Leu Asp Val Pro Ser Ala Ser Gly Thr Pro
275 280 285Ala Asp Asp Ala Ala Ala Lys
Ser Arg Ile Thr Ser Glu Gly Glu Tyr 290 295
300Ile Pro Leu Asp Gln Ile Asp Ile Asn Val Val Ser Lys Gly Glu
Glu305 310 315 320Leu Phe
Thr Gly Val Val Pro Ile Leu Val Glu Leu Asp Gly Asp Val
325 330 335Asn Gly His Lys Phe Ser Val
Ser Gly Glu Gly Glu Gly Asp Ala Thr 340 345
350Tyr Gly Lys Leu Thr Leu Lys Phe Ile Cys Thr Thr Gly Lys
Leu Pro 355 360 365Val Pro Trp Pro
Thr Leu Val Thr Thr Phe Gly Tyr Gly Leu Gln Cys 370
375 380Phe Ala Arg Tyr Pro Asp His Met Lys Gln His Asp
Phe Phe Lys Ser385 390 395
400Ala Met Pro Glu Gly Tyr Val Gln Glu Arg Thr Ile Phe Phe Lys Asp
405 410 415Asp Gly Asn Tyr Lys
Thr Arg Ala Glu Val Lys Phe Glu Gly Asp Thr 420
425 430Leu Val Asn Arg Ile Glu Leu Lys Gly Ile Asp Phe
Lys Glu Asp Gly 435 440 445Asn Ile
Leu Gly His Lys Leu Glu Tyr Asn Tyr Asn Ser His Asn Val 450
455 460Tyr Ile Met Ala Asp Lys Gln Lys Asn Gly Ile
Lys Val Asn Phe Lys465 470 475
480Ile Arg His Asn Ile Glu Asp Gly Ser Val Gln Leu Ala Asp His Tyr
485 490 495Gln Gln Asn Thr
Pro Ile Gly Asp Gly Pro Val Leu Leu Pro Asp Asn 500
505 510His Tyr Leu Ser Tyr Gln Ser Ala Leu Ser Lys
Asp Pro Asn Glu Lys 515 520 525Arg
Asp His Met Val Leu Leu Glu Phe Val Thr Ala Ala Gly Ile Thr 530
535 540Leu Gly Met Asp Glu Leu Tyr Lys Phe Cys
Tyr Glu Asn Glu Val545 550
55518542PRTArtificial sequencesynthetic amino acid sequence 18Met Val Thr
Gln Arg Glu Leu Phe Glu Phe Val Leu Asn Asp Pro Leu1 5
10 15Leu Ala Ser Ser Leu Tyr Ile Asn Ile
Ala Leu Ala Gly Leu Ser Ile 20 25
30Leu Leu Phe Val Phe Met Thr Arg Gly Leu Asp Asp Pro Arg Ala Lys
35 40 45Leu Ile Ala Val Ser Thr Ile
Leu Val Pro Val Val Ser Ile Ala Ser 50 55
60Tyr Thr Gly Leu Ala Ser Gly Leu Thr Ile Ser Val Leu Glu Met Pro65
70 75 80Ala Gly His Phe
Ala Glu Gly Ser Ser Val Met Leu Gly Gly Glu Glu 85
90 95Val Asp Gly Val Val Thr Met Trp Gly Arg
Tyr Leu Thr Trp Ala Leu 100 105
110Ser Thr Pro Met Ile Leu Leu Ala Leu Gly Leu Leu Ala Gly Ser Asn
115 120 125Ala Thr Lys Leu Phe Thr Ala
Ile Thr Phe Asp Ile Ala Met Cys Val 130 135
140Thr Gly Leu Ala Ala Ala Leu Thr Thr Ser Ser His Leu Met Arg
Trp145 150 155 160Phe Trp
Tyr Ala Ile Ser Cys Ala Cys Phe Leu Val Val Leu Tyr Ile
165 170 175Leu Leu Val Glu Trp Ala Gln
Asp Ala Lys Ala Ala Gly Thr Ala Asp 180 185
190Met Phe Asn Thr Leu Lys Leu Leu Thr Val Val Met Trp Leu
Gly Tyr 195 200 205Pro Ile Val Trp
Ala Leu Gly Val Glu Gly Ile Ala Val Leu Pro Val 210
215 220Gly Val Thr Ser Trp Gly Tyr Ser Phe Leu Asp Ile
Val Ala Lys Tyr225 230 235
240Ile Phe Ala Phe Leu Leu Leu Asn Tyr Leu Thr Ser Asn Glu Ser Val
245 250 255Val Ser Gly Ser Ile
Leu Asp Val Pro Ser Ala Ser Gly Thr Pro Ala 260
265 270Asp Asp Ala Ala Ala Lys Ser Arg Ile Thr Ser Glu
Gly Glu Tyr Ile 275 280 285Pro Leu
Asp Gln Ile Asp Ile Asn Val Val Ser Lys Gly Glu Glu Leu 290
295 300Phe Thr Gly Val Val Pro Ile Leu Val Glu Leu
Asp Gly Asp Val Asn305 310 315
320Gly His Lys Phe Ser Val Ser Gly Glu Gly Glu Gly Asp Ala Thr Tyr
325 330 335Gly Lys Leu Thr
Leu Lys Phe Ile Cys Thr Thr Gly Lys Leu Pro Val 340
345 350Pro Trp Pro Thr Leu Val Thr Thr Phe Gly Tyr
Gly Leu Gln Cys Phe 355 360 365Ala
Arg Tyr Pro Asp His Met Lys Gln His Asp Phe Phe Lys Ser Ala 370
375 380Met Pro Glu Gly Tyr Val Gln Glu Arg Thr
Ile Phe Phe Lys Asp Asp385 390 395
400Gly Asn Tyr Lys Thr Arg Ala Glu Val Lys Phe Glu Gly Asp Thr
Leu 405 410 415Val Asn Arg
Ile Glu Leu Lys Gly Ile Asp Phe Lys Glu Asp Gly Asn 420
425 430Ile Leu Gly His Lys Leu Glu Tyr Asn Tyr
Asn Ser His Asn Val Tyr 435 440
445Ile Met Ala Asp Lys Gln Lys Asn Gly Ile Lys Val Asn Phe Lys Ile 450
455 460Arg His Asn Ile Glu Asp Gly Ser
Val Gln Leu Ala Asp His Tyr Gln465 470
475 480Gln Asn Thr Pro Ile Gly Asp Gly Pro Val Leu Leu
Pro Asp Asn His 485 490
495Tyr Leu Ser Tyr Gln Ser Ala Leu Ser Lys Asp Pro Asn Glu Lys Arg
500 505 510Asp His Met Val Leu Leu
Glu Phe Val Thr Ala Ala Gly Ile Thr Leu 515 520
525Gly Met Asp Glu Leu Tyr Lys Phe Cys Tyr Glu Asn Glu Val
530 535 54019512PRTRattus norvegicus
19Met Asp Leu Lys Glu Ser Pro Ser Glu Gly Ser Leu Gln Pro Ser Ser1
5 10 15Ile Gln Ile Phe Ala Asn
Thr Ser Thr Leu His Gly Ile Arg His Ile 20 25
30Phe Val Tyr Gly Pro Leu Thr Ile Arg Arg Val Leu Trp
Ala Val Ala 35 40 45Phe Val Gly
Ser Leu Gly Leu Leu Leu Val Glu Ser Ser Glu Arg Val 50
55 60Ser Tyr Tyr Phe Ser Tyr Gln His Val Thr Lys Val
Asp Glu Val Val65 70 75
80Ala Gln Ser Leu Val Phe Pro Ala Val Thr Leu Cys Asn Leu Asn Gly
85 90 95Phe Arg Phe Ser Arg Leu
Thr Thr Asn Asp Leu Tyr His Ala Gly Glu 100
105 110Leu Leu Ala Leu Leu Asp Val Asn Leu Gln Ile Pro
Asp Pro His Leu 115 120 125Ala Asp
Pro Thr Val Leu Glu Ala Leu Arg Gln Lys Ala Asn Phe Lys 130
135 140His Tyr Lys Pro Lys Gln Phe Ser Met Leu Glu
Phe Leu His Arg Val145 150 155
160Gly His Asp Leu Lys Asp Met Met Leu Tyr Cys Lys Phe Lys Gly Gln
165 170 175Glu Cys Gly His
Gln Asp Phe Thr Thr Val Phe Thr Lys Tyr Gly Lys 180
185 190Cys Tyr Met Phe Asn Ser Gly Glu Asp Gly Lys
Pro Leu Leu Thr Thr 195 200 205Val
Lys Gly Gly Thr Gly Asn Gly Leu Glu Ile Met Leu Asp Ile Gln 210
215 220Gln Asp Glu Tyr Leu Pro Ile Trp Gly Glu
Thr Glu Glu Thr Thr Phe225 230 235
240Glu Ala Gly Val Lys Val Gln Ile His Ser Gln Ser Glu Pro Pro
Phe 245 250 255Ile Gln Glu
Leu Gly Phe Gly Val Ala Pro Gly Phe Gln Thr Phe Val 260
265 270Ala Thr Gln Glu Gln Arg Leu Thr Tyr Leu
Pro Pro Pro Trp Gly Glu 275 280
285Cys Arg Ser Ser Glu Met Gly Leu Asp Phe Phe Pro Val Tyr Ser Ile 290
295 300Thr Ala Cys Arg Ile Asp Cys Glu
Thr Arg Tyr Ile Val Glu Asn Cys305 310
315 320Asn Cys Arg Met Val His Met Pro Gly Asp Ala Pro
Phe Cys Thr Pro 325 330
335Glu Gln His Lys Glu Cys Ala Glu Pro Ala Leu Gly Leu Leu Ala Glu
340 345 350Lys Asp Ser Asn Tyr Cys
Leu Cys Arg Thr Pro Cys Asn Leu Thr Arg 355 360
365Tyr Asn Lys Glu Leu Ser Met Val Lys Ile Pro Ser Lys Thr
Ser Ala 370 375 380Lys Tyr Leu Glu Lys
Lys Phe Asn Lys Ser Glu Lys Tyr Ile Ser Glu385 390
395 400Asn Ile Leu Val Leu Asp Ile Phe Phe Glu
Ala Leu Asn Tyr Glu Thr 405 410
415Ile Glu Gln Lys Lys Ala Tyr Glu Val Ala Ala Leu Leu Gly Asp Ile
420 425 430Gly Gly Gln Met Gly
Leu Phe Ile Gly Ala Ser Leu Leu Thr Ile Leu 435
440 445Glu Leu Phe Asp Tyr Ile Tyr Glu Leu Ile Lys Glu
Lys Leu Leu Asp 450 455 460Leu Leu Gly
Lys Glu Glu Glu Glu Gly Ser His Asp Glu Asn Met Ser465
470 475 480Thr Cys Asp Thr Met Pro Asn
His Ser Glu Thr Ile Ser His Thr Val 485
490 495Asn Val Pro Leu Gln Thr Ala Leu Gly Thr Leu Glu
Glu Ile Ala Cys 500 505
51020378PRTHelicobacter pylori 20Met Phe Glu Lys Leu Lys Phe Phe Lys Ile
Lys Lys Asp Asp Glu Asp1 5 10
15Gln Pro Glu Val Asn Leu Asn Ser Glu Ile Tyr Glu Gln Phe Lys Val
20 25 30Phe Arg Leu Pro Leu Ile
Leu Ile Gln Leu Leu Val Leu Leu Gly Thr 35 40
45Leu Gly Tyr Phe Ala Leu Glu Asn Tyr Ser Leu Met Gln Ala
Phe Phe 50 55 60Gln Thr Thr Tyr Thr
Met Thr Ala Thr Gly Phe Gly Ala Leu Asn Glu65 70
75 80Ser Gln Phe Gly Pro Ile Ser Ile Phe Leu
Thr Ser Ile Leu Met Phe 85 90
95Cys Gly Thr Gly Ile Ile Ala Phe Ser Val Ala Ile Leu Val Ser Val
100 105 110Val Asn Lys Gly Thr
Leu Thr Arg Leu Ile Lys Glu Lys Gly Met Ile 115
120 125Tyr Lys Ile Ala Arg Leu Lys Asp His Tyr Val Ile
Cys Tyr His Asn 130 135 140Glu Tyr Thr
Ile Glu Leu Ser Lys Gln Phe Arg Ser Ala Gln Ile Pro145
150 155 160Phe Val Val Val Asp Asn Asp
Pro Ser Phe Glu Glu Glu Ala Ile Lys 165
170 175His Lys Tyr Pro Tyr Tyr Ile Ile Gly Asp Pro His
Thr Asn Leu Ala 180 185 190Met
Leu Lys Thr His Leu Ser Ser Ala Arg Gly Val Val Ala Leu Ser 195
200 205Lys Ile Leu Pro Val Asn Val Ala Leu
Met Val Ser Val Arg Leu Phe 210 215
220Glu Lys Glu Leu Lys Arg Lys Pro Tyr Tyr Ile Ile Ala Ser Ala His225
230 235 240Ser Asp Glu Gly
Leu Glu Lys Leu Lys Lys Leu Gly Ala Asp Met Val 245
250 255Val Ser Pro Thr Lys Leu Met Ala Gln Arg
Val Ser Ala Met Ala Val 260 265
270Arg Pro Asp Met Glu Asn Ile Leu Glu Arg Phe Ile Asn Lys Lys Asp
275 280 285Thr Leu Leu Asp Leu Glu Glu
Val Ile Val Pro Lys Thr Ser Trp Leu 290 295
300Val Leu Arg Lys Leu Lys Glu Ala His Phe Arg Glu Ile Ala Lys
Ala305 310 315 320Phe Val
Ile Gly Ile Thr Gln Lys Asp Gly Lys Tyr Ile Pro Met Pro
325 330 335Asp Gly Glu Thr Ile Ile Ala
Ser Glu Ser Lys Leu Leu Met Val Gly 340 345
350Thr Ser Glu Gly Val Ala Thr Cys Lys Gln Leu Ile Thr Ser
His Gln 355 360 365Lys Pro Lys Glu
Val Asp Tyr Ile Ser Leu 370 37521661PRTHomo sapiens
21Met Asp Leu Gln Gln Ser Thr Thr Ile Thr Ser Leu Glu Lys Trp Cys1
5 10 15Leu Asp Glu Ser Leu Ser
Gly Cys Arg Arg His Tyr Ser Val Lys Lys 20 25
30Lys Leu Lys Leu Ile Arg Val Leu Gly Leu Phe Met Gly
Leu Val Ala 35 40 45Ile Ser Thr
Val Ser Phe Ser Ile Ser Ala Phe Ser Glu Thr Asp Thr 50
55 60Gln Ser Thr Gly Glu Ala Ser Val Val Ser Gly Pro
Arg Val Ala Gln65 70 75
80Gly Tyr His Gln Arg Thr Leu Leu Asp Leu Asn Asp Lys Ile Leu Asp
85 90 95Tyr Thr Pro Gln Pro Pro
Leu Ser Lys Glu Gly Glu Ser Glu Asn Ser 100
105 110Thr Asp His Ala Gln Gly Asp Tyr Pro Lys Asp Ile
Phe Ser Leu Glu 115 120 125Glu Arg
Arg Lys Gly Ala Ile Ile Leu His Val Ile Gly Met Ile Tyr 130
135 140Met Phe Ile Ala Leu Ala Ile Val Cys Asp Glu
Phe Phe Val Pro Ser145 150 155
160Leu Thr Val Ile Thr Glu Lys Leu Gly Ile Ser Asp Asp Val Ala Gly
165 170 175Ala Thr Phe Met
Ala Ala Gly Gly Ser Ala Pro Glu Leu Phe Thr Ser 180
185 190Leu Ile Gly Val Phe Ile Ala His Ser Asn Val
Gly Ile Gly Thr Ile 195 200 205Val
Gly Ser Ala Val Phe Asn Ile Leu Phe Val Ile Gly Met Cys Ala 210
215 220Leu Phe Ser Arg Glu Ile Leu Asn Leu Thr
Trp Trp Pro Leu Phe Arg225 230 235
240Asp Val Ser Phe Tyr Ile Val Asp Leu Ile Met Leu Ile Ile Phe
Phe 245 250 255Leu Asp Asn
Val Ile Met Trp Trp Glu Ser Leu Leu Leu Leu Thr Ala 260
265 270Tyr Phe Cys Tyr Val Val Phe Met Lys Phe
Asn Val Gln Val Glu Lys 275 280
285Trp Val Lys Gln Met Ile Asn Arg Asn Lys Val Val Lys Val Thr Ala 290
295 300Pro Glu Ala Gln Ala Lys Pro Ser
Ala Ala Arg Asp Lys Asp Glu Pro305 310
315 320Thr Leu Pro Ala Lys Pro Arg Leu Gln Arg Gly Gly
Ser Ser Ala Ser 325 330
335Leu His Asn Ser Leu Met Arg Asn Ser Ile Phe Gln Leu Met Ile His
340 345 350Thr Leu Asp Pro Leu Ala
Glu Glu Leu Gly Ser Tyr Gly Lys Leu Lys 355 360
365Tyr Tyr Asp Thr Met Thr Glu Glu Gly Arg Phe Arg Glu Lys
Ala Ser 370 375 380Ile Leu His Lys Ile
Ala Lys Lys Lys Cys His Val Asp Glu Asn Glu385 390
395 400Arg Gln Asn Gly Ala Ala Asn His Val Glu
Lys Ile Glu Leu Pro Asn 405 410
415Ser Thr Ser Thr Asp Val Glu Met Thr Pro Ser Ser Asp Ala Ser Glu
420 425 430Pro Val Gln Asn Gly
Asn Leu Ser His Asn Ile Glu Gly Ala Glu Ala 435
440 445Gln Thr Ala Asp Glu Glu Glu Asp Gln Pro Leu Ser
Leu Ala Trp Pro 450 455 460Ser Glu Thr
Arg Lys Gln Val Thr Phe Leu Ile Val Phe Pro Ile Val465
470 475 480Phe Pro Leu Trp Ile Thr Leu
Pro Asp Val Arg Lys Pro Ser Ser Arg 485
490 495Lys Phe Phe Pro Ile Thr Phe Phe Gly Ser Ile Thr
Trp Ile Ala Val 500 505 510Phe
Ser Tyr Leu Met Val Trp Trp Ala His Gln Val Gly Glu Thr Ile 515
520 525Gly Ile Ser Glu Glu Ile Met Gly Leu
Thr Ile Leu Ala Ala Gly Thr 530 535
540Ser Ile Pro Asp Leu Ile Thr Ser Val Ile Val Ala Arg Lys Gly Leu545
550 555 560Gly Asp Met Ala
Val Ser Ser Ser Val Gly Ser Asn Ile Phe Asp Ile 565
570 575Thr Val Gly Leu Pro Leu Pro Trp Leu Leu
Tyr Thr Val Ile His Arg 580 585
590Phe Gln Pro Val Ala Val Ser Ser Asn Gly Leu Phe Cys Ala Ile Val
595 600 605Leu Leu Phe Ile Met Leu Leu
Phe Val Ile Leu Ser Ile Ala Leu Cys 610 615
620Lys Trp Arg Met Asn Lys Ile Leu Gly Phe Ile Met Phe Gly Leu
Tyr625 630 635 640Phe Val
Phe Leu Val Val Ser Val Leu Leu Glu Asp Arg Ile Leu Thr
645 650 655Cys Pro Val Ser Ile
66022925PRTHomo sapiens 22Met Ala Trp Leu Arg Leu Gln Pro Leu Thr Ser Ala
Phe Leu His Phe1 5 10
15Gly Leu Val Thr Phe Val Leu Phe Leu Asn Gly Leu Arg Ala Glu Ala
20 25 30Gly Gly Ser Gly Asp Val Pro
Ser Thr Gly Gln Asn Asn Glu Ser Cys 35 40
45Ser Gly Ser Ser Asp Cys Lys Glu Gly Val Ile Leu Pro Ile Trp
Tyr 50 55 60Pro Glu Asn Pro Ser Leu
Gly Asp Lys Ile Ala Arg Val Ile Val Tyr65 70
75 80Phe Val Ala Leu Ile Tyr Met Phe Leu Gly Val
Ser Ile Ile Ala Asp 85 90
95Arg Phe Met Ala Ser Ile Glu Val Ile Thr Ser Gln Glu Arg Glu Val
100 105 110Thr Ile Lys Lys Pro Asn
Gly Glu Thr Ser Thr Thr Thr Ile Arg Val 115 120
125Trp Asn Glu Thr Val Ser Asn Leu Thr Leu Met Ala Leu Gly
Ser Ser 130 135 140Ala Pro Glu Ile Leu
Leu Ser Leu Ile Glu Val Cys Gly His Gly Phe145 150
155 160Ile Ala Gly Asp Leu Gly Pro Ser Thr Ile
Val Gly Ser Ala Ala Phe 165 170
175Asn Met Phe Ile Ile Ile Gly Ile Cys Val Tyr Val Ile Pro Asp Gly
180 185 190Glu Thr Arg Lys Ile
Lys His Leu Arg Val Phe Phe Ile Thr Ala Ala 195
200 205Trp Ser Ile Phe Ala Tyr Ile Trp Leu Tyr Met Ile
Leu Ala Val Phe 210 215 220Ser Pro Gly
Val Val Gln Val Trp Glu Gly Leu Leu Thr Leu Phe Phe225
230 235 240Phe Pro Val Cys Val Leu Leu
Ala Trp Val Ala Asp Lys Arg Leu Leu 245
250 255Phe Tyr Lys Tyr Met His Lys Lys Tyr Arg Thr Asp
Lys His Arg Gly 260 265 270Ile
Ile Ile Glu Thr Glu Gly Asp His Pro Lys Gly Ile Glu Met Asp 275
280 285Gly Lys Met Met Asn Ser His Phe Leu
Asp Gly Asn Leu Val Pro Leu 290 295
300Glu Gly Lys Glu Val Asp Glu Ser Arg Arg Glu Met Ile Arg Ile Leu305
310 315 320Lys Asp Leu Lys
Gln Lys His Pro Glu Lys Asp Leu Asp Gln Leu Val 325
330 335Glu Met Ala Asn Tyr Tyr Ala Leu Ser His
Gln Gln Lys Ser Arg Ala 340 345
350Phe Tyr Arg Ile Gln Ala Thr Arg Met Met Thr Gly Ala Gly Asn Ile
355 360 365Leu Lys Lys His Ala Ala Glu
Gln Ala Lys Lys Ala Ser Ser Met Ser 370 375
380Glu Val His Thr Asp Glu Pro Glu Asp Phe Ile Ser Lys Val Phe
Phe385 390 395 400Asp Pro
Cys Ser Tyr Gln Cys Leu Glu Asn Cys Gly Ala Val Leu Leu
405 410 415Thr Val Val Arg Lys Gly Gly
Asp Met Ser Lys Thr Met Tyr Val Asp 420 425
430Tyr Lys Thr Glu Asp Gly Ser Ala Asn Ala Gly Ala Asp Tyr
Glu Phe 435 440 445Thr Glu Gly Thr
Val Val Leu Lys Pro Gly Glu Thr Gln Lys Glu Phe 450
455 460Ser Val Gly Ile Ile Asp Asp Asp Ile Phe Glu Glu
Asp Glu His Phe465 470 475
480Phe Val Arg Leu Ser Asn Val Arg Ile Glu Glu Glu Gln Pro Glu Glu
485 490 495Gly Met Pro Pro Ala
Ile Phe Asn Ser Leu Pro Leu Pro Arg Ala Val 500
505 510Leu Ala Ser Pro Cys Val Ala Thr Val Thr Ile Leu
Asp Asp Asp His 515 520 525Ala Gly
Ile Phe Thr Phe Glu Cys Asp Thr Ile His Val Ser Glu Ser 530
535 540Ile Gly Val Met Glu Val Lys Val Leu Arg Thr
Ser Gly Ala Arg Gly545 550 555
560Thr Val Ile Val Pro Phe Arg Thr Val Glu Gly Thr Ala Lys Gly Gly
565 570 575Gly Glu Asp Phe
Glu Asp Thr Tyr Gly Glu Leu Glu Phe Lys Asn Asp 580
585 590Glu Thr Val Lys Thr Ile His Ile Lys Val Ile
Asp Asp Glu Ala Tyr 595 600 605Glu
Lys Asn Lys Asn Tyr Phe Ile Glu Met Met Gly Pro Arg Met Val 610
615 620Asp Met Ser Phe Gln Lys Ala Leu Leu Leu
Ser Pro Asp Arg Lys Leu625 630 635
640Thr Met Glu Glu Glu Glu Ala Lys Arg Ile Ala Glu Met Gly Lys
Pro 645 650 655Val Leu Gly
Glu His Pro Lys Leu Glu Val Ile Ile Glu Glu Ser Tyr 660
665 670Glu Phe Lys Thr Thr Val Asp Lys Leu Ile
Lys Lys Thr Asn Leu Ala 675 680
685Leu Val Val Gly Thr His Ser Trp Arg Asp Gln Phe Met Glu Ala Ile 690
695 700Thr Val Ser Ala Ala Gly Asp Glu
Asp Glu Asp Glu Ser Gly Glu Glu705 710
715 720Arg Leu Pro Ser Cys Phe Asp Tyr Val Met His Phe
Leu Thr Val Phe 725 730
735Trp Lys Val Leu Phe Ala Cys Val Pro Pro Thr Glu Tyr Cys His Gly
740 745 750Trp Ala Cys Phe Ala Val
Ser Ile Leu Ile Ile Gly Met Leu Thr Ala 755 760
765Ile Ile Gly Asp Leu Ala Ser His Phe Gly Cys Thr Ile Gly
Leu Lys 770 775 780Asp Ser Val Thr Ala
Val Val Phe Val Ala Phe Gly Thr Ser Val Pro785 790
795 800Asp Thr Phe Ala Ser Lys Ala Ala Ala Leu
Gln Asp Val Tyr Ala Asp 805 810
815Ala Ser Ile Gly Asn Val Thr Gly Ser Asn Ala Val Asn Val Phe Leu
820 825 830Gly Ile Gly Leu Ala
Trp Ser Val Ala Ala Ile Tyr Trp Ala Leu Gln 835
840 845Gly Gln Glu Phe His Val Ser Ala Gly Thr Leu Ala
Phe Ser Val Thr 850 855 860Leu Phe Thr
Ile Phe Ala Phe Val Cys Ile Ser Val Leu Leu Tyr Arg865
870 875 880Arg Arg Pro His Leu Gly Gly
Glu Leu Gly Gly Pro Arg Gly Cys Lys 885
890 895Leu Ala Thr Thr Trp Leu Phe Val Ser Leu Trp Leu
Leu Tyr Ile Leu 900 905 910Phe
Ala Thr Leu Glu Ala Tyr Cys Tyr Ile Lys Gly Phe 915
920 92523409PRTMoraxella catarrhalis 23Met Phe Ala Gln
Phe Lys Arg Phe Leu Glu Leu Glu Ala Ala Gly Gly1 5
10 15Ile Val Leu Ala Ala Ala Ala Leu Leu Ala
Met Ile Ile Ala Asn Ser 20 25
30Pro Leu Asp Glu Met Tyr His Ala Phe Ile His Ala Pro Val Val Val
35 40 45Gln Ile Gly Thr Phe Gln Ile Ala
Lys Asp Ala His His Trp Ile Asn 50 55
60Asp Gly Leu Met Ala Ile Phe Phe Phe Leu Val Gly Leu Glu Leu Lys65
70 75 80Arg Glu Ala Leu Ile
Gly Glu Leu Ser Asp Val Lys Gln Ile Leu Met 85
90 95Pro Ala Leu Ala Ala Val Gly Gly Met Ile Met
Pro Ala Leu Ile Tyr 100 105
110Ala Ala Phe Asn Gln Ser Asn Pro Glu Gln Leu Ala Gly Trp Ala Ile
115 120 125Pro Ala Ala Thr Asp Ile Ala
Phe Ala Leu Gly Val Leu Ser Leu Leu 130 135
140Gly Asn Arg Val Pro Asn Ala Leu Lys Val Phe Leu Val Ser Ile
Ala145 150 155 160Ile Phe
Asp Asp Leu Gly Ala Ile Val Ile Ile Ala Leu Phe Tyr Thr
165 170 175Ser Asp Leu Ser Leu Ser Ser
Leu Ala Val Ala Gly Val Cys Phe Pro 180 185
190Phe Leu Phe Ile Leu Asn Lys Met Asn Val Val Arg Leu Thr
Pro Tyr 195 200 205Leu Leu Ile Gly
Leu Val Met Trp Ala Ala Phe Leu Lys Ser Gly Val 210
215 220His Ala Thr Leu Ala Gly Val Leu Leu Ala Phe Phe
Ile Pro Leu Arg225 230 235
240Asn Lys Ser Asp Pro Glu His Ser Pro Leu Glu Glu Leu Glu His Asp
245 250 255Leu His Asn Thr Val
Ala Phe Gly Val Leu Pro Leu Phe Ala Phe Ala 260
265 270Asn Ala Gly Ile Gly Leu Ala Gly Thr Gly Ile Asp
Ser Leu Leu His 275 280 285Ser Val
Pro Leu Gly Ile Ala Ala Gly Leu Phe Ile Gly Lys Gln Ile 290
295 300Gly Val Met Thr Ala Val Phe Leu Cys Leu Lys
Leu Gly Leu Ala Ser305 310 315
320Leu Pro Lys Gly Thr Thr Ile Lys Gln Leu Tyr Gly Val Ser Leu Leu
325 330 335Cys Gly Ile Gly
Phe Thr Met Ser Leu Phe Ile Ser Gly Leu Ala Phe 340
345 350Gly Asn Thr Pro Lys Asp Phe Asp Pro Arg Leu
Gly Ile Ile Leu Gly 355 360 365Ser
Ile Ile Ser Gly Val Ile Gly Tyr Met Ile Leu Arg Gly Asn Ile 370
375 380Pro Asn Ala Asp His Pro Val Leu Ala Lys
Asp Thr Gly Glu Gly Phe385 390 395
400Ile Pro Thr Gln His Asp Ala Gln Ala
40524676PRTHomo sapiens 24Met Ala Ala Ala Ser Ser Pro Pro Arg Ala Glu Arg
Lys Arg Trp Gly1 5 10
15Trp Gly Arg Leu Pro Gly Ala Arg Arg Gly Ser Ala Gly Leu Ala Lys
20 25 30Lys Cys Pro Phe Ser Leu Glu
Leu Ala Glu Gly Gly Pro Ala Gly Gly 35 40
45Ala Leu Tyr Ala Pro Ile Ala Pro Gly Ala Pro Gly Pro Ala Pro
Pro 50 55 60Ala Ser Pro Ala Ala Pro
Ala Ala Pro Pro Val Ala Ser Asp Leu Gly65 70
75 80Pro Arg Pro Pro Val Ser Leu Asp Pro Arg Val
Ser Ile Tyr Ser Thr 85 90
95Arg Arg Pro Val Leu Ala Arg Thr His Val Gln Gly Arg Val Tyr Asn
100 105 110Phe Leu Glu Arg Pro Thr
Gly Trp Lys Cys Phe Val Tyr His Phe Ala 115 120
125Val Phe Leu Ile Val Leu Val Cys Leu Ile Phe Ser Val Leu
Ser Thr 130 135 140Ile Glu Gln Tyr Ala
Ala Leu Ala Thr Gly Thr Leu Phe Trp Met Glu145 150
155 160Ile Val Leu Val Val Phe Phe Gly Thr Glu
Tyr Val Val Arg Leu Trp 165 170
175Ser Ala Gly Cys Arg Ser Lys Tyr Val Gly Leu Trp Gly Arg Leu Arg
180 185 190Phe Ala Arg Lys Pro
Ile Ser Ile Ile Asp Leu Ile Val Val Val Ala 195
200 205Ser Met Val Val Leu Cys Val Gly Ser Lys Gly Gln
Val Phe Ala Thr 210 215 220Ser Ala Ile
Arg Gly Ile Arg Phe Leu Gln Ile Leu Arg Met Leu His225
230 235 240Val Asp Arg Gln Gly Gly Thr
Trp Arg Leu Leu Gly Ser Val Val Phe 245
250 255Ile His Arg Gln Glu Leu Ile Thr Thr Leu Tyr Ile
Gly Phe Leu Gly 260 265 270Leu
Ile Phe Ser Ser Tyr Phe Val Tyr Leu Ala Glu Lys Asp Ala Val 275
280 285Asn Glu Ser Gly Arg Val Glu Phe Gly
Ser Tyr Ala Asp Ala Leu Trp 290 295
300Trp Gly Val Val Thr Val Thr Thr Ile Gly Tyr Gly Asp Lys Val Pro305
310 315 320Gln Thr Trp Val
Gly Lys Thr Ile Ala Ser Cys Phe Ser Val Phe Ala 325
330 335Ile Ser Phe Phe Ala Leu Pro Ala Gly Ile
Leu Gly Ser Gly Phe Ala 340 345
350Leu Lys Val Gln Gln Lys Gln Arg Gln Lys His Phe Asn Arg Gln Ile
355 360 365Pro Ala Ala Ala Ser Leu Ile
Gln Thr Ala Trp Arg Cys Tyr Ala Ala 370 375
380Glu Asn Pro Asp Ser Ser Thr Trp Lys Ile Tyr Ile Arg Lys Ala
Pro385 390 395 400Arg Ser
His Thr Leu Leu Ser Pro Ser Pro Lys Pro Lys Lys Ser Val
405 410 415Val Val Lys Lys Lys Lys Phe
Lys Leu Asp Lys Asp Asn Gly Val Thr 420 425
430Pro Gly Glu Lys Met Leu Thr Val Pro His Ile Thr Cys Asp
Pro Pro 435 440 445Glu Glu Arg Arg
Leu Asp His Phe Ser Val Asp Gly Tyr Asp Ser Ser 450
455 460Val Arg Lys Ser Pro Thr Leu Leu Glu Val Ser Met
Pro His Phe Met465 470 475
480Arg Thr Asn Ser Phe Ala Glu Asp Leu Asp Leu Glu Gly Glu Thr Leu
485 490 495Leu Thr Pro Ile Thr
His Ile Ser Gln Leu Arg Glu His His Arg Ala 500
505 510Thr Ile Lys Val Ile Arg Arg Met Gln Tyr Phe Val
Ala Lys Lys Lys 515 520 525Phe Gln
Gln Ala Arg Lys Pro Tyr Asp Val Arg Asp Val Ile Glu Gln 530
535 540Tyr Ser Gln Gly His Leu Asn Leu Met Val Arg
Ile Lys Glu Leu Gln545 550 555
560Arg Arg Leu Asp Gln Ser Ile Gly Lys Pro Ser Leu Phe Ile Ser Val
565 570 575Ser Glu Lys Ser
Lys Asp Arg Gly Ser Asn Thr Ile Gly Ala Arg Leu 580
585 590Asn Arg Val Glu Asp Lys Val Thr Gln Leu Asp
Gln Arg Leu Ala Leu 595 600 605Ile
Thr Asp Met Leu His Gln Leu Leu Ser Leu His Gly Gly Ser Thr 610
615 620Pro Gly Ser Gly Gly Pro Pro Arg Glu Gly
Gly Ala His Ile Thr Gln625 630 635
640Pro Cys Gly Ser Gly Gly Ser Val Asp Pro Glu Leu Phe Leu Pro
Ser 645 650 655Asn Thr Leu
Pro Thr Tyr Glu Gln Leu Thr Val Pro Arg Arg Gly Pro 660
665 670Asp Glu Gly Ser 675251159PRTHomo
sapiens 25Met Pro Val Arg Arg Gly His Val Ala Pro Gln Asn Thr Phe Leu
Asp1 5 10 15Thr Ile Ile
Arg Lys Phe Glu Gly Gln Ser Arg Lys Phe Ile Ile Ala 20
25 30Asn Ala Arg Val Glu Asn Cys Ala Val Ile
Tyr Cys Asn Asp Gly Phe 35 40
45Cys Glu Leu Cys Gly Tyr Ser Arg Ala Glu Val Met Gln Arg Pro Cys 50
55 60Thr Cys Asp Phe Leu His Gly Pro Arg
Thr Gln Arg Arg Ala Ala Ala65 70 75
80Gln Ile Ala Gln Ala Leu Leu Gly Ala Glu Glu Arg Lys Val
Glu Ile 85 90 95Ala Phe
Tyr Arg Lys Asp Gly Ser Cys Phe Leu Cys Leu Val Asp Val 100
105 110Val Pro Val Lys Asn Glu Asp Gly Ala
Val Ile Met Phe Ile Leu Asn 115 120
125Phe Glu Val Val Met Glu Lys Asp Met Val Gly Ser Pro Ala His Asp
130 135 140Thr Asn His Arg Gly Pro Pro
Thr Ser Trp Leu Ala Pro Gly Arg Ala145 150
155 160Lys Thr Phe Arg Leu Lys Leu Pro Ala Leu Leu Ala
Leu Thr Ala Arg 165 170
175Glu Ser Ser Val Arg Ser Gly Gly Ala Gly Gly Ala Gly Ala Pro Gly
180 185 190Ala Val Val Val Asp Val
Asp Leu Thr Pro Ala Ala Pro Ser Ser Glu 195 200
205Ser Leu Ala Leu Asp Glu Val Thr Ala Met Asp Asn His Val
Ala Gly 210 215 220Leu Gly Pro Ala Glu
Glu Arg Arg Ala Leu Val Gly Pro Gly Ser Pro225 230
235 240Pro Arg Ser Ala Pro Gly Gln Leu Pro Ser
Pro Arg Ala His Ser Leu 245 250
255Asn Pro Asp Ala Ser Gly Ser Ser Cys Ser Leu Ala Arg Thr Arg Ser
260 265 270Arg Glu Ser Cys Ala
Ser Val Arg Arg Ala Ser Ser Ala Asp Asp Ile 275
280 285Glu Ala Met Arg Ala Gly Val Leu Pro Pro Pro Pro
Arg His Ala Ser 290 295 300Thr Gly Ala
Met His Pro Leu Arg Ser Gly Leu Leu Asn Ser Thr Ser305
310 315 320Asp Ser Asp Leu Val Arg Tyr
Arg Thr Ile Ser Lys Ile Pro Gln Ile 325
330 335Thr Leu Asn Phe Val Asp Leu Lys Gly Asp Pro Phe
Leu Ala Ser Pro 340 345 350Thr
Ser Asp Arg Glu Ile Ile Ala Pro Lys Ile Lys Glu Arg Thr His 355
360 365Asn Val Thr Glu Lys Val Thr Gln Val
Leu Ser Leu Gly Ala Asp Val 370 375
380Leu Pro Glu Tyr Lys Leu Gln Ala Pro Arg Ile His Arg Trp Thr Ile385
390 395 400Leu His Tyr Ser
Pro Phe Lys Ala Val Trp Asp Trp Leu Ile Leu Leu 405
410 415Leu Val Ile Tyr Thr Ala Val Phe Thr Pro
Tyr Ser Ala Ala Phe Leu 420 425
430Leu Lys Glu Thr Glu Glu Gly Pro Pro Ala Thr Glu Cys Gly Tyr Ala
435 440 445Cys Gln Pro Leu Ala Val Val
Asp Leu Ile Val Asp Ile Met Phe Ile 450 455
460Val Asp Ile Leu Ile Asn Phe Arg Thr Thr Tyr Val Asn Ala Asn
Glu465 470 475 480Glu Val
Val Ser His Pro Gly Arg Ile Ala Val His Tyr Phe Lys Gly
485 490 495Trp Phe Leu Ile Asp Met Val
Ala Ala Ile Pro Phe Asp Leu Leu Ile 500 505
510Phe Gly Ser Gly Ser Glu Glu Leu Ile Gly Leu Leu Lys Thr
Ala Arg 515 520 525Leu Leu Arg Leu
Val Arg Val Ala Arg Lys Leu Asp Arg Tyr Ser Glu 530
535 540Tyr Gly Ala Ala Val Leu Phe Leu Leu Met Cys Thr
Phe Ala Leu Ile545 550 555
560Ala His Trp Leu Ala Cys Ile Trp Tyr Ala Ile Gly Asn Met Glu Gln
565 570 575Pro His Met Asp Ser
Arg Ile Gly Trp Leu His Asn Leu Gly Asp Gln 580
585 590Ile Gly Lys Pro Tyr Asn Ser Ser Gly Leu Gly Gly
Pro Ser Ile Lys 595 600 605Asp Lys
Tyr Val Thr Ala Leu Tyr Phe Thr Phe Ser Ser Leu Thr Ser 610
615 620Val Gly Phe Gly Asn Val Ser Pro Asn Thr Asn
Ser Glu Lys Ile Phe625 630 635
640Ser Ile Cys Val Met Leu Ile Gly Ser Leu Met Tyr Ala Ser Ile Phe
645 650 655Gly Asn Val Ser
Ala Ile Ile Gln Arg Leu Tyr Ser Gly Thr Ala Arg 660
665 670Tyr His Thr Gln Met Leu Arg Val Arg Glu Phe
Ile Arg Phe His Gln 675 680 685Ile
Pro Asn Pro Leu Arg Gln Arg Leu Glu Glu Tyr Phe Gln His Ala 690
695 700Trp Ser Tyr Thr Asn Gly Ile Asp Met Asn
Ala Val Leu Lys Gly Phe705 710 715
720Pro Glu Cys Leu Gln Ala Asp Ile Cys Leu His Leu Asn Arg Ser
Leu 725 730 735Leu Gln His
Cys Lys Pro Phe Arg Gly Ala Thr Lys Gly Cys Leu Arg 740
745 750Ala Leu Ala Met Lys Phe Lys Thr Thr His
Ala Pro Pro Gly Asp Thr 755 760
765Leu Val His Ala Gly Asp Leu Leu Thr Ala Leu Tyr Phe Ile Ser Arg 770
775 780Gly Ser Ile Glu Ile Leu Arg Gly
Asp Val Val Val Ala Ile Leu Gly785 790
795 800Lys Asn Asp Ile Phe Gly Glu Pro Leu Asn Leu Tyr
Ala Arg Pro Gly 805 810
815Lys Ser Asn Gly Asp Val Arg Ala Leu Thr Tyr Cys Asp Leu His Lys
820 825 830Ile His Arg Asp Asp Leu
Leu Glu Val Leu Asp Met Tyr Pro Glu Phe 835 840
845Ser Asp His Phe Trp Ser Ser Leu Glu Ile Thr Phe Asn Leu
Arg Asp 850 855 860Thr Asn Met Ile Pro
Gly Ser Pro Gly Ser Thr Glu Leu Glu Gly Gly865 870
875 880Phe Ser Arg Gln Arg Lys Arg Lys Leu Ser
Phe Arg Arg Arg Thr Asp 885 890
895Lys Asp Thr Glu Gln Pro Gly Glu Val Ser Ala Leu Gly Pro Gly Arg
900 905 910Ala Gly Ala Gly Pro
Ser Ser Arg Gly Arg Pro Gly Gly Pro Trp Gly 915
920 925Glu Ser Pro Ser Ser Gly Pro Ser Ser Pro Glu Ser
Ser Glu Asp Glu 930 935 940Gly Pro Gly
Arg Ser Ser Ser Pro Leu Arg Leu Val Pro Phe Ser Ser945
950 955 960Pro Arg Pro Pro Gly Glu Pro
Pro Gly Gly Glu Pro Leu Met Glu Asp 965
970 975Cys Glu Lys Ser Ser Asp Thr Cys Asn Pro Leu Ser
Gly Ala Phe Ser 980 985 990Gly
Val Ser Asn Ile Phe Ser Phe Trp Gly Asp Ser Arg Gly Arg Gln 995
1000 1005Tyr Gln Glu Leu Pro Arg Cys Pro
Ala Pro Thr Pro Ser Leu Leu 1010 1015
1020Asn Ile Pro Leu Ser Ser Pro Gly Arg Arg Pro Arg Gly Asp Val
1025 1030 1035Glu Ser Arg Leu Asp Ala
Leu Gln Arg Gln Leu Asn Arg Leu Glu 1040 1045
1050Thr Arg Leu Ser Ala Asp Met Ala Thr Val Leu Gln Leu Leu
Gln 1055 1060 1065Arg Gln Met Thr Leu
Val Pro Pro Ala Tyr Ser Ala Val Thr Thr 1070 1075
1080Pro Gly Pro Gly Pro Thr Ser Thr Ser Pro Leu Leu Pro
Val Ser 1085 1090 1095Pro Leu Pro Thr
Leu Thr Leu Asp Ser Leu Ser Gln Val Ser Gln 1100
1105 1110Phe Met Ala Cys Glu Glu Leu Pro Pro Gly Ala
Pro Glu Leu Pro 1115 1120 1125Gln Glu
Gly Pro Thr Arg Arg Leu Ser Leu Pro Gly Gln Leu Gly 1130
1135 1140Ala Leu Thr Ser Gln Pro Leu His Arg His
Gly Ser Asp Pro Gly 1145 1150
1155Ser26427PRTHomo sapiens 26Met Gly Ser Val Arg Thr Asn Arg Tyr Ser Ile
Val Ser Ser Glu Glu1 5 10
15Asp Gly Met Lys Leu Ala Thr Met Ala Val Ala Asn Gly Phe Gly Asn
20 25 30Gly Lys Ser Lys Val His Thr
Arg Gln Gln Cys Arg Ser Arg Phe Val 35 40
45Lys Lys Asp Gly His Cys Asn Val Gln Phe Ile Asn Val Gly Glu
Lys 50 55 60Gly Gln Arg Tyr Leu Ala
Asp Ile Phe Thr Thr Cys Val Asp Ile Arg65 70
75 80Trp Arg Trp Met Leu Val Ile Phe Cys Leu Ala
Phe Val Leu Ser Trp 85 90
95Leu Phe Phe Gly Cys Val Phe Trp Leu Ile Ala Leu Leu His Gly Asp
100 105 110Leu Asp Ala Ser Lys Glu
Gly Lys Ala Cys Val Ser Glu Val Asn Ser 115 120
125Phe Thr Ala Ala Phe Leu Phe Ser Ile Glu Thr Gln Thr Thr
Ile Gly 130 135 140Tyr Gly Phe Arg Cys
Val Thr Asp Glu Cys Pro Ile Ala Val Phe Met145 150
155 160Val Val Phe Gln Ser Ile Val Gly Cys Ile
Ile Asp Ala Phe Ile Ile 165 170
175Gly Ala Val Met Ala Lys Met Ala Lys Pro Lys Lys Arg Asn Glu Thr
180 185 190Leu Val Phe Ser His
Asn Ala Val Ile Ala Met Arg Asp Gly Lys Leu 195
200 205Cys Leu Met Trp Arg Val Gly Asn Leu Arg Lys Ser
His Leu Val Glu 210 215 220Ala His Val
Arg Ala Gln Leu Leu Lys Ser Arg Ile Thr Ser Glu Gly225
230 235 240Glu Tyr Ile Pro Leu Asp Gln
Ile Asp Ile Asn Val Gly Phe Asp Ser 245
250 255Gly Ile Asp Arg Ile Phe Leu Val Ser Pro Ile Thr
Ile Val His Glu 260 265 270Ile
Asp Glu Asp Ser Pro Leu Tyr Asp Leu Ser Lys Gln Asp Ile Asp 275
280 285Asn Ala Asp Phe Glu Ile Val Val Ile
Leu Glu Gly Met Val Glu Ala 290 295
300Thr Ala Met Thr Thr Gln Cys Arg Ser Ser Tyr Leu Ala Asn Glu Ile305
310 315 320Leu Trp Gly His
Arg Tyr Glu Pro Val Leu Phe Glu Glu Lys His Tyr 325
330 335Tyr Lys Val Asp Tyr Ser Arg Phe His Lys
Thr Tyr Glu Val Pro Asn 340 345
350Thr Pro Leu Cys Ser Ala Arg Asp Leu Ala Glu Lys Lys Tyr Ile Leu
355 360 365Ser Asn Ala Asn Ser Phe Cys
Tyr Glu Asn Glu Val Ala Leu Thr Ser 370 375
380Lys Glu Glu Asp Asp Ser Glu Asn Gly Val Pro Glu Ser Thr Ser
Thr385 390 395 400Asp Thr
Pro Pro Asp Ile Asp Leu His Asn Gln Ala Ser Val Pro Leu
405 410 415Glu Pro Arg Pro Leu Arg Arg
Glu Ser Glu Ile 420 42527215PRTHomo sapiens
27Met Leu Ser Tyr Gly Glu Arg Leu Gly Ser Pro Ala Val Ser Pro Leu1
5 10 15Pro Val Arg Gly Gly His
Val Met Arg Gly Thr Ala Phe Ala Tyr Val 20 25
30Pro Ser Pro Gln Val Leu His Arg Ile Pro Gly Thr Ser
Ala Tyr Ala 35 40 45Phe Pro Ser
Leu Gly Pro Val Ala Leu Ala Glu His Thr Cys Pro Cys 50
55 60Gly Glu Val Leu Glu Arg His Glu Pro Leu Pro Ala
Lys Leu Ala Leu65 70 75
80Glu Glu Glu Gln Lys Pro Glu Ser Arg Leu Val Pro Lys Leu Arg Gln
85 90 95Ala Gly Ala Met Leu Leu
Lys Val Pro Leu Met Leu Thr Phe Leu Tyr 100
105 110Leu Phe Val Cys Ser Leu Asp Met Leu Ser Ser Ala
Phe Gln Leu Ala 115 120 125Gly Gly
Lys Val Ala Gly Asp Ile Phe Lys Asp Asn Ala Ile Leu Ser 130
135 140Asn Pro Val Ala Gly Leu Val Val Gly Ile Leu
Val Thr Val Leu Val145 150 155
160Gln Ser Ser Ser Thr Ser Thr Ser Ile Ile Val Ser Met Val Ser Ser
165 170 175Gly Leu Leu Glu
Val Ser Ser Ala Ile Pro Ile Ile Met Gly Ser Asn 180
185 190Ile Gly Thr Ser Val Thr Asn Thr Ile Val Ala
Leu Met Gln Ala Gly 195 200 205Asp
Arg Thr Asp Phe Arg Arg 210 21528311PRTHomo sapiens
28Val Ile Val Leu Gly Leu Tyr Ile Tyr Val Thr Tyr Lys Lys Pro Asp1
5 10 15Val Asn Trp Gly Ser Ser
Thr Gln Ala Leu Thr Tyr Leu Asn Ala Leu 20 25
30Gln His Ser Ile Arg Leu Ser Gly Val Glu Asp His Val
Lys Asn Phe 35 40 45Arg Pro Gln
Cys Leu Val Met Thr Gly Ala Pro Asn Ser Arg Pro Ala 50
55 60Leu Leu His Leu Val His Asp Phe Thr Lys Asn Val
Gly Leu Met Ile65 70 75
80Cys Gly His Val His Met Gly Pro Arg Arg Gln Ala Met Lys Glu Met
85 90 95Ser Ile Asp Gln Ala Lys
Tyr Gln Arg Trp Leu Ile Lys Asn Lys Met 100
105 110Lys Ala Phe Tyr Ala Pro Val His Ala Asp Asp Leu
Arg Glu Gly Ala 115 120 125Gln Tyr
Leu Met Gln Ala Ala Gly Leu Gly Arg Met Lys Pro Asn Thr 130
135 140Leu Val Leu Gly Phe Lys Lys Asp Trp Leu Gln
Ala Asp Met Arg Asp145 150 155
160Val Asp Met Tyr Ile Asn Leu Phe His Asp Ala Phe Asp Ile Gln Tyr
165 170 175Gly Val Val Val
Ile Arg Leu Lys Glu Gly Leu Asp Ile Ser His Leu 180
185 190Gln Gly Gln Glu Glu Leu Leu Ser Ser Gln Glu
Lys Ser Pro Gly Thr 195 200 205Lys
Asp Val Val Val Ser Val Glu Tyr Ser Lys Lys Ser Asp Leu Asp 210
215 220Thr Ser Lys Pro Leu Ser Glu Lys Pro Ile
Thr His Lys Glu Ser Lys225 230 235
240Gly Pro Ile Val Pro Leu Asn Val Ala Asp Gln Lys Leu Leu Glu
Ala 245 250 255Ser Thr Gln
Phe Gln Lys Lys Gln Gly Lys Asn Thr Ile Asp Val Trp 260
265 270Trp Leu Phe Asp Asp Gly Gly Leu Thr Leu
Leu Ile Pro Tyr Leu Leu 275 280
285Thr Thr Lys Lys Lys Trp Lys Asp Cys Lys Ile Arg Val Phe Ile Gly 290
295 300Gly Lys Ile Asn Arg Ile Asp305
31029353PRTArtificial sequencesynthetic amino acid sequence
29Met Ser Arg Arg Pro Trp Leu Leu Ala Leu Ala Leu Ala Val Ala Leu1
5 10 15Ala Ala Gly Ser Ala Gly
Ala Ser Thr Gly Ser Asp Ala Thr Val Pro 20 25
30Val Ala Thr Gln Asp Gly Pro Asp Tyr Val Phe His Arg
Ala His Glu 35 40 45Arg Met Leu
Phe Gln Thr Ser Tyr Thr Leu Glu Asn Asn Gly Ser Val 50
55 60Ile Cys Ile Pro Asn Asn Gly Gln Cys Phe Cys Leu
Ala Trp Leu Lys65 70 75
80Ser Asn Gly Thr Asn Ala Glu Lys Leu Ala Ala Asn Ile Leu Gln Trp
85 90 95Ile Thr Phe Ala Leu Ser
Ala Leu Cys Leu Met Phe Tyr Gly Tyr Gln 100
105 110Thr Trp Lys Ser Thr Cys Gly Trp Glu Glu Ile Tyr
Val Ala Thr Ile 115 120 125Glu Met
Ile Lys Phe Ile Ile Glu Tyr Phe His Glu Phe Asp Glu Pro 130
135 140Ala Val Ile Tyr Ser Ser Asn Gly Asn Lys Thr
Val Trp Leu Arg Tyr145 150 155
160Ala Glu Trp Leu Leu Thr Cys Pro Val Ile Leu Ile His Leu Ser Asn
165 170 175Leu Thr Gly Leu
Ala Asn Asp Tyr Asn Lys Arg Thr Met Gly Leu Leu 180
185 190Val Ser Asp Ile Gly Thr Ile Val Trp Gly Thr
Thr Ala Ala Leu Ser 195 200 205Lys
Gly Tyr Val Arg Val Ile Phe Phe Leu Met Gly Leu Cys Tyr Gly 210
215 220Ile Tyr Thr Phe Phe Asn Ala Ala Lys Val
Tyr Ile Glu Ala Tyr His225 230 235
240Thr Val Pro Lys Gly Arg Cys Arg Gln Val Val Thr Gly Met Ala
Trp 245 250 255Leu Phe Phe
Val Ser Trp Gly Met Phe Pro Ile Leu Phe Ile Leu Gly 260
265 270Pro Glu Gly Phe Gly Val Leu Ser Val Tyr
Gly Ser Thr Val Gly His 275 280
285Thr Ile Ile Asp Leu Met Ser Lys Asn Cys Trp Gly Leu Leu Gly His 290
295 300Tyr Leu Arg Val Leu Ile His Glu
His Ile Leu Ile His Gly Asp Ile305 310
315 320Arg Lys Thr Thr Lys Leu Asn Ile Gly Gly Thr Glu
Ile Glu Val Glu 325 330
335Thr Leu Val Glu Asp Glu Ala Glu Ala Gly Ala Val Ser Glu Gln Ile
340 345 350Asp30350PRTArtificial
sequencesynthetic amino acid sequence 30Met Val Ser Arg Arg Pro Trp Leu
Leu Ala Leu Ala Leu Ala Val Ala1 5 10
15Leu Ala Ala Gly Ser Ala Gly Ala Ser Thr Gly Ser Asp Ala
Thr Val 20 25 30Pro Val Ala
Thr Gln Asp Gly Pro Asp Tyr Val Phe His Arg Ala His 35
40 45Glu Arg Met Leu Phe Gln Thr Ser Tyr Thr Leu
Glu Asn Asn Gly Ser 50 55 60Val Ile
Cys Ile Pro Asn Asn Gly Gln Cys Phe Cys Leu Ala Trp Leu65
70 75 80Lys Ser Asn Gly Thr Asn Ala
Glu Lys Leu Ala Ala Asn Ile Leu Gln 85 90
95Trp Val Thr Phe Ala Leu Ser Val Ala Cys Leu Gly Trp
Tyr Ala Tyr 100 105 110Gln Ala
Trp Arg Ala Thr Cys Gly Trp Glu Glu Val Tyr Val Ala Leu 115
120 125Ile Glu Met Met Lys Ser Ile Ile Glu Ala
Phe His Glu Phe Asp Ser 130 135 140Pro
Ala Thr Leu Trp Leu Ser Ser Gly Asn Gly Val Val Trp Met Arg145
150 155 160Tyr Gly Glu Trp Leu Leu
Thr Cys Pro Val Ile Leu Ile His Leu Ser 165
170 175Asn Leu Thr Gly Leu Lys Asp Asp Tyr Ser Lys Arg
Thr Met Gly Leu 180 185 190Leu
Val Ser Asp Val Gly Cys Ile Val Trp Gly Ala Thr Ser Ala Met 195
200 205Cys Thr Gly Trp Thr Lys Ile Leu Phe
Phe Leu Ile Ser Leu Ser Tyr 210 215
220Gly Met Tyr Thr Tyr Phe His Ala Ala Lys Val Tyr Ile Glu Ala Phe225
230 235 240His Thr Val Pro
Lys Gly Leu Cys Arg Gln Leu Val Arg Ala Met Ala 245
250 255Trp Leu Phe Phe Val Ser Trp Gly Met Phe
Pro Val Leu Phe Leu Leu 260 265
270Gly Pro Glu Gly Phe Gly His Ile Ser Pro Tyr Gly Ser Ala Ile Gly
275 280 285His Ser Ile Leu Asp Leu Ile
Ala Lys Asn Met Trp Gly Val Leu Gly 290 295
300Asn Tyr Leu Arg Val Lys Ile His Glu His Ile Leu Leu Tyr Gly
Asp305 310 315 320Ile Arg
Lys Lys Gln Lys Ile Thr Ile Ala Gly Gln Glu Met Glu Val
325 330 335Glu Thr Leu Val Ala Glu Glu
Glu Asp Lys Tyr Glu Ser Ser 340 345
350311061PRTArtificial sequencesynthetic amino acid sequence 31Met
Asp Pro Ile Ala Leu Gln Ala Gly Tyr Asp Leu Leu Gly Asp Gly1
5 10 15Arg Pro Glu Thr Leu Trp Leu
Gly Ile Gly Thr Leu Leu Met Leu Ile 20 25
30Gly Thr Phe Tyr Phe Leu Val Arg Gly Trp Gly Val Thr Asp
Lys Asp 35 40 45Ala Arg Glu Tyr
Tyr Ala Val Thr Ile Leu Val Pro Gly Ile Ala Ser 50 55
60Ala Ala Tyr Leu Ser Met Phe Phe Gly Ile Gly Leu Thr
Glu Val Thr65 70 75
80Val Gly Gly Glu Met Leu Asp Ile Tyr Tyr Ala Arg Tyr Ala Asp Trp
85 90 95Leu Phe Thr Thr Pro Leu
Leu Leu Leu Asp Leu Ala Leu Leu Ala Lys 100
105 110Val Asp Arg Val Thr Ile Gly Thr Leu Val Gly Val
Asp Ala Leu Met 115 120 125Ile Val
Thr Gly Leu Ile Gly Ala Leu Ser His Thr Ala Ile Ala Arg 130
135 140Tyr Ser Trp Trp Leu Phe Ser Thr Ile Cys Met
Ile Val Val Leu Tyr145 150 155
160Phe Leu Ala Thr Ser Leu Arg Ser Ala Ala Lys Glu Arg Gly Pro Glu
165 170 175Val Ala Ser Thr
Phe Asn Thr Leu Thr Ala Leu Val Leu Val Leu Trp 180
185 190Thr Ala Tyr Pro Ile Leu Trp Ile Ile Gly Thr
Glu Gly Ala Gly Val 195 200 205Val
Gly Leu Gly Ile Glu Thr Leu Leu Phe Met Val Leu Asp Val Thr 210
215 220Ala Lys Val Gly Phe Gly Phe Ile Leu Leu
Arg Ser Arg Ala Ile Leu225 230 235
240Gly Asp Thr Glu Ala Pro Glu Pro Ser Ala Gly Ala Asp Val Ser
Ala 245 250 255Ala Asp Lys
Ser Arg Ile Thr Ser Glu Gly Glu Tyr Ile Pro Leu Asp 260
265 270Gln Ile Asp Ile Asn Val Gly Ala Pro Gly
Ser Gly Ala Thr Asn Phe 275 280
285Ser Leu Leu Lys Gln Ala Gly Asp Val Glu Glu Asn Pro Met Asp Leu 290
295 300Lys Glu Ser Pro Ser Glu Gly Ser
Leu Gln Pro Ser Ser Ile Gln Ile305 310
315 320Phe Ala Asn Thr Ser Thr Leu His Gly Ile Arg His
Ile Phe Val Tyr 325 330
335Gly Pro Leu Thr Ile Arg Arg Val Leu Trp Ala Val Ala Phe Val Gly
340 345 350Ser Leu Gly Leu Leu Leu
Val Glu Ser Ser Glu Arg Val Ser Tyr Tyr 355 360
365Phe Ser Tyr Gln His Val Thr Lys Val Asp Glu Val Val Ala
Gln Ser 370 375 380Leu Val Phe Pro Ala
Val Thr Leu Cys Asn Leu Asn Gly Phe Arg Phe385 390
395 400Ser Arg Leu Thr Thr Asn Asp Leu Tyr His
Ala Gly Glu Leu Leu Ala 405 410
415Leu Leu Asp Val Asn Leu Gln Ile Pro Asp Pro His Leu Ala Asp Pro
420 425 430Thr Val Leu Glu Ala
Leu Arg Gln Lys Ala Asn Phe Lys His Tyr Lys 435
440 445Pro Lys Gln Phe Ser Met Leu Glu Phe Leu His Arg
Val Gly His Asp 450 455 460Leu Lys Asp
Met Met Leu Tyr Cys Lys Phe Lys Gly Gln Glu Cys Gly465
470 475 480His Gln Asp Phe Thr Thr Val
Phe Thr Lys Tyr Gly Lys Cys Tyr Met 485
490 495Phe Asn Ser Gly Glu Asp Gly Lys Pro Leu Leu Thr
Thr Val Lys Gly 500 505 510Gly
Thr Gly Asn Gly Leu Glu Ile Met Leu Asp Ile Gln Gln Asp Glu 515
520 525Tyr Leu Pro Ile Trp Gly Glu Thr Glu
Glu Thr Thr Phe Glu Ala Gly 530 535
540Val Lys Val Gln Ile His Ser Gln Ser Glu Pro Pro Phe Ile Gln Glu545
550 555 560Leu Gly Phe Gly
Val Ala Pro Gly Phe Gln Thr Phe Val Ala Thr Gln 565
570 575Glu Gln Arg Leu Thr Tyr Leu Pro Pro Pro
Trp Gly Glu Cys Arg Ser 580 585
590Ser Glu Met Gly Leu Asp Phe Phe Pro Val Tyr Ser Ile Thr Ala Cys
595 600 605Arg Ile Asp Cys Glu Thr Arg
Tyr Ile Val Glu Asn Cys Asn Cys Arg 610 615
620Met Val His Met Pro Gly Asp Ala Pro Phe Cys Thr Pro Glu Gln
His625 630 635 640Lys Glu
Cys Ala Glu Pro Ala Leu Gly Leu Leu Ala Glu Lys Asp Ser
645 650 655Asn Tyr Cys Leu Cys Arg Thr
Pro Cys Asn Leu Thr Arg Tyr Asn Lys 660 665
670Glu Leu Ser Met Val Lys Ile Pro Ser Lys Thr Ser Ala Lys
Tyr Leu 675 680 685Glu Lys Lys Phe
Asn Lys Ser Glu Lys Tyr Ile Ser Glu Asn Ile Leu 690
695 700Val Leu Asp Ile Phe Phe Glu Ala Leu Asn Tyr Glu
Thr Ile Glu Gln705 710 715
720Lys Lys Ala Tyr Glu Val Ala Ala Leu Leu Gly Asp Ile Gly Gly Gln
725 730 735Met Gly Leu Phe Ile
Gly Ala Ser Leu Leu Thr Ile Leu Glu Leu Phe 740
745 750Asp Tyr Ile Tyr Glu Leu Ile Lys Glu Lys Leu Leu
Asp Leu Leu Gly 755 760 765Lys Glu
Glu Glu Glu Gly Ser His Asp Glu Asn Met Ser Thr Cys Asp 770
775 780Thr Met Pro Asn His Ser Glu Thr Ile Ser His
Thr Val Asn Val Pro785 790 795
800Leu Gln Thr Ala Leu Gly Thr Leu Glu Glu Ile Ala Cys Ala Ala Ala
805 810 815Val Ser Lys Gly
Glu Glu Leu Phe Thr Gly Val Val Pro Ile Leu Val 820
825 830Glu Leu Asp Gly Asp Val Asn Gly His Lys Phe
Ser Val Ser Gly Glu 835 840 845Gly
Glu Gly Asp Ala Thr Tyr Gly Lys Leu Thr Leu Lys Phe Ile Cys 850
855 860Thr Thr Gly Lys Leu Pro Val Pro Trp Pro
Thr Leu Val Thr Thr Phe865 870 875
880Gly Tyr Gly Leu Gln Cys Phe Ala Arg Tyr Pro Asp His Met Lys
Gln 885 890 895His Asp Phe
Phe Lys Ser Ala Met Pro Glu Gly Tyr Val Gln Glu Arg 900
905 910Thr Ile Phe Phe Lys Asp Asp Gly Asn Tyr
Lys Thr Arg Ala Glu Val 915 920
925Lys Phe Glu Gly Asp Thr Leu Val Asn Arg Ile Glu Leu Lys Gly Ile 930
935 940Asp Phe Arg Glu Asp Gly Asn Ile
Leu Gly His Lys Leu Glu Tyr Asn945 950
955 960Tyr Asn Ser His Asn Val Tyr Ile Met Ala Asp Lys
Gln Lys Asn Gly 965 970
975Ile Lys Val Asn Phe Lys Ile Arg His Asn Ile Glu Asp Gly Ser Val
980 985 990Gln Leu Ala Asp His Tyr
Gln Gln Asn Thr Pro Ile Gly Asp Gly Pro 995 1000
1005Val Leu Leu Pro Asp Asn His Tyr Leu Ser Tyr Gln
Ser Ala Leu 1010 1015 1020Ser Lys Asp
Pro Asn Glu Lys Arg Asp His Met Val Leu Leu Glu 1025
1030 1035Phe Val Thr Ala Ala Gly Ile Thr Leu Gly Met
Asp Glu Leu Tyr 1040 1045 1050Lys Phe
Cys Tyr Glu Asn Glu Val 1055 1060321081PRTArtificial
sequencesynthetic amino acid sequence 32Met Asp Pro Ile Ala Leu Gln Ala
Gly Tyr Asp Leu Leu Gly Asp Gly1 5 10
15Arg Pro Glu Thr Leu Trp Leu Gly Ile Gly Thr Leu Leu Met
Leu Ile 20 25 30Gly Thr Phe
Tyr Phe Leu Val Arg Gly Trp Gly Val Thr Asp Lys Asp 35
40 45Ala Arg Glu Tyr Tyr Ala Val Thr Ile Leu Val
Pro Gly Ile Ala Ser 50 55 60Ala Ala
Tyr Leu Ser Met Phe Phe Gly Ile Gly Leu Thr Glu Val Thr65
70 75 80Val Gly Gly Glu Met Leu Asp
Ile Tyr Tyr Ala Arg Tyr Ala Asp Trp 85 90
95Leu Phe Thr Thr Pro Leu Leu Leu Leu Asp Leu Ala Leu
Leu Ala Lys 100 105 110Val Asp
Arg Val Thr Ile Gly Thr Leu Val Gly Val Asp Ala Leu Met 115
120 125Ile Val Thr Gly Leu Ile Gly Ala Leu Ser
His Thr Ala Ile Ala Arg 130 135 140Tyr
Ser Trp Trp Leu Phe Ser Thr Ile Cys Met Ile Val Val Leu Tyr145
150 155 160Phe Leu Ala Thr Ser Leu
Arg Ser Ala Ala Lys Glu Arg Gly Pro Glu 165
170 175Val Ala Ser Thr Phe Asn Thr Leu Thr Ala Leu Val
Leu Val Leu Trp 180 185 190Thr
Ala Tyr Pro Ile Leu Trp Ile Ile Gly Thr Glu Gly Ala Gly Val 195
200 205Val Gly Leu Gly Ile Glu Thr Leu Leu
Phe Met Val Leu Asp Val Thr 210 215
220Ala Lys Val Gly Phe Gly Phe Ile Leu Leu Arg Ser Arg Ala Ile Leu225
230 235 240Gly Asp Thr Glu
Ala Pro Glu Pro Ser Ala Gly Ala Asp Val Ser Ala 245
250 255Ala Asp Lys Ser Arg Ile Thr Ser Glu Gly
Glu Tyr Ile Pro Leu Asp 260 265
270Gln Ile Asp Ile Asn Val Gly Ala Pro Gly Ser Gly Ala Thr Asn Phe
275 280 285Ser Leu Leu Lys Gln Ala Gly
Asp Val Glu Glu Asn Pro Met Asp Leu 290 295
300Lys Glu Ser Pro Ser Glu Gly Ser Leu Gln Pro Ser Ser Ile Gln
Ile305 310 315 320Phe Ala
Asn Thr Ser Thr Leu His Gly Ile Arg His Ile Phe Val Tyr
325 330 335Gly Pro Leu Thr Ile Arg Arg
Val Leu Trp Ala Val Ala Phe Val Gly 340 345
350Ser Leu Gly Leu Leu Leu Val Glu Ser Ser Glu Arg Val Ser
Tyr Tyr 355 360 365Phe Ser Tyr Gln
His Val Thr Lys Val Asp Glu Val Val Ala Gln Ser 370
375 380Leu Val Phe Pro Ala Val Thr Leu Cys Asn Leu Asn
Gly Phe Arg Phe385 390 395
400Ser Arg Leu Thr Thr Asn Asp Leu Tyr His Ala Gly Glu Leu Leu Ala
405 410 415Leu Leu Asp Val Asn
Leu Gln Ile Pro Asp Pro His Leu Ala Asp Pro 420
425 430Thr Val Leu Glu Ala Leu Arg Gln Lys Ala Asn Phe
Lys His Tyr Lys 435 440 445Pro Lys
Gln Phe Ser Met Leu Glu Phe Leu His Arg Val Gly His Asp 450
455 460Leu Lys Asp Met Met Leu Tyr Cys Lys Phe Lys
Gly Gln Glu Cys Gly465 470 475
480His Gln Asp Phe Thr Thr Val Phe Thr Lys Tyr Gly Lys Cys Tyr Met
485 490 495Phe Asn Ser Gly
Glu Asp Gly Lys Pro Leu Leu Thr Thr Val Lys Gly 500
505 510Gly Thr Gly Asn Gly Leu Glu Ile Met Leu Asp
Ile Gln Gln Asp Glu 515 520 525Tyr
Leu Pro Ile Trp Gly Glu Thr Glu Glu Thr Thr Phe Glu Ala Gly 530
535 540Val Lys Val Gln Ile His Ser Gln Ser Glu
Pro Pro Phe Ile Gln Glu545 550 555
560Leu Gly Phe Gly Val Ala Pro Gly Phe Gln Thr Phe Val Ala Thr
Gln 565 570 575Glu Gln Arg
Leu Thr Tyr Leu Pro Pro Pro Trp Gly Glu Cys Arg Ser 580
585 590Ser Glu Met Gly Leu Asp Phe Phe Pro Val
Tyr Ser Ile Thr Ala Cys 595 600
605Arg Ile Asp Cys Glu Thr Arg Tyr Ile Val Glu Asn Cys Asn Cys Arg 610
615 620Met Val His Met Pro Gly Asp Ala
Pro Phe Cys Thr Pro Glu Gln His625 630
635 640Lys Glu Cys Ala Glu Pro Ala Leu Gly Leu Leu Ala
Glu Lys Asp Ser 645 650
655Asn Tyr Cys Leu Cys Arg Thr Pro Cys Asn Leu Thr Arg Tyr Asn Lys
660 665 670Glu Leu Ser Met Val Lys
Ile Pro Ser Lys Thr Ser Ala Lys Tyr Leu 675 680
685Glu Lys Lys Phe Asn Lys Ser Glu Lys Tyr Ile Ser Glu Asn
Ile Leu 690 695 700Val Leu Asp Ile Phe
Phe Glu Ala Leu Asn Tyr Glu Thr Ile Glu Gln705 710
715 720Lys Lys Ala Tyr Glu Val Ala Ala Leu Leu
Gly Asp Ile Gly Gly Gln 725 730
735Met Gly Leu Phe Ile Gly Ala Ser Leu Leu Thr Ile Leu Glu Leu Phe
740 745 750Asp Tyr Ile Tyr Glu
Leu Ile Lys Glu Lys Leu Leu Asp Leu Leu Gly 755
760 765Lys Glu Glu Glu Glu Gly Ser His Asp Glu Asn Met
Ser Thr Cys Asp 770 775 780Thr Met Pro
Asn His Ser Glu Thr Ile Ser His Thr Val Asn Val Pro785
790 795 800Leu Gln Thr Ala Leu Gly Thr
Leu Glu Glu Ile Ala Cys Ala Ala Ala 805
810 815Lys Ser Arg Ile Thr Ser Glu Gly Glu Tyr Ile Pro
Leu Asp Gln Ile 820 825 830Asp
Ile Asn Val Val Ser Lys Gly Glu Glu Leu Phe Thr Gly Val Val 835
840 845Pro Ile Leu Val Glu Leu Asp Gly Asp
Val Asn Gly His Lys Phe Ser 850 855
860Val Ser Gly Glu Gly Glu Gly Asp Ala Thr Tyr Gly Lys Leu Thr Leu865
870 875 880Lys Phe Ile Cys
Thr Thr Gly Lys Leu Pro Val Pro Trp Pro Thr Leu 885
890 895Val Thr Thr Phe Gly Tyr Gly Leu Gln Cys
Phe Ala Arg Tyr Pro Asp 900 905
910His Met Lys Gln His Asp Phe Phe Lys Ser Ala Met Pro Glu Gly Tyr
915 920 925Val Gln Glu Arg Thr Ile Phe
Phe Lys Asp Asp Gly Asn Tyr Lys Thr 930 935
940Arg Ala Glu Val Lys Phe Glu Gly Asp Thr Leu Val Asn Arg Ile
Glu945 950 955 960Leu Lys
Gly Ile Asp Phe Arg Glu Asp Gly Asn Ile Leu Gly His Lys
965 970 975Leu Glu Tyr Asn Tyr Asn Ser
His Asn Val Tyr Ile Met Ala Asp Lys 980 985
990Gln Lys Asn Gly Ile Lys Val Asn Phe Lys Ile Arg His Asn
Ile Glu 995 1000 1005Asp Gly Ser
Val Gln Leu Ala Asp His Tyr Gln Gln Asn Thr Pro 1010
1015 1020Ile Gly Asp Gly Pro Val Leu Leu Pro Asp Asn
His Tyr Leu Ser 1025 1030 1035Tyr Gln
Ser Ala Leu Ser Lys Asp Pro Asn Glu Lys Arg Asp His 1040
1045 1050Met Val Leu Leu Glu Phe Val Thr Ala Ala
Gly Ile Thr Leu Gly 1055 1060 1065Met
Asp Glu Leu Tyr Lys Phe Cys Tyr Glu Asn Glu Val 1070
1075 1080331061PRTArtificial sequencesynthetic amino
acid sequence 33Met Asp Pro Ile Ala Leu Gln Ala Gly Tyr Asp Leu Leu Gly
Asp Gly1 5 10 15Arg Pro
Glu Thr Leu Trp Leu Gly Ile Gly Thr Leu Leu Met Leu Ile 20
25 30Gly Thr Phe Tyr Phe Leu Val Arg Gly
Trp Gly Val Thr Asp Lys Asp 35 40
45Ala Arg Glu Tyr Tyr Ala Val Thr Ile Leu Val Pro Gly Ile Ala Ser 50
55 60Ala Ala Tyr Leu Ser Met Phe Phe Gly
Ile Gly Leu Thr Glu Val Thr65 70 75
80Val Gly Gly Glu Met Leu Asp Ile Tyr Tyr Ala Arg Tyr Ala
Asp Trp 85 90 95Leu Phe
Thr Thr Pro Leu Leu Leu Leu Asp Leu Ala Leu Leu Ala Lys 100
105 110Val Asp Arg Val Thr Ile Gly Thr Leu
Val Gly Val Asp Ala Leu Met 115 120
125Ile Val Thr Gly Leu Ile Gly Ala Leu Ser His Thr Ala Ile Ala Arg
130 135 140Tyr Ser Trp Trp Leu Phe Ser
Thr Ile Cys Met Ile Val Val Leu Tyr145 150
155 160Phe Leu Ala Thr Ser Leu Arg Ser Ala Ala Lys Glu
Arg Gly Pro Glu 165 170
175Val Ala Ser Thr Phe Asn Thr Leu Thr Ala Leu Val Leu Val Leu Trp
180 185 190Thr Ala Tyr Pro Ile Leu
Trp Ile Ile Gly Thr Glu Gly Ala Gly Val 195 200
205Val Gly Leu Gly Ile Glu Thr Leu Leu Phe Met Val Leu Asp
Val Thr 210 215 220Ala Lys Val Gly Phe
Gly Phe Ile Leu Leu Arg Ser Arg Ala Ile Leu225 230
235 240Gly Asp Thr Glu Ala Pro Glu Pro Ser Ala
Gly Ala Asp Val Ser Ala 245 250
255Ala Asp Lys Ser Arg Ile Thr Ser Glu Gly Glu Tyr Ile Pro Leu Asp
260 265 270Gln Ile Asp Ile Asn
Val Gly Ala Pro Met Asp Leu Lys Glu Ser Pro 275
280 285Ser Glu Gly Ser Leu Gln Pro Ser Ser Ile Gln Ile
Phe Ala Asn Thr 290 295 300Ser Thr Leu
His Gly Ile Arg His Ile Phe Val Tyr Gly Pro Leu Thr305
310 315 320Ile Arg Arg Val Leu Trp Ala
Val Ala Phe Val Gly Ser Leu Gly Leu 325
330 335Leu Leu Val Glu Ser Ser Glu Arg Val Ser Tyr Tyr
Phe Ser Tyr Gln 340 345 350His
Val Thr Lys Val Asp Glu Val Val Ala Gln Ser Leu Val Phe Pro 355
360 365Ala Val Thr Leu Cys Asn Leu Asn Gly
Phe Arg Phe Ser Arg Leu Thr 370 375
380Thr Asn Asp Leu Tyr His Ala Gly Glu Leu Leu Ala Leu Leu Asp Val385
390 395 400Asn Leu Gln Ile
Pro Asp Pro His Leu Ala Asp Pro Thr Val Leu Glu 405
410 415Ala Leu Arg Gln Lys Ala Asn Phe Lys His
Tyr Lys Pro Lys Gln Phe 420 425
430Ser Met Leu Glu Phe Leu His Arg Val Gly His Asp Leu Lys Asp Met
435 440 445Met Leu Tyr Cys Lys Phe Lys
Gly Gln Glu Cys Gly His Gln Asp Phe 450 455
460Thr Thr Val Phe Thr Lys Tyr Gly Lys Cys Tyr Met Phe Asn Ser
Gly465 470 475 480Glu Asp
Gly Lys Pro Leu Leu Thr Thr Val Lys Gly Gly Thr Gly Asn
485 490 495Gly Leu Glu Ile Met Leu Asp
Ile Gln Gln Asp Glu Tyr Leu Pro Ile 500 505
510Trp Gly Glu Thr Glu Glu Thr Thr Phe Glu Ala Gly Val Lys
Val Gln 515 520 525Ile His Ser Gln
Ser Glu Pro Pro Phe Ile Gln Glu Leu Gly Phe Gly 530
535 540Val Ala Pro Gly Phe Gln Thr Phe Val Ala Thr Gln
Glu Gln Arg Leu545 550 555
560Thr Tyr Leu Pro Pro Pro Trp Gly Glu Cys Arg Ser Ser Glu Met Gly
565 570 575Leu Asp Phe Phe Pro
Val Tyr Ser Ile Thr Ala Cys Arg Ile Asp Cys 580
585 590Glu Thr Arg Tyr Ile Val Glu Asn Cys Asn Cys Arg
Met Val His Met 595 600 605Pro Gly
Asp Ala Pro Phe Cys Thr Pro Glu Gln His Lys Glu Cys Ala 610
615 620Glu Pro Ala Leu Gly Leu Leu Ala Glu Lys Asp
Ser Asn Tyr Cys Leu625 630 635
640Cys Arg Thr Pro Cys Asn Leu Thr Arg Tyr Asn Lys Glu Leu Ser Met
645 650 655Val Lys Ile Pro
Ser Lys Thr Ser Ala Lys Tyr Leu Glu Lys Lys Phe 660
665 670Asn Lys Ser Glu Lys Tyr Ile Ser Glu Asn Ile
Leu Val Leu Asp Ile 675 680 685Phe
Phe Glu Ala Leu Asn Tyr Glu Thr Ile Glu Gln Lys Lys Ala Tyr 690
695 700Glu Val Ala Ala Leu Leu Gly Asp Ile Gly
Gly Gln Met Gly Leu Phe705 710 715
720Ile Gly Ala Ser Leu Leu Thr Ile Leu Glu Leu Phe Asp Tyr Ile
Tyr 725 730 735Glu Leu Ile
Lys Glu Lys Leu Leu Asp Leu Leu Gly Lys Glu Glu Glu 740
745 750Glu Gly Ser His Asp Glu Asn Met Ser Thr
Cys Asp Thr Met Pro Asn 755 760
765His Ser Glu Thr Ile Ser His Thr Val Asn Val Pro Leu Gln Thr Ala 770
775 780Leu Gly Thr Leu Glu Glu Ile Ala
Cys Ala Ala Ala Lys Ser Arg Ile785 790
795 800Thr Ser Glu Gly Glu Tyr Ile Pro Leu Asp Gln Ile
Asp Ile Asn Val 805 810
815Val Ser Lys Gly Glu Glu Leu Phe Thr Gly Val Val Pro Ile Leu Val
820 825 830Glu Leu Asp Gly Asp Val
Asn Gly His Lys Phe Ser Val Ser Gly Glu 835 840
845Gly Glu Gly Asp Ala Thr Tyr Gly Lys Leu Thr Leu Lys Phe
Ile Cys 850 855 860Thr Thr Gly Lys Leu
Pro Val Pro Trp Pro Thr Leu Val Thr Thr Phe865 870
875 880Gly Tyr Gly Leu Gln Cys Phe Ala Arg Tyr
Pro Asp His Met Lys Gln 885 890
895His Asp Phe Phe Lys Ser Ala Met Pro Glu Gly Tyr Val Gln Glu Arg
900 905 910Thr Ile Phe Phe Lys
Asp Asp Gly Asn Tyr Lys Thr Arg Ala Glu Val 915
920 925Lys Phe Glu Gly Asp Thr Leu Val Asn Arg Ile Glu
Leu Lys Gly Ile 930 935 940Asp Phe Arg
Glu Asp Gly Asn Ile Leu Gly His Lys Leu Glu Tyr Asn945
950 955 960Tyr Asn Ser His Asn Val Tyr
Ile Met Ala Asp Lys Gln Lys Asn Gly 965
970 975Ile Lys Val Asn Phe Lys Ile Arg His Asn Ile Glu
Asp Gly Ser Val 980 985 990Gln
Leu Ala Asp His Tyr Gln Gln Asn Thr Pro Ile Gly Asp Gly Pro 995
1000 1005Val Leu Leu Pro Asp Asn His Tyr
Leu Ser Tyr Gln Ser Ala Leu 1010 1015
1020Ser Lys Asp Pro Asn Glu Lys Arg Asp His Met Val Leu Leu Glu
1025 1030 1035Phe Val Thr Ala Ala Gly
Ile Thr Leu Gly Met Asp Glu Leu Tyr 1040 1045
1050Lys Phe Cys Tyr Glu Asn Glu Val 1055
1060341083PRTArtificial sequencesynthetic amino acid sequence 34Met Asp
Pro Ile Ala Leu Gln Ala Gly Tyr Asp Leu Leu Gly Asp Gly1 5
10 15Arg Pro Glu Thr Leu Trp Leu Gly
Ile Gly Thr Leu Leu Met Leu Ile 20 25
30Gly Thr Phe Tyr Phe Leu Val Arg Gly Trp Gly Val Thr Asp Lys
Asp 35 40 45Ala Arg Glu Tyr Tyr
Ala Val Thr Ile Leu Val Pro Gly Ile Ala Ser 50 55
60Ala Ala Tyr Leu Ser Met Phe Phe Gly Ile Gly Leu Thr Glu
Val Thr65 70 75 80Val
Gly Gly Glu Met Leu Asp Ile Tyr Tyr Ala Arg Tyr Ala Asp Trp
85 90 95Leu Phe Thr Thr Pro Leu Leu
Leu Leu Asp Leu Ala Leu Leu Ala Lys 100 105
110Val Asp Arg Val Thr Ile Gly Thr Leu Val Gly Val Asp Ala
Leu Met 115 120 125Ile Val Thr Gly
Leu Ile Gly Ala Leu Ser His Thr Ala Ile Ala Arg 130
135 140Tyr Ser Trp Trp Leu Phe Ser Thr Ile Cys Met Ile
Val Val Leu Tyr145 150 155
160Phe Leu Ala Thr Ser Leu Arg Ser Ala Ala Lys Glu Arg Gly Pro Glu
165 170 175Val Ala Ser Thr Phe
Asn Thr Leu Thr Ala Leu Val Leu Val Leu Trp 180
185 190Thr Ala Tyr Pro Ile Leu Trp Ile Ile Gly Thr Glu
Gly Ala Gly Val 195 200 205Val Gly
Leu Gly Ile Glu Thr Leu Leu Phe Met Val Leu Asp Val Thr 210
215 220Ala Lys Val Gly Phe Gly Phe Ile Leu Leu Arg
Ser Arg Ala Ile Leu225 230 235
240Gly Asp Thr Glu Ala Pro Glu Pro Ser Ala Gly Ala Asp Val Ser Ala
245 250 255Ala Asp Lys Ser
Arg Ile Thr Ser Glu Gly Glu Tyr Ile Pro Leu Asp 260
265 270Gln Ile Asp Ile Asn Val Gly Ala Pro Gly Ser
Gly Ala Thr Asn Phe 275 280 285Ser
Leu Leu Lys Gln Ala Gly Asp Val Glu Glu Asn Pro Gly Pro Met 290
295 300Asp Leu Lys Glu Ser Pro Ser Glu Gly Ser
Leu Gln Pro Ser Ser Ile305 310 315
320Gln Ile Phe Ala Asn Thr Ser Thr Leu His Gly Ile Arg His Ile
Phe 325 330 335Val Tyr Gly
Pro Leu Thr Ile Arg Arg Val Leu Trp Ala Val Ala Phe 340
345 350Val Gly Ser Leu Gly Leu Leu Leu Val Glu
Ser Ser Glu Arg Val Ser 355 360
365Tyr Tyr Phe Ser Tyr Gln His Val Thr Lys Val Asp Glu Val Val Ala 370
375 380Gln Ser Leu Val Phe Pro Ala Val
Thr Leu Cys Asn Leu Asn Gly Phe385 390
395 400Arg Phe Ser Arg Leu Thr Thr Asn Asp Leu Tyr His
Ala Gly Glu Leu 405 410
415Leu Ala Leu Leu Asp Val Asn Leu Gln Ile Pro Asp Pro His Leu Ala
420 425 430Asp Pro Thr Val Leu Glu
Ala Leu Arg Gln Lys Ala Asn Phe Lys His 435 440
445Tyr Lys Pro Lys Gln Phe Ser Met Leu Glu Phe Leu His Arg
Val Gly 450 455 460His Asp Leu Lys Asp
Met Met Leu Tyr Cys Lys Phe Lys Gly Gln Glu465 470
475 480Cys Gly His Gln Asp Phe Thr Thr Val Phe
Thr Lys Tyr Gly Lys Cys 485 490
495Tyr Met Phe Asn Ser Gly Glu Asp Gly Lys Pro Leu Leu Thr Thr Val
500 505 510Lys Gly Gly Thr Gly
Asn Gly Leu Glu Ile Met Leu Asp Ile Gln Gln 515
520 525Asp Glu Tyr Leu Pro Ile Trp Gly Glu Thr Glu Glu
Thr Thr Phe Glu 530 535 540Ala Gly Val
Lys Val Gln Ile His Ser Gln Ser Glu Pro Pro Phe Ile545
550 555 560Gln Glu Leu Gly Phe Gly Val
Ala Pro Gly Phe Gln Thr Phe Val Ala 565
570 575Thr Gln Glu Gln Arg Leu Thr Tyr Leu Pro Pro Pro
Trp Gly Glu Cys 580 585 590Arg
Ser Ser Glu Met Gly Leu Asp Phe Phe Pro Val Tyr Ser Ile Thr 595
600 605Ala Cys Arg Ile Asp Cys Glu Thr Arg
Tyr Ile Val Glu Asn Cys Asn 610 615
620Cys Arg Met Val His Met Pro Gly Asp Ala Pro Phe Cys Thr Pro Glu625
630 635 640Gln His Lys Glu
Cys Ala Glu Pro Ala Leu Gly Leu Leu Ala Glu Lys 645
650 655Asp Ser Asn Tyr Cys Leu Cys Arg Thr Pro
Cys Asn Leu Thr Arg Tyr 660 665
670Asn Lys Glu Leu Ser Met Val Lys Ile Pro Ser Lys Thr Ser Ala Lys
675 680 685Tyr Leu Glu Lys Lys Phe Asn
Lys Ser Glu Lys Tyr Ile Ser Glu Asn 690 695
700Ile Leu Val Leu Asp Ile Phe Phe Glu Ala Leu Asn Tyr Glu Thr
Ile705 710 715 720Glu Gln
Lys Lys Ala Tyr Glu Val Ala Ala Leu Leu Gly Asp Ile Gly
725 730 735Gly Gln Met Gly Leu Phe Ile
Gly Ala Ser Leu Leu Thr Ile Leu Glu 740 745
750Leu Phe Asp Tyr Ile Tyr Glu Leu Ile Lys Glu Lys Leu Leu
Asp Leu 755 760 765Leu Gly Lys Glu
Glu Glu Glu Gly Ser His Asp Glu Asn Met Ser Thr 770
775 780Cys Asp Thr Met Pro Asn His Ser Glu Thr Ile Ser
His Thr Val Asn785 790 795
800Val Pro Leu Gln Thr Ala Leu Gly Thr Leu Glu Glu Ile Ala Cys Ala
805 810 815Ala Ala Lys Ser Arg
Ile Thr Ser Glu Gly Glu Tyr Ile Pro Leu Asp 820
825 830Gln Ile Asp Ile Asn Val Val Ser Lys Gly Glu Glu
Leu Phe Thr Gly 835 840 845Val Val
Pro Ile Leu Val Glu Leu Asp Gly Asp Val Asn Gly His Lys 850
855 860Phe Ser Val Ser Gly Glu Gly Glu Gly Asp Ala
Thr Tyr Gly Lys Leu865 870 875
880Thr Leu Lys Phe Ile Cys Thr Thr Gly Lys Leu Pro Val Pro Trp Pro
885 890 895Thr Leu Val Thr
Thr Phe Gly Tyr Gly Leu Gln Cys Phe Ala Arg Tyr 900
905 910Pro Asp His Met Lys Gln His Asp Phe Phe Lys
Ser Ala Met Pro Glu 915 920 925Gly
Tyr Val Gln Glu Arg Thr Ile Phe Phe Lys Asp Asp Gly Asn Tyr 930
935 940Lys Thr Arg Ala Glu Val Lys Phe Glu Gly
Asp Thr Leu Val Asn Arg945 950 955
960Ile Glu Leu Lys Gly Ile Asp Phe Arg Glu Asp Gly Asn Ile Leu
Gly 965 970 975His Lys Leu
Glu Tyr Asn Tyr Asn Ser His Asn Val Tyr Ile Met Ala 980
985 990Asp Lys Gln Lys Asn Gly Ile Lys Val Asn
Phe Lys Ile Arg His Asn 995 1000
1005Ile Glu Asp Gly Ser Val Gln Leu Ala Asp His Tyr Gln Gln Asn
1010 1015 1020Thr Pro Ile Gly Asp Gly
Pro Val Leu Leu Pro Asp Asn His Tyr 1025 1030
1035Leu Ser Tyr Gln Ser Ala Leu Ser Lys Asp Pro Asn Glu Lys
Arg 1040 1045 1050Asp His Met Val Leu
Leu Glu Phe Val Thr Ala Ala Gly Ile Thr 1055 1060
1065Leu Gly Met Asp Glu Leu Tyr Lys Phe Cys Tyr Glu Asn
Glu Val 1070 1075
1080353171PRTArtificial sequencesynthetic amino acid sequence 35Ala Thr
Gly Gly Ala Cys Cys Cys Cys Ala Thr Cys Gly Cys Thr Cys1 5
10 15Thr Gly Cys Ala Gly Gly Cys Thr
Gly Gly Thr Thr Ala Cys Gly Ala 20 25
30Cys Cys Thr Gly Cys Thr Gly Gly Gly Thr Gly Ala Cys Gly Gly
Cys 35 40 45Ala Gly Ala Cys Cys
Thr Gly Ala Ala Ala Cys Thr Cys Thr Gly Thr 50 55
60Gly Gly Cys Thr Gly Gly Gly Cys Ala Thr Cys Gly Gly Cys
Ala Cys65 70 75 80Thr
Cys Thr Gly Cys Thr Gly Ala Thr Gly Cys Thr Gly Ala Thr Thr
85 90 95Gly Gly Ala Ala Cys Cys Thr
Thr Cys Thr Ala Cys Thr Thr Thr Cys 100 105
110Thr Gly Gly Thr Cys Cys Gly Cys Gly Gly Ala Thr Gly Gly
Gly Gly 115 120 125Ala Gly Thr Cys
Ala Cys Cys Gly Ala Thr Ala Ala Gly Gly Ala Thr 130
135 140Gly Cys Cys Cys Gly Gly Gly Ala Ala Thr Ala Thr
Thr Ala Cys Gly145 150 155
160Cys Thr Gly Thr Gly Ala Cys Thr Ala Thr Cys Cys Thr Gly Gly Thr
165 170 175Gly Cys Cys Cys Gly
Gly Ala Ala Thr Cys Gly Cys Ala Thr Cys Cys 180
185 190Gly Cys Cys Gly Cys Ala Thr Ala Thr Cys Thr Gly
Thr Cys Thr Ala 195 200 205Thr Gly
Thr Thr Cys Thr Thr Thr Gly Gly Thr Ala Thr Cys Gly Gly 210
215 220Gly Cys Thr Thr Ala Cys Thr Gly Ala Gly Gly
Thr Gly Ala Cys Cys225 230 235
240Gly Thr Cys Gly Gly Gly Gly Gly Cys Gly Ala Ala Ala Thr Gly Thr
245 250 255Thr Gly Gly Ala
Thr Ala Thr Cys Thr Ala Thr Thr Ala Thr Gly Cys 260
265 270Cys Ala Gly Gly Thr Ala Cys Gly Cys Cys Gly
Ala Cys Thr Gly Gly 275 280 285Cys
Thr Gly Thr Thr Thr Ala Cys Cys Ala Cys Cys Cys Cys Ala Cys 290
295 300Thr Thr Cys Thr Gly Cys Thr Gly Cys Thr
Gly Gly Ala Thr Cys Thr305 310 315
320Gly Gly Cys Cys Cys Thr Thr Cys Thr Cys Gly Cys Thr Ala Ala
Gly 325 330 335Gly Thr Gly
Gly Ala Thr Cys Gly Gly Gly Thr Gly Ala Cys Cys Ala 340
345 350Thr Cys Gly Gly Cys Ala Cys Cys Cys Thr
Gly Gly Thr Gly Gly Gly 355 360
365Thr Gly Thr Gly Gly Ala Cys Gly Cys Cys Cys Thr Gly Ala Thr Gly 370
375 380Ala Thr Cys Gly Thr Cys Ala Cys
Thr Gly Gly Cys Cys Thr Cys Ala385 390
395 400Thr Cys Gly Gly Ala Gly Cys Cys Thr Thr Gly Ala
Gly Cys Cys Ala 405 410
415Cys Ala Cys Gly Gly Cys Cys Ala Thr Ala Gly Cys Cys Ala Gly Ala
420 425 430Thr Ala Cys Ala Gly Thr
Thr Gly Gly Thr Gly Gly Thr Thr Gly Thr 435 440
445Thr Cys Thr Cys Thr Ala Cys Ala Ala Thr Thr Thr Gly Cys
Ala Thr 450 455 460Gly Ala Thr Ala Gly
Thr Gly Gly Thr Gly Cys Thr Cys Thr Ala Thr465 470
475 480Thr Thr Thr Cys Thr Gly Gly Cys Thr Ala
Cys Ala Thr Cys Cys Cys 485 490
495Thr Gly Cys Gly Ala Thr Cys Thr Gly Cys Thr Gly Cys Ala Ala Ala
500 505 510Gly Gly Ala Gly Cys
Gly Gly Gly Gly Cys Cys Cys Cys Gly Ala Gly 515
520 525Gly Thr Gly Gly Cys Ala Thr Cys Thr Ala Cys Cys
Thr Thr Thr Ala 530 535 540Ala Cys Ala
Cys Cys Cys Thr Gly Ala Cys Ala Gly Cys Thr Cys Thr545
550 555 560Gly Gly Thr Cys Thr Thr Gly
Gly Thr Gly Cys Thr Gly Thr Gly Gly 565
570 575Ala Cys Cys Gly Cys Thr Thr Ala Cys Cys Cys Thr
Ala Thr Cys Cys 580 585 590Thr
Gly Thr Gly Gly Ala Thr Cys Ala Thr Ala Gly Gly Cys Ala Cys 595
600 605Thr Gly Ala Gly Gly Gly Cys Gly Cys
Thr Gly Gly Cys Gly Thr Gly 610 615
620Gly Thr Gly Gly Gly Cys Cys Thr Gly Gly Gly Cys Ala Thr Cys Gly625
630 635 640Ala Ala Ala Cys
Thr Cys Thr Gly Cys Thr Gly Thr Thr Thr Ala Thr 645
650 655Gly Gly Thr Gly Thr Thr Gly Gly Ala Cys
Gly Thr Gly Ala Cys Thr 660 665
670Gly Cys Cys Ala Ala Gly Gly Thr Cys Gly Gly Cys Thr Thr Thr Gly
675 680 685Gly Cys Thr Thr Thr Ala Thr
Cys Cys Thr Gly Thr Thr Gly Ala Gly 690 695
700Ala Thr Cys Cys Cys Gly Gly Gly Cys Thr Ala Thr Thr Cys Thr
Gly705 710 715 720Gly Gly
Cys Gly Ala Cys Ala Cys Cys Gly Ala Gly Gly Cys Ala Cys
725 730 735Cys Ala Gly Ala Ala Cys Cys
Cys Ala Gly Thr Gly Cys Cys Gly Gly 740 745
750Thr Gly Cys Cys Gly Ala Thr Gly Thr Cys Ala Gly Thr Gly
Cys Cys 755 760 765Gly Cys Cys Gly
Ala Cys Ala Ala Gly Ala Gly Cys Ala Gly Gly Ala 770
775 780Thr Cys Ala Cys Cys Ala Gly Cys Gly Ala Gly Gly
Gly Cys Gly Ala785 790 795
800Gly Thr Ala Cys Ala Thr Cys Cys Cys Cys Cys Thr Gly Gly Ala Cys
805 810 815Cys Ala Gly Ala Thr
Cys Gly Ala Cys Ala Thr Cys Ala Ala Cys Gly 820
825 830Thr Gly Gly Gly Cys Gly Cys Gly Cys Cys Cys Gly
Gly Cys Thr Cys 835 840 845Cys Gly
Gly Ala Gly Cys Cys Ala Cys Gly Ala Ala Cys Thr Thr Cys 850
855 860Thr Cys Thr Cys Thr Gly Thr Thr Ala Ala Ala
Gly Cys Ala Ala Gly865 870 875
880Cys Ala Gly Gly Ala Gly Ala Cys Gly Thr Gly Gly Ala Ala Gly Ala
885 890 895Ala Ala Ala Cys
Cys Cys Cys Gly Gly Thr Cys Cys Cys Ala Thr Gly 900
905 910Gly Ala Cys Cys Thr Gly Ala Ala Gly Gly Ala
Gly Thr Cys Ala Cys 915 920 925Cys
Ala Ala Gly Cys Gly Ala Gly Gly Gly Ala Thr Cys Ala Cys Thr 930
935 940Gly Cys Ala Gly Cys Cys Ala Thr Cys Ala
Ala Gly Cys Ala Thr Thr945 950 955
960Cys Ala Gly Ala Thr Thr Thr Thr Cys Gly Cys Thr Ala Ala Thr
Ala 965 970 975Cys Ala Ala
Gly Cys Ala Cys Ala Cys Thr Gly Cys Ala Cys Gly Gly 980
985 990Cys Ala Thr Cys Cys Gly Gly Cys Ala Thr
Ala Thr Cys Thr Thr Cys 995 1000
1005Gly Thr Gly Thr Ala Cys Gly Gly Cys Cys Cys Ala Cys Thr Gly
1010 1015 1020Ala Cys Cys Ala Thr Thr
Cys Gly Gly Ala Gly Ala Gly Thr Cys 1025 1030
1035Cys Thr Gly Thr Gly Gly Gly Cys Ala Gly Thr Gly Gly Cys
Cys 1040 1045 1050Thr Thr Thr Gly Thr
Cys Gly Gly Ala Ala Gly Cys Cys Thr Gly 1055 1060
1065Gly Gly Ala Cys Thr Gly Cys Thr Gly Cys Thr Gly Gly
Thr Gly 1070 1075 1080Gly Ala Gly Ala
Gly Cys Thr Cys Cys Gly Ala Ala Ala Gly Ala 1085
1090 1095Gly Thr Cys Ala Gly Thr Thr Ala Cys Thr Ala
Thr Thr Thr Cys 1100 1105 1110Thr Cys
Ala Thr Ala Thr Cys Ala Gly Cys Ala Cys Gly Thr Gly 1115
1120 1125Ala Cys Thr Ala Ala Gly Gly Thr Gly Gly
Ala Cys Gly Ala Gly 1130 1135 1140Gly
Thr Gly Gly Thr Cys Gly Cys Thr Cys Ala Gly Thr Cys Cys 1145
1150 1155Cys Thr Gly Gly Thr Gly Thr Thr Thr
Cys Cys Cys Gly Cys Ala 1160 1165
1170Gly Thr Cys Ala Cys Cys Cys Thr Gly Thr Gly Cys Ala Ala Cys
1175 1180 1185Cys Thr Gly Ala Ala Thr
Gly Gly Gly Thr Thr Cys Ala Gly Gly 1190 1195
1200Thr Thr Thr Thr Cys Thr Cys Gly Cys Cys Thr Gly Ala Cys
Cys 1205 1210 1215Ala Cys Ala Ala Ala
Cys Gly Ala Cys Cys Thr Gly Thr Ala Cys 1220 1225
1230Cys Ala Cys Gly Cys Cys Gly Gly Ala Gly Ala Gly Cys
Thr Gly 1235 1240 1245Cys Thr Gly Gly
Cys Thr Cys Thr Gly Cys Thr Gly Gly Ala Thr 1250
1255 1260Gly Thr Gly Ala Ala Thr Cys Thr Gly Cys Ala
Gly Ala Thr Cys 1265 1270 1275Cys Cys
Ala Gly Ala Cys Cys Cys Cys Cys Ala Thr Cys Thr Gly 1280
1285 1290Gly Cys Cys Gly Ala Thr Cys Cys Ala Ala
Cys Cys Gly Thr Gly 1295 1300 1305Cys
Thr Gly Gly Ala Ala Gly Cys Ala Cys Thr Gly Ala Gly Gly 1310
1315 1320Cys Ala Gly Ala Ala Gly Gly Cys Cys
Ala Ala Cys Thr Thr Cys 1325 1330
1335Ala Ala Ala Cys Ala Cys Thr Ala Cys Ala Ala Gly Cys Cys Cys
1340 1345 1350Ala Ala Ala Cys Ala Gly
Thr Thr Cys Ala Gly Cys Ala Thr Gly 1355 1360
1365Cys Thr Gly Gly Ala Gly Thr Thr Thr Cys Thr Gly Cys Ala
Cys 1370 1375 1380Cys Gly Cys Gly Thr
Gly Gly Gly Ala Cys Ala Thr Gly Ala Cys 1385 1390
1395Cys Thr Gly Ala Ala Ala Gly Ala Thr Ala Thr Gly Ala
Thr Gly 1400 1405 1410Cys Thr Gly Thr
Ala Thr Thr Gly Cys Ala Ala Gly Thr Thr Cys 1415
1420 1425Ala Ala Ala Gly Gly Cys Cys Ala Gly Gly Ala
Gly Thr Gly Thr 1430 1435 1440Gly Gly
Gly Cys Ala Thr Cys Ala Gly Gly Ala Cys Thr Thr Cys 1445
1450 1455Ala Cys Thr Ala Cys Cys Gly Thr Gly Thr
Thr Thr Ala Cys Ala 1460 1465 1470Ala
Ala Gly Thr Ala Cys Gly Gly Cys Ala Ala Ala Thr Gly Thr 1475
1480 1485Thr Ala Cys Ala Thr Gly Thr Thr Cys
Ala Ala Cys Thr Cys Cys 1490 1495
1500Gly Gly Gly Gly Ala Ala Gly Ala Thr Gly Gly Ala Ala Ala Ala
1505 1510 1515Cys Cys Thr Cys Thr Gly
Cys Thr Gly Ala Cys Ala Ala Cys Thr 1520 1525
1530Gly Thr Gly Ala Ala Gly Gly Gly Cys Gly Gly Gly Ala Cys
Ala 1535 1540 1545Gly Gly Gly Ala Ala
Thr Gly Gly Ala Cys Thr Gly Gly Ala Gly 1550 1555
1560Ala Thr Cys Ala Thr Gly Cys Thr Gly Gly Ala Cys Ala
Thr Thr 1565 1570 1575Cys Ala Gly Cys
Ala Gly Gly Ala Thr Gly Ala Gly Thr Ala Cys 1580
1585 1590Cys Thr Gly Cys Cys Ala Ala Thr Cys Thr Gly
Gly Gly Gly Ala 1595 1600 1605Gly Ala
Ala Ala Cys Thr Gly Ala Gly Gly Ala Ala Ala Cys Cys 1610
1615 1620Ala Cys Ala Thr Thr Cys Gly Ala Gly Gly
Cys Cys Gly Gly Cys 1625 1630 1635Gly
Thr Gly Ala Ala Gly Gly Thr Cys Cys Ala Gly Ala Thr Cys 1640
1645 1650Cys Ala Cys Thr Cys Ala Cys Ala Gly
Ala Gly Cys Gly Ala Gly 1655 1660
1665Cys Cys Cys Cys Cys Thr Thr Thr Cys Ala Thr Thr Cys Ala Gly
1670 1675 1680Gly Ala Ala Cys Thr Gly
Gly Gly Ala Thr Thr Thr Gly Gly Ala 1685 1690
1695Gly Thr Gly Gly Cys Ala Cys Cys Ala Gly Gly Ala Thr Thr
Cys 1700 1705 1710Cys Ala Gly Ala Cys
Ala Thr Thr Thr Gly Thr Cys Gly Cys Thr 1715 1720
1725Ala Cys Thr Cys Ala Gly Gly Ala Gly Cys Ala Gly Cys
Gly Cys 1730 1735 1740Cys Thr Gly Ala
Cys Cys Thr Ala Thr Cys Thr Gly Cys Cys Ala 1745
1750 1755Cys Cys Cys Cys Cys Thr Thr Gly Gly Gly Gly
Cys Gly Ala Gly 1760 1765 1770Thr Gly
Cys Cys Gly Ala Thr Cys Thr Ala Gly Thr Gly Ala Ala 1775
1780 1785Ala Thr Gly Gly Gly Gly Cys Thr Gly Gly
Ala Cys Thr Thr Cys 1790 1795 1800Thr
Thr Thr Cys Cys Thr Gly Thr Gly Thr Ala Cys Thr Cys Thr 1805
1810 1815Ala Thr Cys Ala Cys Cys Gly Cys Cys
Thr Gly Cys Cys Gly Ala 1820 1825
1830Ala Thr Thr Gly Ala Thr Thr Gly Thr Gly Ala Gly Ala Cys Ala
1835 1840 1845Cys Gly Gly Thr Ala Thr
Ala Thr Cys Gly Thr Gly Gly Ala Ala 1850 1855
1860Ala Ala Cys Thr Gly Cys Ala Ala Thr Thr Gly Thr Ala Gly
Gly 1865 1870 1875Ala Thr Gly Gly Thr
Cys Cys Ala Cys Ala Thr Gly Cys Cys Thr 1880 1885
1890Gly Gly Cys Gly Ala Cys Gly Cys Cys Cys Cys Ala Thr
Thr Cys 1895 1900 1905Thr Gly Cys Ala
Cys Thr Cys Cys Cys Gly Ala Ala Cys Ala Gly 1910
1915 1920Cys Ala Thr Ala Ala Ala Gly Ala Gly Thr Gly
Thr Gly Cys Thr 1925 1930 1935Gly Ala
Ala Cys Cys Thr Gly Cys Ala Cys Thr Gly Gly Gly Gly 1940
1945 1950Cys Thr Gly Cys Thr Gly Gly Cys Thr Gly
Ala Gly Ala Ala Gly 1955 1960 1965Gly
Ala Thr Ala Gly Thr Ala Ala Cys Thr Ala Cys Thr Gly Cys 1970
1975 1980Cys Thr Gly Thr Gly Thr Ala Gly Ala
Ala Cys Ala Cys Cys Cys 1985 1990
1995Thr Gly Thr Ala Ala Cys Cys Thr Gly Ala Cys Thr Ala Gly Gly
2000 2005 2010Thr Ala Thr Ala Ala Thr
Ala Ala Gly Gly Ala Ala Cys Thr Gly 2015 2020
2025Ala Gly Cys Ala Thr Gly Gly Thr Gly Ala Ala Gly Ala Thr
Cys 2030 2035 2040Cys Cys Thr Thr Cys
Cys Ala Ala Ala Ala Cys Ala Thr Cys Thr 2045 2050
2055Gly Cys Ala Ala Ala Gly Thr Ala Cys Cys Thr Gly Gly
Ala Gly 2060 2065 2070Ala Ala Gly Ala
Ala Gly Thr Thr Cys Ala Ala Cys Ala Ala Gly 2075
2080 2085Thr Cys Thr Gly Ala Gly Ala Ala Gly Thr Ala
Cys Ala Thr Cys 2090 2095 2100Ala Gly
Thr Gly Ala Ala Ala Ala Cys Ala Thr Thr Cys Thr Gly 2105
2110 2115Gly Thr Gly Cys Thr Gly Gly Ala Cys Ala
Thr Cys Thr Thr Cys 2120 2125 2130Thr
Thr Thr Gly Ala Ala Gly Cys Thr Cys Thr Gly Ala Ala Thr 2135
2140 2145Thr Ala Cys Gly Ala Gly Ala Cys Cys
Ala Thr Thr Gly Ala Ala 2150 2155
2160Cys Ala Gly Ala Ala Gly Ala Ala Ala Gly Cys Ala Thr Ala Thr
2165 2170 2175Gly Ala Gly Gly Thr Gly
Gly Cys Cys Gly Cys Thr Cys Thr Gly 2180 2185
2190Cys Thr Gly Gly Gly Gly Gly Ala Thr Ala Thr Thr Gly Gly
Ala 2195 2200 2205Gly Gly Cys Cys Ala
Gly Ala Thr Gly Gly Gly Ala Cys Thr Gly 2210 2215
2220Thr Thr Cys Ala Thr Cys Gly Gly Cys Gly Cys Cys Ala
Gly Cys 2225 2230 2235Cys Thr Gly Cys
Thr Gly Ala Cys Ala Ala Thr Thr Cys Thr Gly 2240
2245 2250Gly Ala Gly Cys Thr Gly Thr Thr Thr Gly Ala
Cys Thr Ala Cys 2255 2260 2265Ala Thr
Cys Thr Ala Thr Gly Ala Gly Cys Thr Gly Ala Thr Thr 2270
2275 2280Ala Ala Gly Gly Ala Ala Ala Ala Ala Cys
Thr Gly Cys Thr Gly 2285 2290 2295Gly
Ala Thr Cys Thr Gly Cys Thr Gly Gly Gly Gly Ala Ala Gly 2300
2305 2310Gly Ala Gly Gly Ala Ala Gly Ala Gly
Gly Ala Ala Gly Gly Ala 2315 2320
2325Thr Cys Ala Cys Ala Cys Gly Ala Cys Gly Ala Ala Ala Ala Cys
2330 2335 2340Ala Thr Gly Ala Gly Cys
Ala Cys Thr Thr Gly Cys Gly Ala Thr 2345 2350
2355Ala Cys Cys Ala Thr Gly Cys Cys Thr Ala Ala Thr Cys Ala
Cys 2360 2365 2370Ala Gly Cys Gly Ala
Gly Ala Cys Cys Ala Thr Cys Thr Cys Cys 2375 2380
2385Cys Ala Thr Ala Cys Ala Gly Thr Gly Ala Ala Thr Gly
Thr Cys 2390 2395 2400Cys Cys Ala Cys
Thr Gly Cys Ala Gly Ala Cys Thr Gly Cys Ala 2405
2410 2415Cys Thr Gly Gly Gly Cys Ala Cys Cys Cys Thr
Gly Gly Ala Gly 2420 2425 2430Gly Ala
Ala Ala Thr Thr Gly Cys Cys Thr Gly Thr Gly Cys Gly 2435
2440 2445Gly Cys Cys Gly Cys Cys Gly Thr Gly Ala
Gly Cys Ala Ala Gly 2450 2455 2460Gly
Gly Cys Gly Ala Gly Gly Ala Gly Cys Thr Gly Thr Thr Cys 2465
2470 2475Ala Cys Cys Gly Gly Gly Gly Thr Gly
Gly Thr Gly Cys Cys Cys 2480 2485
2490Ala Thr Cys Cys Thr Gly Gly Thr Cys Gly Ala Gly Cys Thr Gly
2495 2500 2505Gly Ala Cys Gly Gly Cys
Gly Ala Cys Gly Thr Ala Ala Ala Cys 2510 2515
2520Gly Gly Cys Cys Ala Cys Ala Ala Gly Thr Thr Cys Ala Gly
Cys 2525 2530 2535Gly Thr Gly Thr Cys
Cys Gly Gly Cys Gly Ala Gly Gly Gly Cys 2540 2545
2550Gly Ala Gly Gly Gly Cys Gly Ala Thr Gly Cys Cys Ala
Cys Cys 2555 2560 2565Thr Ala Cys Gly
Gly Cys Ala Ala Gly Cys Thr Gly Ala Cys Cys 2570
2575 2580Cys Thr Gly Ala Ala Gly Thr Thr Cys Ala Thr
Cys Thr Gly Cys 2585 2590 2595Ala Cys
Cys Ala Cys Cys Gly Gly Cys Ala Ala Gly Cys Thr Gly 2600
2605 2610Cys Cys Cys Gly Thr Gly Cys Cys Cys Thr
Gly Gly Cys Cys Cys 2615 2620 2625Ala
Cys Cys Cys Thr Cys Gly Thr Gly Ala Cys Cys Ala Cys Cys 2630
2635 2640Thr Thr Cys Gly Gly Cys Thr Ala Cys
Gly Gly Cys Cys Thr Gly 2645 2650
2655Cys Ala Gly Thr Gly Cys Thr Thr Cys Gly Cys Cys Cys Gly Cys
2660 2665 2670Thr Ala Cys Cys Cys Cys
Gly Ala Cys Cys Ala Cys Ala Thr Gly 2675 2680
2685Ala Ala Gly Cys Ala Gly Cys Ala Cys Gly Ala Cys Thr Thr
Cys 2690 2695 2700Thr Thr Cys Ala Ala
Gly Thr Cys Cys Gly Cys Cys Ala Thr Gly 2705 2710
2715Cys Cys Cys Gly Ala Ala Gly Gly Cys Thr Ala Cys Gly
Thr Cys 2720 2725 2730Cys Ala Gly Gly
Ala Gly Cys Gly Cys Ala Cys Cys Ala Thr Cys 2735
2740 2745Thr Thr Cys Thr Thr Cys Ala Ala Gly Gly Ala
Cys Gly Ala Cys 2750 2755 2760Gly Gly
Cys Ala Ala Cys Thr Ala Cys Ala Ala Gly Ala Cys Cys 2765
2770 2775Cys Gly Cys Gly Cys Cys Gly Ala Gly Gly
Thr Gly Ala Ala Gly 2780 2785 2790Thr
Thr Cys Gly Ala Gly Gly Gly Cys Gly Ala Cys Ala Cys Cys 2795
2800 2805Cys Thr Gly Gly Thr Gly Ala Ala Cys
Cys Gly Cys Ala Thr Cys 2810 2815
2820Gly Ala Gly Cys Thr Gly Ala Ala Gly Gly Gly Cys Ala Thr Cys
2825 2830 2835Gly Ala Cys Thr Thr Cys
Ala Gly Gly Gly Ala Gly Gly Ala Cys 2840 2845
2850Gly Gly Cys Ala Ala Cys Ala Thr Cys Cys Thr Gly Gly Gly
Gly 2855 2860 2865Cys Ala Cys Ala Ala
Gly Cys Thr Gly Gly Ala Gly Thr Ala Cys 2870 2875
2880Ala Ala Cys Thr Ala Cys Ala Ala Cys Ala Gly Cys Cys
Ala Cys 2885 2890 2895Ala Ala Cys Gly
Thr Cys Thr Ala Thr Ala Thr Cys Ala Thr Gly 2900
2905 2910Gly Cys Cys Gly Ala Cys Ala Ala Gly Cys Ala
Gly Ala Ala Gly 2915 2920 2925Ala Ala
Cys Gly Gly Cys Ala Thr Cys Ala Ala Gly Gly Thr Gly 2930
2935 2940Ala Ala Cys Thr Thr Cys Ala Ala Gly Ala
Thr Cys Cys Gly Cys 2945 2950 2955Cys
Ala Cys Ala Ala Cys Ala Thr Cys Gly Ala Gly Gly Ala Cys 2960
2965 2970Gly Gly Cys Ala Gly Cys Gly Thr Gly
Cys Ala Gly Cys Thr Cys 2975 2980
2985Gly Cys Cys Gly Ala Cys Cys Ala Cys Thr Ala Cys Cys Ala Gly
2990 2995 3000Cys Ala Gly Ala Ala Cys
Ala Cys Cys Cys Cys Cys Ala Thr Cys 3005 3010
3015Gly Gly Cys Gly Ala Cys Gly Gly Cys Cys Cys Cys Gly Thr
Gly 3020 3025 3030Cys Thr Gly Cys Thr
Gly Cys Cys Cys Gly Ala Cys Ala Ala Cys 3035 3040
3045Cys Ala Cys Thr Ala Cys Cys Thr Gly Ala Gly Cys Thr
Ala Cys 3050 3055 3060Cys Ala Gly Thr
Cys Cys Gly Cys Cys Cys Thr Gly Ala Gly Cys 3065
3070 3075Ala Ala Ala Gly Ala Cys Cys Cys Cys Ala Ala
Cys Gly Ala Gly 3080 3085 3090Ala Ala
Gly Cys Gly Cys Gly Ala Thr Cys Ala Cys Ala Thr Gly 3095
3100 3105Gly Thr Cys Cys Thr Gly Cys Thr Gly Gly
Ala Gly Thr Thr Cys 3110 3115 3120Gly
Thr Gly Ala Cys Cys Gly Cys Cys Gly Cys Cys Gly Gly Gly 3125
3130 3135Ala Thr Cys Ala Cys Thr Cys Thr Cys
Gly Gly Cys Ala Thr Gly 3140 3145
3150Gly Ala Cys Gly Ala Gly Cys Thr Gly Thr Ala Cys Ala Ala Gly
3155 3160 3165Thr Ala Ala
3170363252PRTArtificial sequencesynthetic amino acid sequence 36Ala Thr
Gly Gly Ala Cys Cys Cys Cys Ala Thr Cys Gly Cys Thr Cys1 5
10 15Thr Gly Cys Ala Gly Gly Cys Thr
Gly Gly Thr Thr Ala Cys Gly Ala 20 25
30Cys Cys Thr Gly Cys Thr Gly Gly Gly Thr Gly Ala Cys Gly Gly
Cys 35 40 45Ala Gly Ala Cys Cys
Thr Gly Ala Ala Ala Cys Thr Cys Thr Gly Thr 50 55
60Gly Gly Cys Thr Gly Gly Gly Cys Ala Thr Cys Gly Gly Cys
Ala Cys65 70 75 80Thr
Cys Thr Gly Cys Thr Gly Ala Thr Gly Cys Thr Gly Ala Thr Thr
85 90 95Gly Gly Ala Ala Cys Cys Thr
Thr Cys Thr Ala Cys Thr Thr Thr Cys 100 105
110Thr Gly Gly Thr Cys Cys Gly Cys Gly Gly Ala Thr Gly Gly
Gly Gly 115 120 125Ala Gly Thr Cys
Ala Cys Cys Gly Ala Thr Ala Ala Gly Gly Ala Thr 130
135 140Gly Cys Cys Cys Gly Gly Gly Ala Ala Thr Ala Thr
Thr Ala Cys Gly145 150 155
160Cys Thr Gly Thr Gly Ala Cys Thr Ala Thr Cys Cys Thr Gly Gly Thr
165 170 175Gly Cys Cys Cys Gly
Gly Ala Ala Thr Cys Gly Cys Ala Thr Cys Cys 180
185 190Gly Cys Cys Gly Cys Ala Thr Ala Thr Cys Thr Gly
Thr Cys Thr Ala 195 200 205Thr Gly
Thr Thr Cys Thr Thr Thr Gly Gly Thr Ala Thr Cys Gly Gly 210
215 220Gly Cys Thr Thr Ala Cys Thr Gly Ala Gly Gly
Thr Gly Ala Cys Cys225 230 235
240Gly Thr Cys Gly Gly Gly Gly Gly Cys Gly Ala Ala Ala Thr Gly Thr
245 250 255Thr Gly Gly Ala
Thr Ala Thr Cys Thr Ala Thr Thr Ala Thr Gly Cys 260
265 270Cys Ala Gly Gly Thr Ala Cys Gly Cys Cys Gly
Ala Cys Thr Gly Gly 275 280 285Cys
Thr Gly Thr Thr Thr Ala Cys Cys Ala Cys Cys Cys Cys Ala Cys 290
295 300Thr Thr Cys Thr Gly Cys Thr Gly Cys Thr
Gly Gly Ala Thr Cys Thr305 310 315
320Gly Gly Cys Cys Cys Thr Thr Cys Thr Cys Gly Cys Thr Ala Ala
Gly 325 330 335Gly Thr Gly
Gly Ala Thr Cys Gly Gly Gly Thr Gly Ala Cys Cys Ala 340
345 350Thr Cys Gly Gly Cys Ala Cys Cys Cys Thr
Gly Gly Thr Gly Gly Gly 355 360
365Thr Gly Thr Gly Gly Ala Cys Gly Cys Cys Cys Thr Gly Ala Thr Gly 370
375 380Ala Thr Cys Gly Thr Cys Ala Cys
Thr Gly Gly Cys Cys Thr Cys Ala385 390
395 400Thr Cys Gly Gly Ala Gly Cys Cys Thr Thr Gly Ala
Gly Cys Cys Ala 405 410
415Cys Ala Cys Gly Gly Cys Cys Ala Thr Ala Gly Cys Cys Ala Gly Ala
420 425 430Thr Ala Cys Ala Gly Thr
Thr Gly Gly Thr Gly Gly Thr Thr Gly Thr 435 440
445Thr Cys Thr Cys Thr Ala Cys Ala Ala Thr Thr Thr Gly Cys
Ala Thr 450 455 460Gly Ala Thr Ala Gly
Thr Gly Gly Thr Gly Cys Thr Cys Thr Ala Thr465 470
475 480Thr Thr Thr Cys Thr Gly Gly Cys Thr Ala
Cys Ala Thr Cys Cys Cys 485 490
495Thr Gly Cys Gly Ala Thr Cys Thr Gly Cys Thr Gly Cys Ala Ala Ala
500 505 510Gly Gly Ala Gly Cys
Gly Gly Gly Gly Cys Cys Cys Cys Gly Ala Gly 515
520 525Gly Thr Gly Gly Cys Ala Thr Cys Thr Ala Cys Cys
Thr Thr Thr Ala 530 535 540Ala Cys Ala
Cys Cys Cys Thr Gly Ala Cys Ala Gly Cys Thr Cys Thr545
550 555 560Gly Gly Thr Cys Thr Thr Gly
Gly Thr Gly Cys Thr Gly Thr Gly Gly 565
570 575Ala Cys Cys Gly Cys Thr Thr Ala Cys Cys Cys Thr
Ala Thr Cys Cys 580 585 590Thr
Gly Thr Gly Gly Ala Thr Cys Ala Thr Ala Gly Gly Cys Ala Cys 595
600 605Thr Gly Ala Gly Gly Gly Cys Gly Cys
Thr Gly Gly Cys Gly Thr Gly 610 615
620Gly Thr Gly Gly Gly Cys Cys Thr Gly Gly Gly Cys Ala Thr Cys Gly625
630 635 640Ala Ala Ala Cys
Thr Cys Thr Gly Cys Thr Gly Thr Thr Thr Ala Thr 645
650 655Gly Gly Thr Gly Thr Thr Gly Gly Ala Cys
Gly Thr Gly Ala Cys Thr 660 665
670Gly Cys Cys Ala Ala Gly Gly Thr Cys Gly Gly Cys Thr Thr Thr Gly
675 680 685Gly Cys Thr Thr Thr Ala Thr
Cys Cys Thr Gly Thr Thr Gly Ala Gly 690 695
700Ala Thr Cys Cys Cys Gly Gly Gly Cys Thr Ala Thr Thr Cys Thr
Gly705 710 715 720Gly Gly
Cys Gly Ala Cys Ala Cys Cys Gly Ala Gly Gly Cys Ala Cys
725 730 735Cys Ala Gly Ala Ala Cys Cys
Cys Ala Gly Thr Gly Cys Cys Gly Gly 740 745
750Thr Gly Cys Cys Gly Ala Thr Gly Thr Cys Ala Gly Thr Gly
Cys Cys 755 760 765Gly Cys Cys Gly
Ala Cys Ala Ala Gly Ala Gly Cys Ala Gly Gly Ala 770
775 780Thr Cys Ala Cys Cys Ala Gly Cys Gly Ala Gly Gly
Gly Cys Gly Ala785 790 795
800Gly Thr Ala Cys Ala Thr Cys Cys Cys Cys Cys Thr Gly Gly Ala Cys
805 810 815Cys Ala Gly Ala Thr
Cys Gly Ala Cys Ala Thr Cys Ala Ala Cys Gly 820
825 830Thr Gly Gly Gly Cys Gly Cys Gly Cys Cys Cys Gly
Gly Cys Thr Cys 835 840 845Cys Gly
Gly Ala Gly Cys Cys Ala Cys Gly Ala Ala Cys Thr Thr Cys 850
855 860Thr Cys Thr Cys Thr Gly Thr Thr Ala Ala Ala
Gly Cys Ala Ala Gly865 870 875
880Cys Ala Gly Gly Ala Gly Ala Cys Gly Thr Gly Gly Ala Ala Gly Ala
885 890 895Ala Ala Ala Cys
Cys Cys Cys Gly Gly Thr Cys Cys Cys Ala Thr Gly 900
905 910Gly Ala Cys Cys Thr Gly Ala Ala Gly Gly Ala
Gly Thr Cys Ala Cys 915 920 925Cys
Ala Ala Gly Cys Gly Ala Gly Gly Gly Ala Thr Cys Ala Cys Thr 930
935 940Gly Cys Ala Gly Cys Cys Ala Thr Cys Ala
Ala Gly Cys Ala Thr Thr945 950 955
960Cys Ala Gly Ala Thr Thr Thr Thr Cys Gly Cys Thr Ala Ala Thr
Ala 965 970 975Cys Ala Ala
Gly Cys Ala Cys Ala Cys Thr Gly Cys Ala Cys Gly Gly 980
985 990Cys Ala Thr Cys Cys Gly Gly Cys Ala Thr
Ala Thr Cys Thr Thr Cys 995 1000
1005Gly Thr Gly Thr Ala Cys Gly Gly Cys Cys Cys Ala Cys Thr Gly
1010 1015 1020Ala Cys Cys Ala Thr Thr
Cys Gly Gly Ala Gly Ala Gly Thr Cys 1025 1030
1035Cys Thr Gly Thr Gly Gly Gly Cys Ala Gly Thr Gly Gly Cys
Cys 1040 1045 1050Thr Thr Thr Gly Thr
Cys Gly Gly Ala Ala Gly Cys Cys Thr Gly 1055 1060
1065Gly Gly Ala Cys Thr Gly Cys Thr Gly Cys Thr Gly Gly
Thr Gly 1070 1075 1080Gly Ala Gly Ala
Gly Cys Thr Cys Cys Gly Ala Ala Ala Gly Ala 1085
1090 1095Gly Thr Cys Ala Gly Thr Thr Ala Cys Thr Ala
Thr Thr Thr Cys 1100 1105 1110Thr Cys
Ala Thr Ala Thr Cys Ala Gly Cys Ala Cys Gly Thr Gly 1115
1120 1125Ala Cys Thr Ala Ala Gly Gly Thr Gly Gly
Ala Cys Gly Ala Gly 1130 1135 1140Gly
Thr Gly Gly Thr Cys Gly Cys Thr Cys Ala Gly Thr Cys Cys 1145
1150 1155Cys Thr Gly Gly Thr Gly Thr Thr Thr
Cys Cys Cys Gly Cys Ala 1160 1165
1170Gly Thr Cys Ala Cys Cys Cys Thr Gly Thr Gly Cys Ala Ala Cys
1175 1180 1185Cys Thr Gly Ala Ala Thr
Gly Gly Gly Thr Thr Cys Ala Gly Gly 1190 1195
1200Thr Thr Thr Thr Cys Thr Cys Gly Cys Cys Thr Gly Ala Cys
Cys 1205 1210 1215Ala Cys Ala Ala Ala
Cys Gly Ala Cys Cys Thr Gly Thr Ala Cys 1220 1225
1230Cys Ala Cys Gly Cys Cys Gly Gly Ala Gly Ala Gly Cys
Thr Gly 1235 1240 1245Cys Thr Gly Gly
Cys Thr Cys Thr Gly Cys Thr Gly Gly Ala Thr 1250
1255 1260Gly Thr Gly Ala Ala Thr Cys Thr Gly Cys Ala
Gly Ala Thr Cys 1265 1270 1275Cys Cys
Ala Gly Ala Cys Cys Cys Cys Cys Ala Thr Cys Thr Gly 1280
1285 1290Gly Cys Cys Gly Ala Thr Cys Cys Ala Ala
Cys Cys Gly Thr Gly 1295 1300 1305Cys
Thr Gly Gly Ala Ala Gly Cys Ala Cys Thr Gly Ala Gly Gly 1310
1315 1320Cys Ala Gly Ala Ala Gly Gly Cys Cys
Ala Ala Cys Thr Thr Cys 1325 1330
1335Ala Ala Ala Cys Ala Cys Thr Ala Cys Ala Ala Gly Cys Cys Cys
1340 1345 1350Ala Ala Ala Cys Ala Gly
Thr Thr Cys Ala Gly Cys Ala Thr Gly 1355 1360
1365Cys Thr Gly Gly Ala Gly Thr Thr Thr Cys Thr Gly Cys Ala
Cys 1370 1375 1380Cys Gly Cys Gly Thr
Gly Gly Gly Ala Cys Ala Thr Gly Ala Cys 1385 1390
1395Cys Thr Gly Ala Ala Ala Gly Ala Thr Ala Thr Gly Ala
Thr Gly 1400 1405 1410Cys Thr Gly Thr
Ala Thr Thr Gly Cys Ala Ala Gly Thr Thr Cys 1415
1420 1425Ala Ala Ala Gly Gly Cys Cys Ala Gly Gly Ala
Gly Thr Gly Thr 1430 1435 1440Gly Gly
Gly Cys Ala Thr Cys Ala Gly Gly Ala Cys Thr Thr Cys 1445
1450 1455Ala Cys Thr Ala Cys Cys Gly Thr Gly Thr
Thr Thr Ala Cys Ala 1460 1465 1470Ala
Ala Gly Thr Ala Cys Gly Gly Cys Ala Ala Ala Thr Gly Thr 1475
1480 1485Thr Ala Cys Ala Thr Gly Thr Thr Cys
Ala Ala Cys Thr Cys Cys 1490 1495
1500Gly Gly Gly Gly Ala Ala Gly Ala Thr Gly Gly Ala Ala Ala Ala
1505 1510 1515Cys Cys Thr Cys Thr Gly
Cys Thr Gly Ala Cys Ala Ala Cys Thr 1520 1525
1530Gly Thr Gly Ala Ala Gly Gly Gly Cys Gly Gly Gly Ala Cys
Ala 1535 1540 1545Gly Gly Gly Ala Ala
Thr Gly Gly Ala Cys Thr Gly Gly Ala Gly 1550 1555
1560Ala Thr Cys Ala Thr Gly Cys Thr Gly Gly Ala Cys Ala
Thr Thr 1565 1570 1575Cys Ala Gly Cys
Ala Gly Gly Ala Thr Gly Ala Gly Thr Ala Cys 1580
1585 1590Cys Thr Gly Cys Cys Ala Ala Thr Cys Thr Gly
Gly Gly Gly Ala 1595 1600 1605Gly Ala
Ala Ala Cys Thr Gly Ala Gly Gly Ala Ala Ala Cys Cys 1610
1615 1620Ala Cys Ala Thr Thr Cys Gly Ala Gly Gly
Cys Cys Gly Gly Cys 1625 1630 1635Gly
Thr Gly Ala Ala Gly Gly Thr Cys Cys Ala Gly Ala Thr Cys 1640
1645 1650Cys Ala Cys Thr Cys Ala Cys Ala Gly
Ala Gly Cys Gly Ala Gly 1655 1660
1665Cys Cys Cys Cys Cys Thr Thr Thr Cys Ala Thr Thr Cys Ala Gly
1670 1675 1680Gly Ala Ala Cys Thr Gly
Gly Gly Ala Thr Thr Thr Gly Gly Ala 1685 1690
1695Gly Thr Gly Gly Cys Ala Cys Cys Ala Gly Gly Ala Thr Thr
Cys 1700 1705 1710Cys Ala Gly Ala Cys
Ala Thr Thr Thr Gly Thr Cys Gly Cys Thr 1715 1720
1725Ala Cys Thr Cys Ala Gly Gly Ala Gly Cys Ala Gly Cys
Gly Cys 1730 1735 1740Cys Thr Gly Ala
Cys Cys Thr Ala Thr Cys Thr Gly Cys Cys Ala 1745
1750 1755Cys Cys Cys Cys Cys Thr Thr Gly Gly Gly Gly
Cys Gly Ala Gly 1760 1765 1770Thr Gly
Cys Cys Gly Ala Thr Cys Thr Ala Gly Thr Gly Ala Ala 1775
1780 1785Ala Thr Gly Gly Gly Gly Cys Thr Gly Gly
Ala Cys Thr Thr Cys 1790 1795 1800Thr
Thr Thr Cys Cys Thr Gly Thr Gly Thr Ala Cys Thr Cys Thr 1805
1810 1815Ala Thr Cys Ala Cys Cys Gly Cys Cys
Thr Gly Cys Cys Gly Ala 1820 1825
1830Ala Thr Thr Gly Ala Thr Thr Gly Thr Gly Ala Gly Ala Cys Ala
1835 1840 1845Cys Gly Gly Thr Ala Thr
Ala Thr Cys Gly Thr Gly Gly Ala Ala 1850 1855
1860Ala Ala Cys Thr Gly Cys Ala Ala Thr Thr Gly Thr Ala Gly
Gly 1865 1870 1875Ala Thr Gly Gly Thr
Cys Cys Ala Cys Ala Thr Gly Cys Cys Thr 1880 1885
1890Gly Gly Cys Gly Ala Cys Gly Cys Cys Cys Cys Ala Thr
Thr Cys 1895 1900 1905Thr Gly Cys Ala
Cys Thr Cys Cys Cys Gly Ala Ala Cys Ala Gly 1910
1915 1920Cys Ala Thr Ala Ala Ala Gly Ala Gly Thr Gly
Thr Gly Cys Thr 1925 1930 1935Gly Ala
Ala Cys Cys Thr Gly Cys Ala Cys Thr Gly Gly Gly Gly 1940
1945 1950Cys Thr Gly Cys Thr Gly Gly Cys Thr Gly
Ala Gly Ala Ala Gly 1955 1960 1965Gly
Ala Thr Ala Gly Thr Ala Ala Cys Thr Ala Cys Thr Gly Cys 1970
1975 1980Cys Thr Gly Thr Gly Thr Ala Gly Ala
Ala Cys Ala Cys Cys Cys 1985 1990
1995Thr Gly Thr Ala Ala Cys Cys Thr Gly Ala Cys Thr Ala Gly Gly
2000 2005 2010Thr Ala Thr Ala Ala Thr
Ala Ala Gly Gly Ala Ala Cys Thr Gly 2015 2020
2025Ala Gly Cys Ala Thr Gly Gly Thr Gly Ala Ala Gly Ala Thr
Cys 2030 2035 2040Cys Cys Thr Thr Cys
Cys Ala Ala Ala Ala Cys Ala Thr Cys Thr 2045 2050
2055Gly Cys Ala Ala Ala Gly Thr Ala Cys Cys Thr Gly Gly
Ala Gly 2060 2065 2070Ala Ala Gly Ala
Ala Gly Thr Thr Cys Ala Ala Cys Ala Ala Gly 2075
2080 2085Thr Cys Thr Gly Ala Gly Ala Ala Gly Thr Ala
Cys Ala Thr Cys 2090 2095 2100Ala Gly
Thr Gly Ala Ala Ala Ala Cys Ala Thr Thr Cys Thr Gly 2105
2110 2115Gly Thr Gly Cys Thr Gly Gly Ala Cys Ala
Thr Cys Thr Thr Cys 2120 2125 2130Thr
Thr Thr Gly Ala Ala Gly Cys Thr Cys Thr Gly Ala Ala Thr 2135
2140 2145Thr Ala Cys Gly Ala Gly Ala Cys Cys
Ala Thr Thr Gly Ala Ala 2150 2155
2160Cys Ala Gly Ala Ala Gly Ala Ala Ala Gly Cys Ala Thr Ala Thr
2165 2170 2175Gly Ala Gly Gly Thr Gly
Gly Cys Cys Gly Cys Thr Cys Thr Gly 2180 2185
2190Cys Thr Gly Gly Gly Gly Gly Ala Thr Ala Thr Thr Gly Gly
Ala 2195 2200 2205Gly Gly Cys Cys Ala
Gly Ala Thr Gly Gly Gly Ala Cys Thr Gly 2210 2215
2220Thr Thr Cys Ala Thr Cys Gly Gly Cys Gly Cys Cys Ala
Gly Cys 2225 2230 2235Cys Thr Gly Cys
Thr Gly Ala Cys Ala Ala Thr Thr Cys Thr Gly 2240
2245 2250Gly Ala Gly Cys Thr Gly Thr Thr Thr Gly Ala
Cys Thr Ala Cys 2255 2260 2265Ala Thr
Cys Thr Ala Thr Gly Ala Gly Cys Thr Gly Ala Thr Thr 2270
2275 2280Ala Ala Gly Gly Ala Ala Ala Ala Ala Cys
Thr Gly Cys Thr Gly 2285 2290 2295Gly
Ala Thr Cys Thr Gly Cys Thr Gly Gly Gly Gly Ala Ala Gly 2300
2305 2310Gly Ala Gly Gly Ala Ala Gly Ala Gly
Gly Ala Ala Gly Gly Ala 2315 2320
2325Thr Cys Ala Cys Ala Cys Gly Ala Cys Gly Ala Ala Ala Ala Cys
2330 2335 2340Ala Thr Gly Ala Gly Cys
Ala Cys Thr Thr Gly Cys Gly Ala Thr 2345 2350
2355Ala Cys Cys Ala Thr Gly Cys Cys Thr Ala Ala Thr Cys Ala
Cys 2360 2365 2370Ala Gly Cys Gly Ala
Gly Ala Cys Cys Ala Thr Cys Thr Cys Cys 2375 2380
2385Cys Ala Thr Ala Cys Ala Gly Thr Gly Ala Ala Thr Gly
Thr Cys 2390 2395 2400Cys Cys Ala Cys
Thr Gly Cys Ala Gly Ala Cys Thr Gly Cys Ala 2405
2410 2415Cys Thr Gly Gly Gly Cys Ala Cys Cys Cys Thr
Gly Gly Ala Gly 2420 2425 2430Gly Ala
Ala Ala Thr Thr Gly Cys Cys Thr Gly Thr Gly Cys Gly 2435
2440 2445Gly Cys Cys Gly Cys Cys Ala Ala Gly Ala
Gly Cys Ala Gly Gly 2450 2455 2460Ala
Thr Cys Ala Cys Cys Ala Gly Cys Gly Ala Gly Gly Gly Cys 2465
2470 2475Gly Ala Gly Thr Ala Cys Ala Thr Cys
Cys Cys Cys Cys Thr Gly 2480 2485
2490Gly Ala Cys Cys Ala Gly Ala Thr Cys Gly Ala Cys Ala Thr Cys
2495 2500 2505Ala Ala Cys Gly Thr Gly
Gly Thr Gly Ala Gly Cys Ala Ala Gly 2510 2515
2520Gly Gly Cys Gly Ala Gly Gly Ala Gly Cys Thr Gly Thr Thr
Cys 2525 2530 2535Ala Cys Cys Gly Gly
Gly Gly Thr Gly Gly Thr Gly Cys Cys Cys 2540 2545
2550Ala Thr Cys Cys Thr Gly Gly Thr Cys Gly Ala Gly Cys
Thr Gly 2555 2560 2565Gly Ala Cys Gly
Gly Cys Gly Ala Cys Gly Thr Ala Ala Ala Cys 2570
2575 2580Gly Gly Cys Cys Ala Cys Ala Ala Gly Thr Thr
Cys Ala Gly Cys 2585 2590 2595Gly Thr
Gly Thr Cys Cys Gly Gly Cys Gly Ala Gly Gly Gly Cys 2600
2605 2610Gly Ala Gly Gly Gly Cys Gly Ala Thr Gly
Cys Cys Ala Cys Cys 2615 2620 2625Thr
Ala Cys Gly Gly Cys Ala Ala Gly Cys Thr Gly Ala Cys Cys 2630
2635 2640Cys Thr Gly Ala Ala Gly Thr Thr Cys
Ala Thr Cys Thr Gly Cys 2645 2650
2655Ala Cys Cys Ala Cys Cys Gly Gly Cys Ala Ala Gly Cys Thr Gly
2660 2665 2670Cys Cys Cys Gly Thr Gly
Cys Cys Cys Thr Gly Gly Cys Cys Cys 2675 2680
2685Ala Cys Cys Cys Thr Cys Gly Thr Gly Ala Cys Cys Ala Cys
Cys 2690 2695 2700Thr Thr Cys Gly Gly
Cys Thr Ala Cys Gly Gly Cys Cys Thr Gly 2705 2710
2715Cys Ala Gly Thr Gly Cys Thr Thr Cys Gly Cys Cys Cys
Gly Cys 2720 2725 2730Thr Ala Cys Cys
Cys Cys Gly Ala Cys Cys Ala Cys Ala Thr Gly 2735
2740 2745Ala Ala Gly Cys Ala Gly Cys Ala Cys Gly Ala
Cys Thr Thr Cys 2750 2755 2760Thr Thr
Cys Ala Ala Gly Thr Cys Cys Gly Cys Cys Ala Thr Gly 2765
2770 2775Cys Cys Cys Gly Ala Ala Gly Gly Cys Thr
Ala Cys Gly Thr Cys 2780 2785 2790Cys
Ala Gly Gly Ala Gly Cys Gly Cys Ala Cys Cys Ala Thr Cys 2795
2800 2805Thr Thr Cys Thr Thr Cys Ala Ala Gly
Gly Ala Cys Gly Ala Cys 2810 2815
2820Gly Gly Cys Ala Ala Cys Thr Ala Cys Ala Ala Gly Ala Cys Cys
2825 2830 2835Cys Gly Cys Gly Cys Cys
Gly Ala Gly Gly Thr Gly Ala Ala Gly 2840 2845
2850Thr Thr Cys Gly Ala Gly Gly Gly Cys Gly Ala Cys Ala Cys
Cys 2855 2860 2865Cys Thr Gly Gly Thr
Gly Ala Ala Cys Cys Gly Cys Ala Thr Cys 2870 2875
2880Gly Ala Gly Cys Thr Gly Ala Ala Gly Gly Gly Cys Ala
Thr Cys 2885 2890 2895Gly Ala Cys Thr
Thr Cys Ala Gly Gly Gly Ala Gly Gly Ala Cys 2900
2905 2910Gly Gly Cys Ala Ala Cys Ala Thr Cys Cys Thr
Gly Gly Gly Gly 2915 2920 2925Cys Ala
Cys Ala Ala Gly Cys Thr Gly Gly Ala Gly Thr Ala Cys 2930
2935 2940Ala Ala Cys Thr Ala Cys Ala Ala Cys Ala
Gly Cys Cys Ala Cys 2945 2950 2955Ala
Ala Cys Gly Thr Cys Thr Ala Thr Ala Thr Cys Ala Thr Gly 2960
2965 2970Gly Cys Cys Gly Ala Cys Ala Ala Gly
Cys Ala Gly Ala Ala Gly 2975 2980
2985Ala Ala Cys Gly Gly Cys Ala Thr Cys Ala Ala Gly Gly Thr Gly
2990 2995 3000Ala Ala Cys Thr Thr Cys
Ala Ala Gly Ala Thr Cys Cys Gly Cys 3005 3010
3015Cys Ala Cys Ala Ala Cys Ala Thr Cys Gly Ala Gly Gly Ala
Cys 3020 3025 3030Gly Gly Cys Ala Gly
Cys Gly Thr Gly Cys Ala Gly Cys Thr Cys 3035 3040
3045Gly Cys Cys Gly Ala Cys Cys Ala Cys Thr Ala Cys Cys
Ala Gly 3050 3055 3060Cys Ala Gly Ala
Ala Cys Ala Cys Cys Cys Cys Cys Ala Thr Cys 3065
3070 3075Gly Gly Cys Gly Ala Cys Gly Gly Cys Cys Cys
Cys Gly Thr Gly 3080 3085 3090Cys Thr
Gly Cys Thr Gly Cys Cys Cys Gly Ala Cys Ala Ala Cys 3095
3100 3105Cys Ala Cys Thr Ala Cys Cys Thr Gly Ala
Gly Cys Thr Ala Cys 3110 3115 3120Cys
Ala Gly Thr Cys Cys Gly Cys Cys Cys Thr Gly Ala Gly Cys 3125
3130 3135Ala Ala Ala Gly Ala Cys Cys Cys Cys
Ala Ala Cys Gly Ala Gly 3140 3145
3150Ala Ala Gly Cys Gly Cys Gly Ala Thr Cys Ala Cys Ala Thr Gly
3155 3160 3165Gly Thr Cys Cys Thr Gly
Cys Thr Gly Gly Ala Gly Thr Thr Cys 3170 3175
3180Gly Thr Gly Ala Cys Cys Gly Cys Cys Gly Cys Cys Gly Gly
Gly 3185 3190 3195Ala Thr Cys Ala Cys
Thr Cys Thr Cys Gly Gly Cys Ala Thr Gly 3200 3205
3210Gly Ala Cys Gly Ala Gly Cys Thr Gly Thr Ala Cys Ala
Ala Gly 3215 3220 3225Thr Thr Cys Thr
Gly Cys Thr Ala Cys Gly Ala Gly Ala Ala Cys 3230
3235 3240Gly Ala Gly Gly Thr Gly Thr Ala Ala 3245
32503720PRTHomo sapiens 37Lys Ser Arg Ile Thr Ser Glu Gly
Glu Tyr Ile Pro Leu Asp Gln Ile1 5 10
15Asp Ile Asn Val 203826PRTHomo sapiens 38Met Asp
Tyr Gly Gly Ala Leu Ser Ala Val Gly Arg Glu Leu Leu Phe1 5
10 15Val Thr Asn Pro Val Val Val Asn
Gly Ser 20 253927PRTHomo sapiens 39Met Ala
Gly His Ser Asn Ser Met Ala Leu Phe Ser Phe Ser Leu Leu1 5
10 15Trp Leu Cys Ser Gly Val Leu Gly
Thr Glu Phe 20 254023PRTHomo sapiens 40Met
Gly Leu Arg Ala Leu Met Leu Trp Leu Leu Ala Ala Ala Gly Leu1
5 10 15Val Arg Glu Ser Leu Gln Gly
204118PRTHomo sapiens 41Met Arg Gly Thr Pro Leu Leu Leu Val Val
Ser Leu Phe Ser Leu Leu1 5 10
15Gln Asp425PRTArtificial sequencesynthetic amino acid
sequenceMISC_FEATURE(2)..(3)X may be any amino acid 42Val Xaa Xaa Ser
Leu1 5435PRTArtificial sequencesynthetic amino acid
sequence 43Val Lys Glu Ser Leu1 5445PRTArtificial
sequencesynthetic amino acid sequence 44Val Leu Gly Ser Leu1
54516PRTArtificial sequencesynthetic amino acid sequence 45Asn Ala Asn
Ser Phe Cys Tyr Glu Asn Glu Val Ala Leu Thr Ser Lys1 5
10 15466PRTArtificial sequencesynthetic
amino acid sequenceMISC_FEATURE(2)..(2)X may be any amino acid 46Phe Xaa
Tyr Glu Asn Glu1 5477PRTArtificial sequencesynthetic amino
acid sequence 47Phe Cys Tyr Glu Asn Glu Val1
54818PRTArtificial sequencesynthetic amino acid sequence 48Met Thr Glu
Thr Leu Pro Pro Val Thr Glu Ser Ala Val Ala Leu Gln1 5
10 15Ala Glu4919PRTArtificial
sequencesynthetic amino acid sequence 49Ala Thr Asn Phe Ser Leu Leu Lys
Gln Ala Gly Asp Val Glu Glu Asn1 5 10
15Pro Gly Pro5018PRTArtificial sequencesynthetic amino acid
sequence 50Glu Gly Arg Gly Ser Leu Leu Thr Cys Gly Asp Val Glu Glu Asn
Pro1 5 10 15Gly
Pro5120PRTArtificial sequencesynthetic amino acid sequence 51Gln Cys Thr
Asn Tyr Ala Leu Leu Lys Leu Ala Gly Asp Val Glu Ser1 5
10 15Asn Pro Gly Pro
205222PRTArtificial sequencesynthetic amino acid sequence 52Val Lys Gln
Thr Leu Asn Phe Asp Leu Leu Lys Leu Ala Gly Asp Val1 5
10 15Glu Ser Asn Pro Gly Pro
20535PRTArtificial sequencesynthetic amino acid sequence 53Gly Ser Gly
Gly Ser1 5544PRTArtificial sequencesynthetic amino acid
sequence 54Gly Gly Gly Ser1554PRTArtificial sequencesynthetic amino acid
sequence 55Gly Gly Ser Gly1565PRTArtificial sequencesynthetic amino acid
sequence 56Gly Gly Ser Gly Gly1 5575PRTArtificial
sequencesynthetic amino acid sequence 57Gly Ser Gly Ser Gly1
5585PRTArtificial sequencesynthetic amino acid sequence 58Gly Ser Gly
Gly Gly1 5595PRTArtificial sequencesynthetic amino acid
sequence 59Gly Gly Gly Ser Gly1 5605PRTArtificial
sequencesynthetic amino acid sequence 60Gly Ser Ser Ser Gly1
56122PRTArtificial sequencesynthetic amino acid sequence 61Gly Ser Gly
Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val1 5
10 15Glu Glu Asn Pro Gly Pro
2062314PRTCoccomyxa subellipsoidea 62Met Ala Val His Gln Ile Gly Glu Gly
Gly Leu Val Met Tyr Trp Val1 5 10
15Thr Phe Gly Leu Met Ala Phe Ser Ala Leu Ala Phe Ala Val Met
Thr 20 25 30Phe Thr Arg Pro
Leu Asn Lys Arg Ser His Gly Tyr Ile Thr Leu Ala 35
40 45Ile Val Thr Ile Ala Ala Ile Ala Tyr Tyr Ala Met
Ala Ala Ser Gly 50 55 60Gly Lys Ala
Leu Val Ser Asn Pro Asp Gly Asn Leu Arg Asp Ile Tyr65 70
75 80Tyr Ala Arg Tyr Ile Asp Trp Phe
Phe Thr Thr Pro Leu Leu Leu Leu 85 90
95Asp Ile Ile Leu Leu Thr Gly Ile Pro Ile Gly Val Thr Leu
Trp Ile 100 105 110Val Leu Ala
Asp Val Ala Met Ile Met Leu Gly Leu Phe Gly Ala Leu 115
120 125Ser Thr Asn Ser Tyr Arg Trp Gly Tyr Tyr Gly
Val Ser Cys Ala Phe 130 135 140Phe Phe
Val Val Leu Trp Gly Leu Phe Phe Pro Gly Ala Lys Gly Ala145
150 155 160Arg Ala Arg Gly Gly Gln Val
Pro Gly Leu Tyr Phe Gly Leu Ala Gly 165
170 175Tyr Leu Ala Leu Leu Trp Phe Gly Tyr Pro Ile Val
Trp Gly Leu Ala 180 185 190Glu
Gly Ser Asp Tyr Ile Ser Val Thr Ala Glu Ala Ala Ser Tyr Ala 195
200 205Gly Leu Asp Ile Ala Ala Lys Val Val
Phe Gly Trp Ala Val Met Leu 210 215
220Ser His Pro Leu Ile Ala Arg Asn Gln Thr Asp Gly Ser Leu Leu Ile225
230 235 240Asn Ser Thr Asn
Asp Pro Phe Val Ala Ser Thr Thr His Ile Pro Glu 245
250 255Arg Gln Gly Gly Ile Phe Gly Gly Leu Met
Gly Lys Lys Arg Gly Ala 260 265
270Gly Thr Pro Leu Ala Thr Asn Glu Gly Val Pro Arg Lys Ala Ala Pro
275 280 285Thr Ala Ala Thr Thr Thr Ala
Gly Asn Pro Ala Thr Ala Ala Glu Val 290 295
300Arg Thr Pro Arg Glu Leu Met Ala Arg Leu305 310
User Contributions:
Comment about this patent or add new information about this topic: