Patent application title: PLANTS WITH IMPROVED AGRONOMIC TRAITS
Inventors:
IPC8 Class: AC12N1582FI
USPC Class:
1 1
Class name:
Publication date: 2017-06-29
Patent application number: 20170183671
Abstract:
Isolated polynucleotides and polypeptides and recombinant DNA constructs
useful for conferring drought tolerance, compositions (such as plants or
seeds) comprising these recombinant DNA constructs, and methods utilizing
these recombinant DNA constructs. The recombinant DNA construct comprises
a polynucleotide operably linked to a promoter that is functional in a
plant, wherein said polynucleotide encodes a PRE2 polypeptide.Claims:
1. A method of altering an agronomic parameter of a plant, the method
comprising downregulating the endogenous expression of a nucleotide
encoding a polypeptide, wherein the polypeptide comprises a conserved
domain selected from the group consisting of SEQ ID NOS: 27-48.
2. The method of claim 1, wherein the agronomic parameter is selected from the group consisting of greenness, yield, growth rate, biomass, plant nitrogen content, drought tolerance, nitrogen uptake, root lodging, harvest index, stalk lodging, plant height, ear height, ear width, ear length, ear area, salt tolerance, early seedling vigor and seedling emergence under low temperature stress, drought tolerance, increased nitrogen use efficiency, silk count, inducing early maturity, delaying maturity, days to shed and days to silk.
3. The method of claim 1, wherein the suppression of endogenous expression of the messenger RNA is by RNAi.
4. The method of claim 1, wherein the polypeptide comprises the amino acid sequence of SEQ ID NO: 3 or a sequence that is at least 90% identical to SEQ ID NO: 3.
5. A plant comprising in its genome a polynucleotide operably linked to at least one heterologous regulatory element, wherein said polynucleotide comprises a nucleotide sequence selected from the group consisting of: (a) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 90% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX "Gonnet Series"), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22 or a fragment thereof; (b) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement compared to a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; (c) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is derived from one or more SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (d) a nucleotide sequence encoding a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and (e) a nucleotide sequence comprising a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; and wherein said plant exhibits increased drought tolerance or improved nitrogen utilization when compared to a control plant not comprising said polynucleotide.
6. The plant of claim 5, wherein said plant exhibits said increase in yield when compared, under water limiting conditions, to said control plant not comprising said recombinant DNA construct.
7. The plant of any one of claim 5 wherein the plant is a monocot.
8. The plant of claim 5 wherein the plant is selected from the group consisting of: maize, soybean, sunflower, sorghum, canola, wheat, alfalfa, cotton, rice, barley, millet, sugarcane, switchgrass, tobacco, potato and sugar beet.
9. An isolated polynucleotide comprising a nucleotide sequence selected from the group consisting of: (a) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 90% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX "Gonnet Series"), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (b) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement of SEQ ID NO a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; (c) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26 a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (d) a nucleotide sequence encoding a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and (e) a nucleotide sequence comprising a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26 a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; wherein the polynucleotide is operably linked to a heterologous regulatory element.
10. The polynucleotide of claim 9, wherein the polypeptide of part (a) has an amino acid sequence of at least 80% sequence identity, based on the Clustal W method of alignment with the pairwise alignment default parameters, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22.
11. The polynucleotide of claim 9, wherein the polypeptide of part (a) has an amino acid sequence of at least 85% sequence identity, based on the Clustal W method of alignment with the pairwise alignment default parameters, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22.
12. The polynucleotide of claim 9, wherein the polypeptide of part (a) has an amino acid sequence of at least 90% sequence identity, based on the Clustal W method of alignment with the pairwise alignment default parameters, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22.
13. The polynucleotide of claim 9, wherein the polypeptide of part (a) has an amino acid sequence of at least 95% sequence identity, based on the Clustal W method of alignment with the pairwise alignment default parameters, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22.
14. A recombinant DNA construct comprising the isolated polynucleotide of claim 9 operably linked to at least one regulatory element.
15. A cell comprising the recombinant DNA construct of claim 14, wherein the cell is selected from the group consisting of a bacterial cell, a yeast cell, and insect cell and a plant cell.
16. A plant comprising the recombinant DNA construct of claim 14.
17. A seed comprising the recombinant DNA construct of claim 14.
18. Seed of the plant of claim 5.
19. The plant of claim 5, wherein the plant is maize and wherein the polypeptide comprises an amino acid sequence of SEQ ID NO: 3 or a sequence that is at least 95% identical to SEQ ID NO: 3, wherein the plant shows one or more improved agronomic parameters that contribute to drought tolerance or yield.
20. A maize plant cell derived from the plant of claim 19.
Description:
CROSS-REFERENCE
[0001] This continuation application is a continuation application of U.S. Ser. No. 13/819,619 filed Feb. 27, 2013, which is a 35 USC .sctn.371 National Stage application of PCT/US2012/44434 filed Jun. 27, 2012, which claims priority to U.S. Ser. No. 61/503,852 filed Jul. 1, 2011, all of which are incorporated herein by reference.
FIELD
[0002] The field of disclosure relates to plant breeding and genetics and, in particular, relates to recombinant DNA constructs useful in plants for conferring improved agronomic traits.
BACKGROUND
[0003] Improving agronomic traits in crop plants is beneficial to farmers. Several factors crop yield. Abiotic stress is the primary cause of crop loss worldwide, causing average yield losses of more than 50% for major crops. Among the various abiotic stresses, drought is a major factor that limits crop productivity worldwide. Exposure of plants to a water-limiting environment during various developmental stages appears to activate various physiological and developmental changes. Molecular mechanisms of abiotic stress responses and the genetic regulatory networks of drought stress tolerance have been studied.
[0004] Natural responses to abiotic stress vary among plant species and among varieties and cultivars within a plant species. Certain species, varieties or cultivars are more tolerant to abiotic stress such as drought than others. Transgenic approaches including overexpression and downregulation are evaluated for engineering drought tolerance in crop plants. Nitrogen utilization efficiency also affects crop yield, especially where the application of nitrogen fertilizer is limited.
SUMMARY
[0005] Methods and compositions to increase yield and stress tolerance in plants are disclosed. In an embodiment, reduced activity or expression of Pre2 gene results in increased tolerance to drought and improved nitrogen utilization.
[0006] A method of altering an agronomic trait or parameter of a plant, the method includes expressing a polynucleotide that down-regulates the endogenous expression of a messenger RNA encoding a polypeptide, wherein the polypeptide includes a conserved domain selected from the group consisting of SEQ ID NOS: 27-48. In an embodiment, the agronomic trait or parameter is selected from the group consisting of drought tolerance, increased nitrogen use efficiency, and increased yield. In an embodiment, the suppression of endogenous expression of the messenger RNA is by RNAi.
[0007] In an embodiment, the expression of the endogenous Pre2 gene or production of its protein is reduced by anti-sense expression, co-suppression, dsRNA, ribozymes, microRNA, genome editing, targeted promoter inactivation, site-directed mutagenesis and knock-outs.
[0008] In an embodiment, a plant comprising in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence selected from the group consisting of: (a) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 60%, 80%, 85%, 90%, 95% or 100% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX "Gonnet Series"), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (b) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement to a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; (c) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is derived from a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26 by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (d) a nucleotide sequence encoding a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and (e) a nucleotide sequence comprising a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; and wherein said plant exhibits increased drought tolerance when compared to a control plant not comprising said recombinant DNA construct. The plant may be a monocot or dicot.
[0009] In another embodiment, a plant comprising in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence selected from the group consisting of: (a) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 60%, 80%, 85%, 90%, 95% or 100% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX "Gonnet Series"), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (b) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement to a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; (c) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is derived from a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26 by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (d) a nucleotide sequence encoding a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and (e) a nucleotide sequence comprising a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; and wherein said plant exhibits an increase in yield when compared to a control plant not comprising said recombinant DNA construct. The plant may exhibit said increase in yield when compared, under water limiting conditions, to said control plant not comprising said recombinant DNA construct. The plant may be a monocot or dicot.
[0010] In another embodiment, a method of increasing drought tolerance in a plant, comprising: (a) introducing into a regenerable plant cell a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence selected from the group consisting of: (i) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 60%, 80%, 85%, 90%, 95% or 100% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX "Gonnet Series"), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (ii) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement to a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; (iii) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26 by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (iv) a nucleotide sequence encoding a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and (v) a nucleotide sequence comprising a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; and (b) regenerating a transgenic plant from the regenerable plant cell after step (a), wherein the transgenic plant comprises in its genome the recombinant DNA construct and exhibits increased drought tolerance when compared to a control plant not comprising the recombinant DNA construct. The method may further comprise: (c) obtaining a progeny plant derived from the transgenic plant, wherein said progeny plant comprises in its genome the recombinant DNA construct and exhibits increased drought tolerance when compared to a control plant not comprising the recombinant DNA construct.
[0011] In another embodiment, a method of evaluating drought tolerance in a plant, comprising: (a) obtaining a transgenic plant, wherein the transgenic plant comprises in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence selected from the group consisting of: (i) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 60%, 80%, 85%, 90%, 95% or 100% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX "Gonnet Series"), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (ii) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; (iii) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26 by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (iv) a nucleotide sequence encoding a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and (v) a nucleotide sequence comprising a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; and (b) obtaining a progeny plant derived from the transgenic plant of (a), wherein the progeny plant comprises in its genome the recombinant DNA construct; and (c) evaluating the progeny plant for drought tolerance compared to a control plant not comprising the recombinant DNA construct.
[0012] In another embodiment, a method of determining an alteration of an agronomic characteristic in a plant, comprising: (a) obtaining a transgenic plant, wherein the transgenic plant comprises in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence selected from the group consisting of: (i) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 60%, 80%, 85%, 90%, 95% or 100% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX "Gonnet Series"), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (ii) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; (iii) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26 by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (iv) a nucleotide sequence encoding a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and (v) a nucleotide sequence comprising a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; and (b) obtaining a progeny plant derived from the transgenic plant of step (a), wherein the progeny plant comprises in its genome the recombinant DNA construct; and (c) determining whether the progeny plant exhibits an alteration of at least one agronomic characteristic when compared to a control plant not comprising the recombinant DNA construct. Said determining step (c) may comprise determining whether the transgenic plant exhibits an alteration of at least one agronomic characteristic when compared, under water limiting conditions, to a control plant not comprising the recombinant DNA construct. Said at least one agronomic trait may be yield and furthermore may be an increase in yield.
[0013] In another embodiment, an isolated polynucleotide comprising a nucleotide sequence selected from the group consisting of: (a) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 60%, 80%, 85%, 90% or 95% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX "Gonnet Series"), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; b) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; (c) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26 by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (d) a nucleotide sequence encoding a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and (e) a a nucleotide sequence comprising a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26.
[0014] In another embodiment, an isolated polynucleotide comprising the full complement of the nucleotide sequence of the disclosure, wherein the full complement and the nucleotide sequence of the disclosure consist of the same number of nucleotides and are 100% complementary.
[0015] In another embodiment, a recombinant DNA construct comprising the isolated polynucleotide of the disclosure operably linked to at least one regulatory element.
[0016] In another embodiment, a cell comprising the recombinant DNA construct of the disclosure, wherein the cell is selected from the group consisting of a bacterial cell, a yeast cell, and insect cell and a plant cell.
[0017] In another embodiment, a plant or a seed comprising the recombinant DNA construct of the disclosure. The plant or seed may be a monocot or a dicot plant or seed.
[0018] In another embodiment, a method for isolating a polypeptide encoded by the recombinant DNA construct of the disclosure, wherein the method comprises the following: (a) transforming a cell with the recombinant DNA construct of the disclosure; (b) growing the transformed cell of step (a) under conditions suitable for expression of the recombinant DNA construct; and (c) isolating the polypeptide from the transformed cell of step (b).
[0019] In another embodiment, an isolated polypeptide selected from the group consisting of: (a) a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 60%, 80%, 85%, 90% or 95% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX "Gonnet Series"), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (b) a polypeptide with drought tolerance activity, wherein the amino acid sequence is a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more amino acids by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; and (c) a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22.
[0020] In another embodiment, a vector that includes the polynucleotide of the disclosure is described.
[0021] In another embodiment, a method for producing a transgenic plant comprising transforming a plant cell with the recombinant DNA construct of the disclosure and regenerating a transgenic plant from the transformed plant cell.
[0022] In another embodiment, the present disclosure includes any of the plants of the present disclosure wherein the plant is selected from the group consisting of: maize, soybean, sunflower, sorghum, canola, wheat, alfalfa, cotton, rice, barley, millet, sugarcane, switchgrass, tobacco, potato and sugar beet.
[0023] In another embodiment, the present disclosure includes any of the methods of the present disclosure wherein the plant is selected from the group consisting of: maize, soybean, sunflower, sorghum, canola, wheat, alfalfa, cotton, rice, barley, millet, sugarcane, switchgrass, tobacco, potato and sugar beet.
[0024] In another embodiment, the present disclosure includes seed of any of the plants of the present disclosure, wherein said seed comprises in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide encodes a polypeptide having an amino acid sequence of at least 60% sequence identity, based on the Clustal W method of alignment, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and wherein a plant produced from said seed exhibits either an increased drought tolerance, or an increase in yield, or both, when compared to a control plant not comprising said recombinant DNA construct.
[0025] A method of identifying a plant that exhibits increased drought tolerance or an improved agronomic parameter, the method includes screening a population of maize plants for drought tolerance or enhanced nitrogen utilization efficiency and analyzing the sequence of a polynucleotide encoding a protein comprising SEQ ID NO: 3 and identifying the plant with drought tolerance or enhanced nitrogen utilization efficiency.
[0026] A method of identifying alleles in maize plants or germplasm that are associated with enhanced tolerance to drought and/or increased nitrogen use efficiency comprising:
[0027] (a) obtaining a population of maize plants, wherein one or more plants exhibit differing levels of enhanced tolerance to drought and/or increased nitrogen use efficiency;
[0028] (b) evaluating allelic variations with respect to the polynucleotide sequence encoding a protein comprising SEQ ID NO: 3 or in the genomic region that regulates the expression of the polynucleotide encoding the protein;
[0029] (c) obtaining phenotypic values of enhanced tolerance to drought and/or increased nitrogen use efficiency for a plurality of maize plants in the population;
[0030] (d) associating the allelic variations in the genomic associated with SEQ ID NO: 1 with said tolerance; and
[0031] (e) identifying the alleles that are associated with enhanced tolerance.
[0032] A transgenic plant includes in its genome a recombinant construct, the recombinant construct comprising a genetic element that reduces the expression of an endogenous gene, wherein the endogenous gene encodes a polypeptide that comprises an amino acid sequence of SEQ ID NO: 3 or a sequence that is 90% identical to SEQ ID NO: 3. In an embodiment, the genetic element includes a RNAi construct.
[0033] A plant comprising in its genome a genetic modification that results in the reduced expression of a gene that encodes a polypeptide that comprises an amino acid sequence of SEQ ID NO: 3 or a sequence that is 95% identical to SEQ ID NO: 3 or the reduced activity of the polypeptide, wherein the plant shows one or more improved agronomic parameters that contribute to drought tolerance or yield. In an embodiment, the plant is a maize plant.
BRIEF DESCRIPTION OF THE DRAWINGS AND SEQUENCE LISTING
[0034] The disclosure can be more fully understood from the following detailed description and the accompanying drawings and Sequence Listing which form a part of this application.
[0035] FIG. 1 shows the phenotype of pre-mature senescence (pre2) mutation (1A) and co-segregation analysis using SAIFF (Selective Amplification of Insertion Flanking Fragments) protocol to isolate a candidate gene responsible for the pre2 mutant phenotype in corn (1B).
[0036] FIG. 2 shows RT-PCR and Southern blot analyses of Pre2 candidate gene: Reverse transcriptase-polymerase chain reaction (RT-PCR) of pre2 mutant showing four transcripts with variable intensities as compared to one in WT-sib (2A). Cloning and sequence analysis of these transcripts were due to interference of the Mutator resulting into differential splicing in mutant mature RNA (2C). Southern blot analysis of pre2-2 mutant allele indicates a tight linkage between the pre2 mutant phenotype with the polymorphism in the candidate gene (2B).
[0037] FIG. 3 shows a diagramatic representation of gene expression of Pre2 gene in different plant parts of Arabodopsis. Red (dark shade) and yellow (light shade) colors depict the highest and lowest gene expression, respectively.
[0038] FIG. 4 show PCR fingerprinting of T-DNA insertion plants of Arabidopsis: PCR-FP analysis to identify homozygous knockouts, heterozygous and wild-type plants for T-DNA insertion of pre2 gene.
[0039] FIG. 5A shows that homozygous (pre2/pre2) knockout mutants (#11 and #25) exhibit robust growth and more siliques at flowering as compared to its both wild-type (+/+) and heterozygous (+/pre2) sibs. FIG. 5B shows average biomass of homozygous T-DNA knockout mutant (KO) plants is significantly higher as compared to its homozygous WT-sibs (WT) and heterozygous WT-sibs (Het).
[0040] FIG. 6 shows Arabidopsis knockout mutant (homozygous) for corn homolog of pre2 candidate gene and its WT-sib were screened for drought assay. The Atpre2 mutant was an outlier in this assay with a score (2 sigma) higher than 0.9 and with positive deviation. Arabidopsis transgene with corn native gene was a control and was hypersensitive to drought stress.
[0041] FIG. 7 shows phenotypic response of Arabidopsis knockout mutant (homozygous) for homolog of corn pre2 along with its WT-sib screened on Low N.
[0042] FIG. 8 shows screening of pre2 knockout mutant for pre2 of Arabidopsis showing root inhibition (sensitivity) to high N.
[0043] FIG. 9 shows trait summary of T0 plants for ear characteristics and seed number along with their molecular analysis (A) and the T1 reproductive assays results for three events (B). Significantly positive attributes are shown in bold.
[0044] FIG. 10 (A-E) shows multiple alignment of Arabidopsis Pre2 peptide with monocots (Bahia, Sudan and Resurrection grasses, sorghum, rice, and maize) and other dicots (soybean and castor bean). The order of sequences shown in the alignment is SEQ ID NOS: 15, 9, 5, 22, 18, 20, 3, 13, 7 and 11. The consensus regions are shown at the end of the alignment. A few exemplary conserved regions are indicated by horizontal bars.
[0045] FIG. 11(A-C) shows conserved domain sequences from Pre2 polypeptide sequences.
[0046] FIG. 12 shows germination rate on media containing 1 .mu.M ABA. Col-0 and Atpre2 are represented as dark and light boxes, respectively. The data are averages of germination rate with standard deviations from three replications.
SUMMARY OF SEQ ID NOS
TABLE-US-00001
[0047] Description and Abbreviation SEQ ID NO. Maize (ZmPre2 genomic sequence) 1 Maize (ZmPre2 cDNA sequence) 2 Maize (ZmPRE2 amino acid sequence) 3 Rice (OsPre2 cDNA) 4 Rice (OsPRE2 aa sequence) 5 Sorghum (SbPre2 cDNA) 6 Sorghum (SbPRE2_aa sequence) 7 BahiaGrass cDNA sequence 8 BahiaGrass PRE2 aa 9 SudanGrass_CDS (partial length sequence) 10 SudanGrass_aa partial length sequence 11 ResurrectionGrass CDS 12 ResurrectionGrass_aa 13 At1g72390FL cDNA Arabidopsis 14 AtPRE2_aa sequence 15 At1g72390genomic Arabidopsis 16 GM_chr16_Pre2 CDS 17 GM_chr16_Pre2 (amino acid) 18 GM_chr7_Pre2 (CDS) 19 GM_chr7_Pre2 (amino acid) 20 Castor bean Pre2 CDS 21 Castor bean PRE2 amino acid 22 BrassicaOleracea_Pre2 23 (gi_17734666_gb_BH526581.1) CDS BrassicaRapa_Pre2(PBR136351) CDS 24 Canola(PBN029307) CDS 25 Soybean GM-Pre2 (PSO423639) DNA 26 ZmPre2 TR1 (Fwd) 49 ZmPre2 TR1 (Rev) 50 Soybean Pre2 RNAi target sequence 51 Conserved Domain 1 27 Conserved Domain 2 28 Conserved Domain 3 29 Conserved Domain 4 30 Conserved Domain 5 31
TABLE-US-00002 Description and SEQ Abbreviation Consensus sequences (amino acid) ID NO: Conserved Region 1 MSLENIVKDIPSISDNSWTYGDLMEVESKILKALQPK 32 LHLDPTPKLDRL Conserved Region 2 SWTYGDLMEVES 33 Conserved Region 3 SWTYGDLMEVESKILKALQP 34 Conserved Region 4 GKKVCIDRVQESS 35 Conserved Region 5 QSPRLSAGALPQSPLSSKSGEFS 36 Conserved Region 6 SPLSSKSGEFS 37 Conserved Region 7 AQLAAKRRSNSLPKT 38 Conserved Region 8 VGSPVSVGTTSVPLNANSP 39 Conserved Region 9 RFSKIEMVTMRHQLNFKK 40 Conserved Region 10 LPNTHSADLLAQQFCSLMVREG 41 Conserved Region 11 QALQMSQGLLSGVSM 42 Conserved Region 12 SPQQMSQRTPMSPQISSGAIHAMSAGNPEACPASP 43 QLSSQTLGSVSSITNSPM Conserved Region 13 CPASPQLSSQTLGSVSSITNSPM 44 Conserved Region 14 HEVSFTFSLYDRGYLISKSAAMDPSQTSIQDGKTLH 45 PYDRASEKLFSAIEAGRLPGDILDEIPSKYYNGSVVC EIRDYRKHVSNQAPASSAELGLPIVNKVRLRMTFEN VVKDITLLSDDSWSYRDFVEAEARIVRALQPELCLD PTPKLDRLCQDPVPHKLSLGIGKKRRLRQNPEVVVT SSNMSHGKKVCIDR Conserved Region 15 LCLDPTPKLDRLCQDPVPHKLSLGIGKKRRLRQNP 46 Conserved Region 16 LCLDPTPKLDRL 47 Conserved Region 17 QDPVPHKLSLGIGKKRRLRQNP 48
[0048] The sequence descriptions and Sequence Listing attached hereto comply with the rules governing nucleotide and/or amino acid sequence disclosures in patent applications as set forth in 37 C.F.R. .sctn.1.821-1.825.
[0049] The Sequence Listing contains the one letter code for nucleotide sequence characters and the three letter codes for amino acids as defined in conformity with the IUPAC-IUBMB standards described in Nucleic Acids Res. 13:3021-3030 (1985) and in the Biochemical J. 219(2):345-373 (1984) which are herein incorporated by reference. The symbols and format used for nucleotide and amino acid sequence data comply with the rules set forth in 37 C.F.R. .sctn.1.822.
DETAILED DESCRIPTION
[0050] Pre2 nucleotide sequences and polypeptide sequences improve stress tolerance and yield of agronomically important crop plants and vegetables. Reduced expression of Pre2 mRNA results in enhanced tolerance to drought and improved utilization of nitrogen (NUE) under nitrogen limiting conditions. Suppressing of one or more Pre2 endogenous genes results in improved agronomic performance. One way of suppressing endogenous Pre2 gene expression is through RNAi. Other modes of suppression include anti-sense, co-suppression, promoter inverted repeats, and micro RNA. Another non-transgenic approach is to generate native variation in the expression levels of endogenous Pre2.
[0051] One or more of the plant Pre2 polypeptides disclosed herein include an Spt20 domain that is found in the Spt20 family of proteins from both human and yeast. The Spt20 protein is part of the SAGA complex which is a large complex that may be involved in histone deacetylation. Yeast Spt20 has been shown to play a role in structural integrity of the SAGA complex as no intact SAGA could be purified in spt20 deletion strains. The Spt20 domain or a sub-region thereof may be involved in DNA binding. For example, in an embodiment, the Spt20 domain comprises amino acid positions 69-227 of the castor bean Pre2 polypeptide. Relative positions in other Pre2 homologs or orthologs from one or more other species also contain this conserved region. In an embodiment, this conserved region is designated as "pfam12090".
[0052] Pre2 homozygous mutants were robust in growth with more pod numbers but were late in maturity by 4 to 5 days as compared to its WT-sibs (FIG. 5A). For measuring total biomass, 9 whole plants, each of knock out #11, knock out #25, homozygous WT, and heterozygous WT-sibs, were harvested and air dried for 14 days at room temperature. Total weight was determined by weighing and average and standard deviation were calculated for statistical analysis. The total biomass of both knockouts (combined) was found to be significantly higher (t test at P<0.01) when compared to both homozygous and heterozygous WT-sibs (FIG. 5B). In an embodiment, three maize gene suppression events (e.g., RNAi events namely 1.4, 1.5, and 2.5) exhibited improved agronomic parameters in an NUE Reproductive Assay in T1 generation under 4.0 mMol Nitrate-suboptimal nitrogen conditions. Two of three events (1.5 and 2.5) showed significant increase (percent change vs. Null) in silk count, ear length, ear width, and ear area (FIG. 9B). In addition to these traits, event 2.5 also showed significant difference for Days to shed and days to silk as compared to its nulls. Thus, transgenic plants where the expression of the Pre2 mRNA has been modulated exhibit significant differences in one or more agronomic parameters of interest for crop plants.
[0053] In ABA-sensitivity experiments, Atpre2 mutant showed a hypersensitive response to ABA in a dosage dependent manner. The seed germination in mutant was reduced or delayed by more than 50% as compare to wild type in presence of 1 uM ABA (FIG. x). Endogenous AT-PRE2 gene expression was higher in guard cells in wild type plants and was down-regulated by ABA treatment both in seedling and leaf based on gene expression databases. In addition AtPRE2 was also up-regulated by nitrate in roots. These results indicate a direct or indirect role of AtPRE2 in ABA and N signaling/pathway.
[0054] The disclosure of each reference set forth herein is hereby incorporated by reference in its entirety. Some of the agronomic parameters that correlate with nitrogen use efficiency analysis and/or include for e.g., root dwt (g), root: shoot dwt ratio, shoot dwt (g), shoot nitrogen (mg/g dwt), shoot total nitrogen (mg) and total plant dwt (g). Some of the variables that for nitrogen use efficiency reproductive assay include e.g., anthesis to silking interval (days), days to shed, days to silk, ear area 8 days after silk (sq cm), ear length 8 days after silk (cm), ear width 8 days after silk (cm), max total area, specific growth rate, and silk count.
[0055] As used herein and in the appended claims, the singular forms "a", "an", and "the" include plural reference unless the context clearly dictates otherwise. Thus, for example, reference to "a plant" includes a plurality of such plants, reference to "a cell" includes one or more cells and equivalents thereof known to those skilled in the art, and so forth.
[0056] As used herein:
[0057] The terms "monocot" and "monocotyledonous plant" are used interchangeably herein. A monocot of the current disclosure includes the Gramineae.
[0058] The terms "dicot" and "dicotyledonous plant" are used interchangeably herein. A dicot of the current disclosure includes the following families: Brassicaceae, Leguminosae, and Solanaceae.
[0059] The terms "full complement" and "full-length complement" are used interchangeably herein, and refer to a complement of a given nucleotide sequence, wherein the complement and the nucleotide sequence consist of the same number of nucleotides and are 100% complementary.
[0060] "Arabidopsis" and "Arabidopsis thaliana" are used interchangeably herein, unless otherwise indicated.
[0061] An "Expressed Sequence Tag" ("EST") is a DNA sequence derived from a cDNA library and therefore is a sequence which has been transcribed. An EST is typically obtained by a single sequencing pass of a cDNA insert. The sequence of an entire cDNA insert is termed the "Full-Insert Sequence" ("FIS"). A "Contig" sequence is a sequence assembled from two or more sequences that can be selected from, but not limited to, the group consisting of an EST, FIS and PCR sequence. A sequence encoding an entire or functional protein is termed a "Complete Gene Sequence" ("CGS") and can be derived from an FIS or a contig.
[0062] "Agronomic characteristic" or "agronomic parameter" is a measurable parameter including but not limited to, greenness, yield, growth rate, biomass, fresh weight at maturation, dry weight at maturation, fruit yield, seed yield, total plant nitrogen content, fruit nitrogen content, seed nitrogen content, nitrogen content in a vegetative tissue, total plant free amino acid content, fruit free amino acid content, seed free amino acid content, free amino acid content in a vegetative tissue, total plant protein content, fruit protein content, seed protein content, protein content in a vegetative tissue, drought tolerance, nitrogen uptake, root lodging, harvest index, stalk lodging, plant height, ear height, ear length, salt tolerance, early seedling vigor and seedling emergence under low temperature stress.
[0063] "Transgenic" refers to any cell, cell line, callus, tissue, plant part or plant, the genome of which has been altered by the presence of a heterologous nucleic acid, such as a recombinant DNA construct, including those initial transgenic events as well as those created by sexual crosses or asexual propagation from the initial transgenic event. The term "transgenic" as used herein does not encompass the alteration of the genome (chromosomal or extra-chromosomal) by conventional plant breeding methods or by naturally occurring events such as random cross-fertilization, non-recombinant viral infection, non-recombinant bacterial transformation, non-recombinant transposition or spontaneous mutation.
[0064] "Genome" as it applies to plant cells encompasses not only chromosomal DNA found within the nucleus, but organelle DNA found within subcellular components (e.g., mitochondrial, plastid) of the cell.
[0065] "Plant" includes reference to whole plants, plant organs, plant tissues, seeds and plant cells and progeny of same. Plant cells include, without limitation, cells from seeds, suspension cultures, embryos, meristematic regions, callus tissue, leaves, roots, shoots, gametophytes, sporophytes, pollen, and microspores.
[0066] "Progeny" comprises any subsequent generation of a plant.
[0067] "Transgenic plant" includes reference to a plant which comprises within its genome a heterologous polynucleotide. For example, the heterologous polynucleotide is stably integrated within the genome such that the polynucleotide is passed on to successive generations. The heterologous polynucleotide may be integrated into the genome alone or as part of a recombinant DNA construct.
[0068] "Heterologous" with respect to sequence means a sequence that originates from a foreign species, or, if from the same species, is substantially modified from its native form in composition and/or genomic locus by deliberate human intervention.
[0069] "Polynucleotide", "nucleic acid sequence", "nucleotide sequence", or "nucleic acid fragment" are used interchangeably and is a polymer of RNA or DNA that is single- or double-stranded, optionally containing synthetic, non-natural or altered nucleotide bases. Nucleotides (usually found in their 5'-monophosphate form) are referred to by their single letter designation as follows: "A" for adenylate or deoxyadenylate (for RNA or DNA, respectively), "C" for cytidylate or deoxycytidylate, "G" for guanylate or deoxyguanylate, "U" for uridylate, "T" for deoxythymidylate, "R" for purines (A or G), "Y" for pyrimidines (C or T), "K" for G or T, "H" for A or C or T, "I" for inosine and "N" for any nucleotide.
[0070] "Polypeptide", "peptide", "amino acid sequence" and "protein" are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical analogue of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers. The terms "polypeptide", "peptide", "amino acid sequence", and "protein" are also inclusive of modifications including, but not limited to, glycosylation, lipid attachment, sulfation, gamma-carboxylation of glutamic acid residues, hydroxylation and ADP-ribosylation.
[0071] "Messenger RNA (mRNA)" refers to the RNA that is without introns and that can be translated into protein by the cell.
[0072] "cDNA" refers to a DNA that is complementary to and synthesized from a mRNA template using the enzyme reverse transcriptase. The cDNA can be single-stranded or converted into the double-stranded form using the Klenow fragment of DNA polymerase I.
[0073] "Mature" protein refers to a post-translationally processed polypeptide; i.e., one from which any pre- or pro-peptides present in the primary translation product have been removed.
[0074] Nitrogen utilization efficiency (NUE) genes affect yield and have utility for improving the use of nitrogen in crop plants, especially maize. Increased nitrogen use efficiency can result from enhanced uptake and assimilation of nitrogen fertilizer and/or the subsequent remobilization and reutilization of accumulated nitrogen reserves, as well as increased tolerance of plants to stress situations such as low nitrogen environments. The genes can be used to alter the genetic composition of the plants, rendering them more productive with current fertilizer application standards or maintaining their productive rates with significantly reduced fertilizer or reduced nitrogen availability. Improving NUE in corn would increase corn harvestable yield per unit of input nitrogen fertilizer, both in developing nations where access to nitrogen fertilizer is limited and in developed nations where the level of nitrogen use remains high. Nitrogen utilization improvement also allows decreases in on-farm input costs, decreased use and dependence on the non-renewable energy sources required for nitrogen fertilizer production and reduces the environmental impact of nitrogen fertilizer manufacturing and agricultural use
[0075] "Precursor" protein refers to the primary product of translation of mRNA; i.e., with pre- and pro-peptides still present. Pre- and pro-peptides may be and are not limited to intracellular localization signals.
[0076] "Isolated" refers to materials, such as nucleic acid molecules and/or proteins, which are substantially free or otherwise removed from components that normally accompany or interact with the materials in a naturally occurring environment. Isolated polynucleotides may be purified from a host cell in which they naturally occur. Conventional nucleic acid purification methods known to skilled artisans may be used to obtain isolated polynucleotides. The term also embraces recombinant polynucleotides and chemically synthesized polynucleotides.
[0077] "Recombinant" refers to an artificial combination of two otherwise separated segments of sequence, e.g., by chemical synthesis or by the manipulation of isolated segments of nucleic acids by genetic engineering techniques. "Recombinant" also includes reference to a cell or vector, that has been modified by the introduction of a heterologous nucleic acid or a cell derived from a cell so modified, but does not encompass the alteration of the cell or vector by naturally occurring events (e.g., spontaneous mutation, natural transformation/transduction/transposition) such as those occurring without deliberate human intervention.
[0078] "Recombinant DNA construct" refers to a combination of nucleic acid fragments that are not normally found together in nature. Accordingly, a recombinant DNA construct may comprise regulatory sequences and coding sequences that are derived from different sources, or regulatory sequences and coding sequences derived from the same source, but arranged in a manner different than that normally found in nature.
[0079] The terms "entry clone" and "entry vector" are used interchangeably herein.
[0080] "Regulatory sequences" refer to nucleotide sequences located upstream (5' non-coding sequences), within, or downstream (3' non-coding sequences) of a coding sequence, and which influence the transcription, RNA processing or stability, or translation of the associated coding sequence. Regulatory sequences may include, but are not limited to, promoters, translation leader sequences, introns, and polyadenylation recognition sequences. The terms "regulatory sequence" and "regulatory element" are used interchangeably herein.
[0081] "Promoter" refers to a nucleic acid fragment capable of controlling transcription of another nucleic acid fragment.
[0082] "Promoter functional in a plant" is a promoter capable of controlling transcription in plant cells whether or not its origin is from a plant cell.
[0083] "Tissue-specific promoter" and "tissue-preferred promoter" are used interchangeably, and refer to a promoter that is expressed predominantly but not necessarily exclusively in one tissue or organ, but that may also be expressed in one specific cell.
[0084] "Developmentally regulated promoter" refers to a promoter whose activity is determined by developmental events.
[0085] "Operably linked" refers to the association of nucleic acid fragments in a single fragment so that the function of one is regulated by the other. For example, a promoter is operably linked with a nucleic acid fragment when it is capable of regulating the transcription of that nucleic acid fragment.
[0086] "Expression" refers to the production of a functional product. For example, expression of a nucleic acid fragment may refer to transcription of the nucleic acid fragment (e.g., transcription resulting in mRNA or functional RNA) and/or translation of mRNA into a precursor or mature protein.
[0087] "Phenotype" means the detectable characteristics of a cell or organism.
[0088] "Introduced" in the context of inserting a nucleic acid fragment (e.g., a recombinant DNA construct) into a cell, means "transfection" or "transformation" or "transduction" and includes reference to the incorporation of a nucleic acid fragment into a eukaryotic or prokaryotic cell where the nucleic acid fragment may be incorporated into the genome of the cell (e.g., chromosome, plasmid, plastid or mitochondrial DNA), converted into an autonomous replicon, or transiently expressed (e.g., transfected mRNA).
[0089] A "transformed cell" is any cell into which a nucleic acid fragment (e.g., a recombinant DNA construct) has been introduced.
[0090] "Transformation" as used herein refers to both stable transformation and transient transformation.
[0091] "Stable transformation" refers to the introduction of a nucleic acid fragment into a genome of a host organism resulting in genetically stable inheritance. Once stably transformed, the nucleic acid fragment is stably integrated in the genome of the host organism and any subsequent generation.
[0092] "Transient transformation" refers to the introduction of a nucleic acid fragment into the nucleus, or DNA-containing organelle, of a host organism resulting in gene expression without genetically stable inheritance.
[0093] "Allele" is one of several alternative forms of a gene occupying a given locus on a chromosome. When the alleles present at a given locus on a pair of homologous chromosomes in a diploid plant are the same that plant is homozygous at that locus. If the alleles present at a given locus on a pair of homologous chromosomes in a diploid plant differ that plant is heterozygous at that locus. If a transgene is present on one of a pair of homologous chromosomes in a diploid plant that plant is hemizygous at that locus.
[0094] The percent identity between two amino acid or nucleic acid sequences may be determined by visual inspection and mathematical calculation.
[0095] Sequence alignments and percent identity calculations may be determined using a variety of comparison methods designed to detect homologous sequences including, but not limited to, the MEGALIGN.RTM. program of the LASERGENE.RTM. bioinformatics computing suite (DNASTAR.RTM. Inc., Madison, Wis.). Unless stated otherwise, multiple alignment of the sequences provided herein were performed using the Clustal W method of alignment (Thompson, et al., (1994). Nucleic Acids Research 22:4673-80) with the default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX "Gonnet Series").
[0096] Default parameters for pairwise alignments using the Clustal W method were SLOW-ACCURATE, GAP PENALTY=10, GAP LENGTH=0.10, PROTEIN WEIGHT MATRIX "Gonnet 250". After alignment of the sequences, using the Clustal W program, it is possible to obtain "percent identity" and "divergence" values by viewing the "sequence distances" table on the same program; unless stated otherwise, percent identities and divergences provided and claimed herein were calculated in this manner.
[0097] Alternatively, sequence alignments and percent identity calculations may be determined using a variety of comparison methods designed to detect homologous sequences including, but not limited to, the Clustal V method of alignment (Higgins and Sharp, (1989) CAB/OS 5:151-153) with the default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=10). Default parameters for pairwise alignments and calculation of percent identity of protein sequences using the Clustal V method are KTUPLE=1, GAP PENALTY=3, WINDOW=5 and DIAGONALS SAVED=5. For nucleic acids these parameters are KTUPLE=2, GAP PENALTY=5, WINDOW=4 and DIAGONALS SAVED=4.
[0098] Alternatively, the percent identity of two protein sequences may be determined by comparing sequence information based on the algorithm of Needleman and Wunsch, (J. Mol. Biol. 48:443-453, 1970) and using the GAP computer program available from the University of Wisconsin Genetics Computer Group (UWGCG). The preferred default parameters for the GAP program include: (1) a scoring matrix, blosum62, as described by Henikoff and Henikoff, (Proc. Natl. Acad. Sci. USA 89:10915-10919 1992); (2) a gap weight of 12; (3) a gap length weight of 4; and (4) no penalty for end gaps.
[0099] Other programs used by those skilled in the art of sequence comparison may also be used. The percent identity can be determined by comparing sequence information using, e.g., the BLAST program described by Altschul, et al., (Nucl. Acids. Res. 25:3389-3402 1997). This program is available on the Internet at the web site of the National Center for Biotechnology Information (NCBI) or the DNA Data Bank of Japan (DDBJ). The details of various conditions (parameters) for identity search using the BLAST program are shown on these web sites, and default values are commonly used for search although part of the settings may be changed as appropriate. Alternatively, the percent identity of two amino acid sequences may be determined by using a program such as genetic information processing software GENETYX Ver.7 (Genetyx Corporation, Japan) or using an algorithm such as FASTA. In this case, default values may be used for search.
[0100] The percent identity between two nucleic acid sequences can be determined by visual inspection and mathematical calculation, or more preferably, the comparison is done by comparing sequence information using a computer program. An exemplary, preferred computer program is the Genetic Computer Group (GCG.RTM.; Madison, Wis.) WISCONSIN PACKAGE.RTM. version 10.0 program, "GAP" (Devereux, et al., (1984) Nucl. Acids Res. 12:387). In addition to making a comparison between two nucleic acid sequences, this "GAP" program can be used for comparison between two amino acid sequences and between a nucleic acid sequence and an amino acid sequence. The preferred default parameters for the "GAP" program include: (1) the GCG.RTM. implementation of a unary comparison matrix (containing a value of 1 for identities and 0 for non-identities) for nucleotides, and the weighted amino acid comparison matrix of Gribskov and Burgess, (1986) Nucl. Acids Res. 14:6745, as described by Schwartz and Dayhoff, eds., "Atlas of Polypeptide Sequence and Structure," National Biomedical Research Foundation, pp. 353-358, (1979), or other comparable comparison matrices; (2) a penalty of 30 for each gap and an additional penalty of 1 for each symbol in each gap for amino acid sequences, or penalty of 50 for each gap and an additional penalty of 3 for each symbol in each gap for nucleotide sequences; (3) no penalty for end gaps; and (4) no maximum penalty for long gaps. Other programs used by those skilled in the art of sequence comparison can also be used, such as, for example, the BLASTN program version 2.2.7, available for use via the National Library of Medicine website, or the WU-BLAST 2.0 algorithm (Advanced Biocomputing, LLC). In addition, the BLAST algorithm uses the BLOSUM62 amino acid scoring matrix, and optional parameters that can be used are as follows: (A) inclusion of a filter to mask segments of the query sequence that have low compositional complexity (as determined by the SEG program of Wootton and Federhen (Computers and Chemistry, 1993); also see, Wootton and Federhen, (1996) Methods Enzymol. 266:554-71) or segments consisting of short-periodicity internal repeats (as determined by the XNU program of Claverie and States (Computers and Chemistry, 1993)), and (B) a statistical significance threshold for reporting matches against database sequences, or E-score (the expected probability of matches being found merely by chance, according to the stochastic model of Karlin and Altschul, 1990; if the statistical significance ascribed to a match is greater than this E-score threshold, the match will not be reported); preferred E-score threshold values are 0.5, or in order of increasing preference, 0.25, 0.1, 0.05, 0.01, 0.001, 0.0001, 1 e-5, le-10, 1 e-15, 1 e-20, 1 e-25, 1 e-30, 1 e-40, 1 e-50, 1 e-75 or 1 e-100.
[0101] Standard recombinant DNA and molecular cloning techniques used herein are well known in the art and are described more fully in Sambrook, et al., Molecular Cloning: A Laboratory Manual; Cold Spring Harbor Laboratory Press: Cold Spring Harbor, 1989 (hereinafter "Sambrook").
[0102] The term "consisting essentially of" in the context of a polypeptide sequence generally refers to the specified portion of the amino acid sequence and those other sequences that do not materially affect the basic and novel characteristics of the disclosed sequences herein. For example, in the context of an RNAi sequence, the term consisting essentially generally refers to that portion of the target sequence and those other nucleotide sequences that do not materially affect the binding and suppressing properties of the sequence targets disclosed herein.
[0103] Embodiments include isolated polynucleotides and polypeptides, recombinant DNA constructs useful for conferring drought tolerance, compositions (such as plants or seeds) comprising these recombinant DNA constructs, and methods utilizing these recombinant DNA constructs.
[0104] Isolated Polynucleotides and Polypeptides:
[0105] The present disclosure includes the following isolated polynucleotides and polypeptides:
[0106] An isolated polypeptide having an amino acid sequence of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity, based on the Clustal W method of alignment, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22. The polypeptide is preferably a PRE2 polypeptide.
[0107] An isolated polypeptide wherein the amino acid sequence is a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; by alteration of one or more amino acids by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; and (c) a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22. The polypeptide is preferably a PRE2 polypeptide.
[0108] An isolated polynucleotide comprising a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; An isolated polynucleotide comprising a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion.
[0109] Recombinant DNA Constructs:
[0110] In one aspect, the present disclosure includes recombinant DNA constructs.
[0111] In one embodiment, a recombinant DNA construct comprises a polynucleotide operably linked to at least one regulatory sequence (e.g., a promoter functional in a plant), wherein the polynucleotide comprises (i) a nucleic acid sequence encoding an amino acid sequence of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity, based on the Clustal W method of alignment, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; or (ii) a full complement of the nucleic acid sequence of (i).
[0112] In another embodiment, a recombinant DNA construct comprises a polynucleotide operably linked to at least one regulatory sequence (e.g., a promoter functional in a plant), wherein said polynucleotide encodes a PRE2 polypeptide. The PRE2 polypeptide may be from Arabidopsis thaliana, Zea mays, Glycine max, Glycine tabacina, Glycine soja and Glycine tomentella.
[0113] It is understood, as those skilled in the art will appreciate, that the disclosure encompasses more than the specific exemplary sequences. Alterations in a nucleic acid fragment which result in the production of a chemically equivalent amino acid at a given site, but do not affect the functional properties of the encoded polypeptide, are well known in the art. For example, a codon for the amino acid alanine, a hydrophobic amino acid, may be substituted by a codon encoding another less hydrophobic residue, such as glycine, or a more hydrophobic residue, such as valine, leucine, or isoleucine. Similarly, changes which result in substitution of one negatively charged residue for another, such as aspartic acid for glutamic acid, or one positively charged residue for another, such as lysine for arginine, can also be expected to produce a functionally equivalent product. Nucleotide changes which result in alteration of the N-terminal and C-terminal portions of the polypeptide molecule would also not be expected to alter the activity of the polypeptide. Each of the proposed modifications is well within the routine skill in the art, as is determination of retention of biological activity of the encoded products.
[0114] The protein of the current disclosure may also be a protein which comprises an amino acid sequence comprising deletion, substitution, insertion and/or addition of one or more amino acids in an amino acid sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22. The substitution may be conservative, which means the replacement of a certain amino acid residue by another residue having similar physical and chemical characteristics. Non-limiting examples of conservative substitution include replacement between aliphatic group-containing amino acid residues such as Ile, Val, Leu or Ala, and replacement between polar residues such as Lys-Arg, Glu-Asp or Gln-Asn replacement.
[0115] Proteins derived by amino acid deletion, substitution, insertion and/or addition can be prepared when DNAs encoding their wild-type proteins are subjected to, for example, well-known site-directed mutagenesis (see, e.g., Nucleic Acid Research, 10(20):6487-6500, (1982), which is hereby incorporated by reference in its entirety). As used herein, the term "one or more amino acids" is intended to mean a possible number of amino acids which may be deleted, substituted, inserted and/or added by site-directed mutagenesis.
[0116] Site-directed mutagenesis may be accomplished, for example, as follows using a synthetic oligonucleotide primer that is complementary to single-stranded phage DNA to be mutated, except for having a specific mismatch (i.e., a desired mutation). Namely, the above synthetic oligonucleotide is used as a primer to cause synthesis of a complementary strand by phages, and the resulting duplex DNA is then used to transform host cells. The transformed bacterial culture is plated on agar, whereby plaques are allowed to form from phage-containing single cells. As a result, in theory, 50% of new colonies contain phages with the mutation as a single strand, while the remaining 50% have the original sequence. At a temperature which allows hybridization with DNA completely identical to one having the above desired mutation, but not with DNA having the original strand, the resulting plaques are allowed to hybridize with a synthetic probe labeled by kinase treatment. Subsequently, plaques hybridized with the probe are picked up and cultured for collection of their DNA.
[0117] Techniques for allowing deletion, substitution, insertion and/or addition of one or more amino acids in the amino acid sequences of biologically active peptides such as enzymes while retaining their activity include site-directed mutagenesis mentioned above, as well as other techniques such as those for treating a gene with a mutagen and those in which a gene is selectively cleaved to remove, substitute, insert or add a selected nucleotide or nucleotides, and then ligated. Alternatively, random mutagenesis approaches may be used to disrupt or "knock-out" the expression of a Pre2 gene using either chemical or insertional mutagenesis or irradiation. A mutagenesis and mutant identification system known as TILLING (for targeting induced local lesions in genomes) can also be used. In this method, mutations are induced in the seed of a plant of interest, for example, using EMS treatment. The resulting plants are grown and self-fertilized, and the progeny are assessed. For example, the plants may be assed using PCR to identify whether a mutated plant has a Pre2 mutation, e.g., that reduces expression of a Pre2 gene. See, e.g., Colbert, et al., (2001) Plant Physiol 126:480-484; McCallum, et al., (2000) Nature Biotechnology 18:455-457.
[0118] The term "under stringent conditions" means that two sequences hybridize under moderately or highly stringent conditions. More specifically, moderately stringent conditions can be readily determined by those having ordinary skill in the art, e.g., depending on the length of DNA. The basic conditions are set forth by Sambrook, et al., Molecular Cloning: A Laboratory Manual, Third Edition, Chapters 6 and 7, Cold Spring Harbor Laboratory Press, 2001 and include the use of a prewashing solution for nitrocellulose filters 5.times.SSC, 0.5% SDS, 1.0 mM EDTA (pH 8.0), hybridization conditions of about 50% formamide, 2.times.SSC to 6.times.SSC at about 40-50.degree. C. (or other similar hybridization solutions, such as Stark's solution, in about 50% formamide at about 42.degree. C.) and washing conditions of, for example, about 40-60.degree. C., 0.5-6.times.SSC, 0.1% SDS. Preferably, moderately stringent conditions include hybridization (and washing) at about 50.degree. C. and 6.times.SSC. Highly stringent conditions can also be readily determined by those skilled in the art, e.g., depending on the length of DNA.
[0119] Generally, such conditions include hybridization and/or washing at higher temperature and/or lower salt concentration (such as hybridization at about 65.degree. C., 6.times.SSC to 0.2.times.SSC, preferably 6.times.SSC, more preferably 2.times.SSC, most preferably 0.2.times.SSC), compared to the moderately stringent conditions. For example, highly stringent conditions may include hybridization as defined above, and washing at approximately 65-68.degree. C., 0.2.times.SSC, 0.1% SDS. SSPE (1.times.SSPE is 0.15 M NaCl, 10 mM NaH2PO4, and 1.25 mM EDTA, pH 7.4) can be substituted for SSC (1.times.SSC is 0.15 M NaCl and 15 mM sodium citrate) in the hybridization and washing buffers; washing is performed for 15 minutes after hybridization is completed.
[0120] It is also possible to use a commercially available hybridization kit which uses no radioactive substance as a probe. Specific examples include hybridization with an ECL direct labeling & detection system (Amersham). Stringent conditions include, for example, hybridization at 42.degree. C. for 4 hours using the hybridization buffer included in the kit, which is supplemented with 5% (w/v) Blocking reagent and 0.5 M NaCl, and washing twice in 0.4% SDS, 0.5.times.SSC at 55.degree. C. for 20 minutes and once in 2.times.SSC at room temperature for 5 minutes.
[0121] The protein of the present disclosure is preferably a protein with drought tolerance activity.
[0122] "Suppression DNA construct" is a recombinant DNA construct which when transformed or stably integrated into the genome of the plant, results in "silencing" of a target gene in the plant. The target gene may be endogenous or transgenic to the plant. "Silencing," as used herein with respect to the target gene, refers generally to the suppression of levels of mRNA or protein/enzyme expressed by the target gene and/or the level of the enzyme activity or protein functionality. The terms "suppression", "suppressing" and "silencing", used interchangeably herein, include lowering, reducing, declining, decreasing, inhibiting, eliminating or preventing. "Silencing" or "gene silencing" does not specify mechanism and is inclusive, and not limited to, anti-sense, cosuppression, viral-suppression, hairpin suppression, stem-loop suppression, RNAi-based approaches and small RNA-based approaches.
[0123] A suppression DNA construct may comprise a region derived from a target gene of interest (e.g., Pre2) and may comprise all or part of the nucleic acid sequence of the sense strand (or antisense strand) of the target gene of interest. Depending upon the approach to be utilized, the region may be 100% identical or less than 100% identical (e.g., at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical) to all or part of the sense strand (or antisense strand) of the gene of interest.
[0124] For example, an RNAi target sequence includes about 20 to about 1000 contiguous bases of the disclosed Pre2 sense or anti-sense strand. In an embodiment, the target sequence includes about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100 and 1200 bases of the Pre2 sense or anti-sense strand. Within those contiguous bases, there can be variations and the target RNAi sequences need not be identical and as described above, the similarity level can range from 50% to about 99%.
[0125] Suppression DNA constructs are well-known in the art, are readily constructed once the target gene of interest is selected, and include, without limitation, cosuppression constructs, antisense constructs, viral-suppression constructs, hairpin suppression constructs, stem-loop suppression constructs, double-stranded RNA-producing constructs and more generally, RNAi
[0126] (RNA interference) constructs and small RNA constructs such as siRNA (short interfering RNA) constructs and miRNA (microRNA) constructs.
[0127] "Antisense inhibition" refers to the production of antisense RNA transcripts capable of suppressing the expression of the target gene or gene product. "Antisense RNA" refers to an RNA transcript that is complementary to all or part of a target primary transcript or mRNA and that blocks the expression of a target isolated nucleic acid fragment (U.S. Pat. No. 5,107,065). The complementarity of an antisense RNA may be with any part of the specific gene transcript, i.e., at the 5' non-coding sequence, 3' non-coding sequence, introns or the coding sequence.
[0128] "Cosuppression" refers to the production of sense RNA transcripts capable of suppressing the expression of the target gene or gene product. "Sense" RNA refers to RNA transcript that includes the mRNA and can be translated into protein within a cell or in vitro. Cosuppression constructs in plants have been previously designed by focusing on overexpression of a nucleic acid sequence having homology to a native mRNA, in the sense orientation, which results in the reduction of all RNA having homology to the overexpressed sequence (see, Vaucheret, et al., (1998) Plant J. 16:651-659 and Gura, (2000) Nature 404:804-808).
[0129] Another variation describes the use of plant viral sequences to direct the suppression of proximal mRNA encoding sequences (PCT Publication Number WO 1998/36083 published on Aug. 20, 1998).
[0130] Promoter inverted repeats are also suitable to suppress the expression of endogenous genes including Pre2. Such targeted promoter inactivation is possible by identifying the promoter region of Pre2 and constructing promoter inverted repeat constructs.
[0131] Genome editing or genome engineering through site-directed mutagenesis by custom meganucleases with unique DNA-recognition and cleavage properties is possible (e.g., WO 2007/047859 and WO 2009/114321). This technique provides the ability to specifically modify a defined target of interest within a genome, e.g., Pre2 genomic region. Another site-directed engineering is through the use of zinc finger domain recognition coupled with the restriction properties of restriction enzyme. See, e.g., Urnov, et al., (2010) Nat Rev Genet. 11(9):636-46; Shukla, et al., (2009) Nature 459(7245):437-41. These citations are incorporated herein to the extent they relate to materials and methods to enable genome editing through site-specific modification. Such genome editing techniques are used to engineer site-directed changes including increasing gene expression of an endogenous gene (e.g., placing an enhancer element in control of the transcription), transcriptionally silencing an endogenous gene, creating mutants, variants of the encoded polypeptide, removing one or more genomic regions and other methods to modulate the gene expression and/or its activity.
[0132] Knock-out or gene knock-out refers to an inhibition or substantial suppression of endogenous gene expression either by a transgenic or a non-transgenic approach. For example, knock-outs can be achieved by a variety of approaches including transposons, retrotransposons, deletions, substitutions, mutagenesis of the endogenous coding sequence and/or a regulatory sequence such that the expression is substantially suppressed; and any other methodology that suppresses the activity of the target of interest.
[0133] Exogenous application of nucleotides including synthetic nucleotide molecules to induce RNAi-mediated silencing of the endogenous Pre2 gene is possible. See e.g., US 2008/0248576, US 2011/0296556 and WO 2011/112570. Exogenously applied agents are capable of inducing the downregulation of the endogenous gene.
[0134] Regulatory Sequences:
[0135] A recombinant DNA construct of the present disclosure may comprise at least one regulatory sequence. A regulatory sequence may be a promoter.
[0136] A number of promoters can be used in recombinant DNA constructs of the present disclosure. The promoters can be selected based on the desired outcome, and may include constitutive, tissue-specific, inducible or other promoters for expression in the host organism.
[0137] Promoters that cause a gene to be expressed in most cell types at most times are commonly referred to as "constitutive promoters".
[0138] High level, constitutive expression of the candidate gene under control of the 35S or UBI promoter may have pleiotropic effects, although candidate gene efficacy may be estimated when driven by a constitutive promoter. Use of tissue-specific and/or stress-specific promoters may eliminate undesirable effects but retain the ability to enhance drought tolerance. This effect has been observed in Arabidopsis (Kasuga, et al., (1999) Nature Biotechnol. 17:287-91).
[0139] Suitable constitutive promoters for use in a plant host cell include, for example, the core promoter of the Rsyn7 promoter and other constitutive promoters disclosed in WO 1999/43838 and U.S. Pat. No. 6,072,050; the core CaMV 35S promoter (Odell, et al., (1985) Nature 313:810-812); rice actin (McElroy, et al., (1990) Plant Cell 2:163-171); ubiquitin (Christensen, et al., (1989) Plant Mol. Biol. 12:619-632 and Christensen, et al., (1992) Plant Mol. Biol. 18:675-689); pEMU (Last, et al., (1991) Theor. Appl. Genet. 81:581-588); MAS (Velten, et al., (1984) EMBO J. 3:2723-2730); ALS promoter (U.S. Pat. No. 5,659,026), and the like. Other constitutive promoters include, for example, those discussed in U.S. Pat. Nos. 5,608,149; 5,608,144; 5,604,121; 5,569,597; 5,466,785; 5,399,680; 5,268,463; 5,608,142 and 6,177,611.
[0140] In choosing a promoter to use in the methods of the disclosure, it may be desirable to use a tissue-specific or developmentally regulated promoter.
[0141] A tissue-specific or developmentally regulated promoter is a DNA sequence which regulates the expression of a DNA sequence selectively in the cells/tissues of a plant critical to tassel development, seed set, or both, and limits the expression of such a DNA sequence to the period of tassel development or seed maturation in the plant. Any identifiable promoter may be used in the methods of the present disclosure which causes the desired temporal and spatial expression.
[0142] Promoters which are seed or embryo-specific and may be useful in the disclosure include soybean Kunitz trypsin inhibitor (Kti3, Jofuku and Goldberg, (1989) Plant Cell 1:1079-1093), patatin (potato tubers) (Rocha-Sosa, et al., (1989) EMBO J. 8:23-29), convicilin, vicilin, and legumin (pea cotyledons) (Rerie, et al., (1991) Mol. Gen. Genet. 259:149-157; Newbigin, et al., (1990) Planta 180:461-470; Higgins, et al., (1988) Plant. Mol. Biol. 11:683-695), zein (maize endosperm) (Schemthaner, et al., (1988) EMBO J. 7:1249-1255), phaseolin (bean cotyledon) (Segupta-Gopalan, et al., (1985) Proc. Natl. Acad. Sci. U.S.A. 82:3320-3324), phytohemagglutinin (bean cotyledon) (Voelker, et al., (1987) EMBO J. 6:3571-3577), B-conglycinin and glycinin (soybean cotyledon) (Chen, et al., (1988) EMBO J. 7:297-302), glutelin (rice endosperm), hordein (barley endosperm) (Marris, et al., (1988) Plant Mol. Biol. 10:359-366), glutenin and gliadin (wheat endosperm) (Colot, et al., (1987) EMBO J. 6:3559-3564) and sporamin (sweet potato tuberous root) (Hattori, et al., (1990) Plant Mol. Biol. 14:595-604). Promoters of seed-specific genes operably linked to heterologous coding regions in chimeric gene constructions maintain their temporal and spatial expression pattern in transgenic plants. Such examples include Arabidopsis thaliana 2S seed storage protein gene promoter to express enkephalin peptides in Arabidopsis and Brassica napus seeds (Vanderkerckhove, et al., (1989) Bio/Technology 7:L929-932), bean lectin and bean beta-phaseolin promoters to express luciferase (Riggs, et al., (1989) Plant Sci. 63:47-57) and wheat glutenin promoters to express chloramphenicol acetyl transferase (Colot, et al., (1987) EMBO J 6:3559-3564).
[0143] Inducible promoters selectively express an operably linked DNA sequence in response to the presence of an endogenous or exogenous stimulus, for example by chemical compounds (chemical inducers) or in response to environmental, hormonal, chemical and/or developmental signals. Inducible or regulated promoters include, for example, promoters regulated by light, heat, stress, flooding or drought, phytohormones, wounding or chemicals such as ethanol, jasmonate, salicylic acid or safeners.
[0144] Promoters for use in the current disclosure include the following: 1) the stress-inducible RD29A promoter (Kasuga, et al., (1999) Nature Biotechnol. 17:287-91); 2) the barley promoter, B22E; expression of B22E is specific to the pedicel in developing maize kernels (Klemsdal, et al., (1991) Mol. Gen. Genet. 228(1/2):9-16) and 3) maize promoter, Zag2 (Schmidt, et al., (1993) Plant Cell 5(7):729-737; Theissen, et al., (1995) Gene 156(2):155-166; NCBI GenBank Accession Number X80206)). Zag2 transcripts can be detected 5 days prior to pollination to 7 to 8 days after pollination ("DAP"), and directs expression in the carpel of developing female inflorescences and Ciml which is specific to the nucleus of developing maize kernels. Ciml transcript is detected 4 to 5 days before pollination to 6 to 8 DAP. Other useful promoters include any promoter which can be derived from a gene whose expression is maternally associated with developing female florets.
[0145] Additional promoters for regulating the expression of the nucleotide sequences of the present disclosure in plants are stalk-specific promoters. Such stalk-specific promoters include the alfalfa S2A promoter (GenBank Accession Number EF030816; Abrahams, et al., (1995) Plant Mol. Biol. 27:513-528) and S2B promoter (GenBank Accession Number EF030817) and the like, herein incorporated by reference.
[0146] Promoters may be derived in their entirety from a native gene or be composed of different elements derived from different promoters found in nature or even comprise synthetic DNA segments.
[0147] Promoters for use in the current disclosure may include: RIP2, mLIP15, ZmCOR1, Rab17, CaMV 35S, RD29A, B22E, Zag2, SAM synthetase, ubiquitin, CaMV 19S, nos, Adh, sucrose synthase, R-allele, the vascular tissue preferred promoters S2A (Genbank Accession Number EF030816) and S2B (Genbank Accession Number EF030817) and the constitutive promoter GOS2 from Zea mays. Other promoters include root preferred promoters, such as the maize NAS2 promoter, the maize Cyclo promoter (US 2006/0156439, published Jul. 13, 2006), the maize ROOTMET2 promoter (WO 2005/063998, published Jul. 14, 2005), the CR1BIO promoter (WO 2006/055487, published May 26, 2006), the CRWAQ81 (WO 2005/035770, published Apr. 21, 2005) and the maize ZRP2.47 promoter (NCBI Accession Number: U38790; GI Number 1063664).
[0148] Recombinant DNA constructs of the present disclosure may also include other regulatory sequences, including but not limited to, translation leader sequences, introns, and polyadenylation recognition sequences. In another embodiment of the present disclosure, a recombinant DNA construct of the present disclosure further comprises an enhancer or silencer.
[0149] An intron sequence can be added to the 5' untranslated region, the protein-coding region or the 3' untranslated region to increase the amount of the mature message that accumulates in the cytosol. Inclusion of a spliceable intron in the transcription unit in both plant and animal expression constructs has been shown to increase gene expression at both the mRNA and protein levels up to 1000-fold. Buchman and Berg, (1988) Mol. Cell Biol. 8:4395-4405; Callis, et al., (1987) Genes Dev. 1:1183-1200.
[0150] Any plant can be selected for the identification of regulatory sequences and PRE2 polypeptide genes to be used in recombinant DNA constructs of the present disclosure. Examples of suitable plant targets for the isolation of genes and regulatory sequences would include but are not limited to alfalfa, apple, apricot, Arabidopsis, artichoke, arugula, asparagus, avocado, banana, barley, beans, beet, blackberry, blueberry, broccoli, brussels sprouts, cabbage, canola, cantaloupe, carrot, cassava, castorbean, cauliflower, celery, cherry, chicory, cilantro, citrus, clementines, clover, coconut, coffee, corn, cotton, cranberry, cucumber, Douglas fir, eggplant, endive, escarole, eucalyptus, fennel, figs, garlic, gourd, grape, grapefruit, honey dew, jicama, kiwifruit, lettuce, leeks, lemon, lime, Loblolly pine, linseed, mango, melon, mushroom, nectarine, nut, oat, oil palm, oil seed rape, okra, olive, onion, orange, an ornamental plant, palm, papaya, parsley, parsnip, pea, peach, peanut, pear, pepper, persimmon, pine, pineapple, plantain, plum, pomegranate, poplar, potato, pumpkin, quince, radiata pine, radicchio, radish, rapeseed, raspberry, rice, rye, sorghum, Southern pine, soybean, spinach, squash, strawberry, sugarbeet, sugarcane, sunflower, sweet potato, sweetgum, tangerine, tea, tobacco, tomato, triticale, turf, turnip, a vine, watermelon, wheat, yams and zucchini.
[0151] Compositions:
[0152] A composition of the present disclosure is a plant comprising in its genome any of the recombinant DNA constructs of the present disclosure (such as any of the constructs discussed above). Compositions also include any progeny of the plant, and any seed obtained from the plant or its progeny, wherein the progeny or seed comprises within its genome the recombinant DNA construct. Progeny includes subsequent generations obtained by self-pollination or out-crossing of a plant. Progeny also includes hybrids and inbreds.
[0153] In hybrid seed propagated crops, mature transgenic plants can be self-pollinated to produce a homozygous inbred plant. The inbred plant produces seed containing the newly introduced recombinant DNA construct. These seeds can be grown to produce plants that would exhibit an altered agronomic characteristic (e.g., an increased agronomic characteristic optionally under water limiting conditions), or used in a breeding program to produce hybrid seed, which can be grown to produce plants that would exhibit such an altered agronomic characteristic. The seeds may be maize seeds.
[0154] The plant may be a monocotyledonous or dicotyledonous plant, for example, a maize, rice or soybean plant, such as a maize hybrid plant or a maize inbred plant. The plant may also be sunflower, sorghum, canola, wheat, alfalfa, cotton, barley, millet, sugarcane, switchgrass, tobacco, potato and sugar beet.
[0155] The recombinant DNA construct may be stably integrated into the genome of the plant.
[0156] Particularly embodiments include but are not limited to the following:
[0157] 1. A plant (for example, a maize, rice or soybean plant) comprising in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory sequence, wherein said polynucleotide encodes a polypeptide having an amino acid sequence of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity, based on the Clustal W method of alignment, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and wherein said plant exhibits increased drought tolerance when compared to a control plant not comprising said recombinant DNA construct. The plant may further exhibit an alteration of at least one agronomic characteristic when compared to the control plant.
[0158] 2. A plant (for example, a maize, rice or soybean plant) comprising in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory sequence, wherein said polynucleotide encodes a PRE2 polypeptide, and wherein said plant exhibits increased drought tolerance when compared to a control plant not comprising said recombinant DNA construct. The plant may further exhibit an alteration of at least one agronomic characteristic when compared to the control plant.
[0159] 3. A plant (for example, a maize, rice or soybean plant) comprising in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory sequence, wherein said polynucleotide encodes a PRE2 polypeptide, and wherein said plant exhibits an alteration of at least one agronomic characteristic when compared to a control plant not comprising said recombinant DNA construct.
[0160] 4. A plant (for example, a maize, rice or soybean plant) comprising in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide encodes a polypeptide having an amino acid sequence of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity, based on the Clustal W method of alignment, when compared to a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26, and wherein said plant exhibits an alteration of at least one agronomic characteristic when compared to a control plant not comprising said recombinant DNA construct.
[0161] 5. A plant (for example, a maize, rice or soybean plant) comprising in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is: (a) hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; or (b) a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; and wherein said plant exhibits increased drought tolerance when compared to a control plant not comprising said recombinant DNA construct.
[0162] 6. A plant (for example, a maize, rice or soybean plant) comprising in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is: (a) hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; or (b) a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; and wherein said plant exhibits an alteration of at least one agronomic characteristic when compared to a control plant not comprising said recombinant DNA construct.
[0163] 8. Any progeny of the above plants in embodiments 1-7, any seeds of the above plants in embodiments 1-7, any seeds of progeny of the above plants in embodiments 1-7, and cells from any of the above plants in embodiments 1-6 and progeny thereof.
[0164] In any of the foregoing embodiments 1-8 or any other embodiments of the present disclosure, the PRE2 polypeptide may be from Arabidopsis thaliana, Zea mays, Glycine max, Glycine tabacina, Glycine soja or Glycine tomentella.
[0165] In any of the foregoing embodiments 1-8 or any other embodiments of the present disclosure, the recombinant DNA construct may comprise at least a promoter functional in a plant as a regulatory sequence.
[0166] In any of the foregoing embodiments 1-8 or any other embodiments of the present disclosure, the alteration of at least one agronomic characteristic is either an increase or decrease.
[0167] In any of the foregoing embodiments 1-8 or any other embodiments of the present disclosure, the at least one agronomic characteristic may be selected from the group consisting of greenness, yield, growth rate, biomass, fresh weight at maturation, dry weight at maturation, fruit yield, seed yield, total plant nitrogen content, fruit nitrogen content, seed nitrogen content, nitrogen content in a vegetative tissue, total plant free amino acid content, fruit free amino acid content, seed free amino acid content, free amino acid content in a vegetative tissue, total plant protein content, fruit protein content, seed protein content, protein content in a vegetative tissue, drought tolerance, nitrogen uptake, root lodging, harvest index, stalk lodging, plant height, ear height, ear length, salt tolerance, early seedling vigor and seedling emergence under low temperature stress. For example, the alteration of at least one agronomic characteristic may be an increase in yield, greenness or biomass.
[0168] In any of the foregoing embodiments 1-8 or any other embodiments of the present disclosure, the plant may exhibit the alteration of at least one agronomic characteristic when compared, under water limiting conditions, to a control plant not comprising said recombinant DNA construct.
[0169] "Drought" refers to a decrease in water availability to a plant that, especially when prolonged, can cause damage to the plant or prevent its successful growth (e.g., limiting plant growth or seed yield).
[0170] "Drought tolerance" is a trait of a plant to survive under drought conditions over prolonged periods of time without exhibiting substantial physiological or physical deterioration.
[0171] "Increased drought tolerance" of a plant is measured relative to a reference or control plant, and is a trait of the plant to survive under drought conditions over prolonged periods of time, without exhibiting the same degree of physiological or physical deterioration relative to the reference or control plant grown under similar drought conditions. Typically, when a transgenic plant comprising a recombinant DNA construct in its genome exhibits increased drought tolerance relative to a reference or control plant, the reference or control plant does not comprise in its genome the recombinant DNA construct.
[0172] One of ordinary skill in the art is familiar with protocols for simulating drought conditions and for evaluating drought tolerance of plants that have been subjected to simulated or naturally-occurring drought conditions. For example, one can simulate drought conditions by giving plants less water than normally required or no water over a period of time, and one can evaluate drought tolerance by looking for differences in physiological and/or physical condition, including (but not limited to) vigor, growth, size, or root length, or in particular, leaf color or leaf area size. Other techniques for evaluating drought tolerance include measuring chlorophyll fluorescence, photosynthetic rates and gas exchange rates.
[0173] A drought stress experiment may involve a chronic stress (i.e., slow dry down) and/or may involve two acute stresses (i.e., abrupt removal of water) separated by a day or two of recovery. Chronic stress may last 8-10 days. Acute stress may last 3-5 days. The following variables may be measured during drought stress and well watered treatments of transgenic plants and relevant control plants:
[0174] The variable "% area chg_start chronic--acute2" is a measure of the percent change in total area determined by remote visible spectrum imaging between the first day of chronic stress and the day of the second acute stress
[0175] The variable "% area chg_start chronic--end chronic" is a measure of the percent change in total area determined by remote visible spectrum imaging between the first day of chronic stress and the last day of chronic stress.
[0176] The variable "% area chg_start chronic--harvest" is a measure of the percent change in total area determined by remote visible spectrum imaging between the first day of chronic stress and the day of harvest.
[0177] The variable "% area chg_start chronic--recovery24 hr" is a measure of the percent change in total area determined by remote visible spectrum imaging between the first day of chronic stress and 24 hrs into the recovery (24 hrs after acute stress 2).
[0178] The variable "psii_acute1" is a measure of Photosystem II (PSII) efficiency at the end of the first acute stress period. It provides an estimate of the efficiency at which light is absorbed by PSII antennae and is directly related to carbon dioxide assimilation within the leaf.
[0179] The variable "psii_acute2" is a measure of Photosystem II (PSII) efficiency at the end of the second acute stress period. It provides an estimate of the efficiency at which light is absorbed by PSII antennae and is directly related to carbon dioxide assimilation within the leaf.
[0180] The variable "fv/fm_acute1" is a measure of the optimum quantum yield (Fv/Fm) at the end of the first acute stress--(variable fluorescence difference between the maximum and minimum fluorescence/maximum fluorescence).
[0181] The variable "fv/fm_acute2" is a measure of the optimum quantum yield (Fv/Fm) at the end of the second acute stress--(variable flourescence difference between the maximum and minimum fluorescence/maximum fluorescence).
[0182] The variable "leaf rolling_harvest" is a measure of the ratio of top image to side image on the day of harvest.
[0183] The variable "leaf rolling_recovery24 hr" is a measure of the ratio of top image to side image 24 hours into the recovery.
[0184] The variable "Specific Growth Rate (SGR)" represents the change in total plant surface area (as measured by an imaging instrument) over a single day (Y(t)=Y0*e.sup.r*t). Y(t)=Y0*e.sup.r*t is equivalent to % change in Y/.DELTA.t where the individual terms are as follows: Y(t)=Total surface area at t; Y0=Initial total surface area (estimated); r=Specific Growth Rate day.sup.-1, and t=Days After Planting ("DAP").
[0185] The variable "shoot dry weight" is a measure of the shoot weight 96 hours after being placed into a 104.degree. C. oven.
[0186] The variable "shoot fresh weight" is a measure of the shoot weight immediately after being cut from the plant.
[0187] The Examples below describe some representative protocols and techniques for simulating drought conditions and/or evaluating drought tolerance.
[0188] One can also evaluate drought tolerance by the ability of a plant to maintain sufficient yield (at least 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% yield) in field testing under simulated or naturally-occurring drought conditions (e.g., by measuring for substantially equivalent yield under drought conditions compared to non-drought conditions, or by measuring for less yield loss under drought conditions compared to a control or reference plant).
[0189] One of ordinary skill in the art would readily recognize a suitable control or reference plant to be utilized when assessing or measuring an agronomic characteristic or phenotype of a transgenic plant in any embodiment of the present disclosure in which a control plant is utilized (e.g., compositions or methods as described herein). For example, by way of non-limiting illustrations:
[0190] 1. Progeny of a transformed plant which is hemizygous with respect to a recombinant DNA construct, such that the progeny are segregating into plants either comprising or not comprising the recombinant DNA construct: the progeny comprising the recombinant DNA construct would be typically measured relative to the progeny not comprising the recombinant DNA construct (i.e., the progeny not comprising the recombinant DNA construct is the control or reference plant).
[0191] 2. Introgression of a recombinant DNA construct into an inbred line, such as in maize, or into a variety, such as in soybean: the introgressed line would typically be measured relative to the parent inbred or variety line (i.e., the parent inbred or variety line is the control or reference plant).
[0192] 3. Two hybrid lines, where the first hybrid line is produced from two parent inbred lines and the second hybrid line is produced from the same two parent inbred lines except that one of the parent inbred lines contains a recombinant DNA construct: the second hybrid line would typically be measured relative to the first hybrid line (i.e., the first hybrid line is the control or reference plant).
[0193] 4. A plant comprising a recombinant DNA construct: the plant may be assessed or measured relative to a control plant not comprising the recombinant DNA construct but otherwise having a comparable genetic background to the plant (e.g., sharing at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity of nuclear genetic material compared to the plant comprising the recombinant DNA construct. There are many laboratory-based techniques available for the analysis, comparison and characterization of plant genetic backgrounds; among these are Isozyme Electrophoresis, Restriction Fragment Length Polymorphisms (RFLPs), Randomly Amplified Polymorphic DNAs (RAPDs), Arbitrarily Primed Polymerase Chain Reaction (AP-PCR), DNA Amplification Fingerprinting (DAF), Sequence Characterized Amplified Regions (SCARs), Amplified Fragment Length Polymorphisms (AFLP.RTM.s) and Simple Sequence Repeats (SSRs) which are also referred to as Microsatellites.
[0194] Furthermore, one of ordinary skill in the art would readily recognize that a suitable control or reference plant to be utilized when assessing or measuring an agronomic characteristic or phenotype of a transgenic plant would not include a plant that had been previously selected, via mutagenesis or transformation, for the desired agronomic characteristic or phenotype.
[0195] Methods:
[0196] Methods include but are not limited to methods for increasing drought tolerance in a plant, methods for evaluating drought tolerance in a plant, methods for altering an agronomic characteristic in a plant, methods for determining an alteration of an agronomic characteristic in a plant, and methods for producing seed. The plant may be a monocotyledonous or dicotyledonous plant, for example, a maize, rice or soybean plant. The plant may also be sunflower, sorghum, canola, wheat, alfalfa, cotton, barley or millet. The seed may be a maize, rice or soybean seed, for example, a maize hybrid seed or maize inbred seed.
[0197] Methods include but are not limited to the following:
[0198] A method for transforming a cell comprising transforming a cell with any of the isolated polynucleotides of the present disclosure. The cell transformed by this method is also included. In particular embodiments, the cell is eukaryotic cell, e.g., a yeast, insect or plant cell or prokaryotic, e.g., a bacterial cell.
[0199] A method for producing a transgenic plant comprising transforming a plant cell with any of the isolated polynucleotides or recombinant DNA constructs of the present disclosure and regenerating a transgenic plant from the transformed plant cell. The disclosure is also directed to the transgenic plant produced by this method and transgenic seed obtained from this transgenic plant.
[0200] A method for isolating a polypeptide of the disclosure from a cell or culture medium of the cell, wherein the cell comprises a recombinant DNA construct comprising a polynucleotide of the disclosure operably linked to at least one regulatory sequence and wherein the transformed host cell is grown under conditions that are suitable for expression of the recombinant DNA construct.
[0201] A method of altering the level of expression of a polypeptide of the disclosure in a host cell comprising: (a) transforming a host cell with a recombinant DNA construct of the present disclosure; and (b) growing the transformed host cell under conditions that are suitable for expression of the recombinant DNA construct wherein expression of the recombinant DNA construct results in production of altered levels of the polypeptide of the disclosure in the transformed host cell.
[0202] A method of increasing drought tolerance in a plant, comprising: (a) introducing into a regenerable plant cell a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory sequence (for example, a promoter functional in a plant), wherein the polynucleotide encodes a polypeptide having an amino acid sequence of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity, based on the Clustal W method of alignment, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and (b) regenerating a transgenic plant from the regenerable plant cell after step (a), wherein the transgenic plant comprises in its genome the recombinant DNA construct and exhibits increased drought tolerance when compared to a control plant not comprising the recombinant DNA construct. The method may further comprise (c) obtaining a progeny plant derived from the transgenic plant, wherein said progeny plant comprises in its genome the recombinant DNA construct and exhibits increased drought tolerance when compared to a control plant not comprising the recombinant DNA construct.
[0203] A method of increasing drought tolerance in a plant, comprising: (a) introducing into a regenerable plant cell a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is: (a) hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; or (b) a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; and (b) regenerating a transgenic plant from the regenerable plant cell after step (a), wherein the transgenic plant comprises in its genome the recombinant DNA construct and exhibits increased drought tolerance when compared to a control plant not comprising the recombinant DNA construct. The method may further comprise (c) obtaining a progeny plant derived from the transgenic plant, wherein said progeny plant comprises in its genome the recombinant DNA construct and exhibits increased drought tolerance when compared to a control plant not comprising the recombinant DNA construct.
[0204] A method of evaluating drought tolerance in a plant, comprising (a) obtaining a transgenic plant, wherein the transgenic plant comprises in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory sequence (for example, a promoter functional in a plant), wherein said polynucleotide encodes a polypeptide having an amino acid sequence of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity, based on the Clustal W method of alignment, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (b) obtaining a progeny plant derived from said transgenic plant, wherein the progeny plant comprises in its genome the recombinant DNA construct; and (c) evaluating the progeny plant for drought tolerance compared to a control plant not comprising the recombinant DNA construct.
[0205] A method of evaluating drought tolerance in a plant, comprising (a) obtaining a transgenic plant, wherein the transgenic plant comprises in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is: (a) hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; or (b) a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (b) obtaining a progeny plant derived from said transgenic plant, wherein the progeny plant comprises in its genome the recombinant DNA construct; and (c) evaluating the progeny plant for drought tolerance compared to a control plant not comprising the recombinant DNA construct.
[0206] A method of determining an alteration of an agronomic characteristic in a plant, comprising (a) obtaining a transgenic plant, wherein the transgenic plant comprises in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory sequence (for example, a promoter functional in a plant), wherein said polynucleotide encodes a polypeptide having an amino acid sequence of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity, based on the Clustal W method of alignment, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (b) obtaining a progeny plant derived from said transgenic plant, wherein the progeny plant comprises in its genome the recombinant DNA construct; and (c) determining whether the progeny plant exhibits an alteration in at least one agronomic characteristic when compared, optionally under water limiting conditions, to a control plant not comprising the recombinant DNA construct.
[0207] A method of determining an alteration of an agronomic characteristic in a plant, comprising (a) obtaining a transgenic plant, wherein the transgenic plant comprises in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is: (a) hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; or (b) a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (b) obtaining a progeny plant derived from said transgenic plant, wherein the progeny plant comprises in its genome the recombinant DNA construct; and (c) determining whether the progeny plant exhibits an alteration in at least one agronomic characteristic when compared, optionally under water limiting conditions, to a control plant not comprising the recombinant DNA construct.
[0208] A method of producing seed (for example, seed that can be sold as a drought tolerant product offering) comprising any of the preceding methods and further comprising obtaining seeds from said progeny plant, wherein said seeds comprise in their genome said recombinant DNA construct.
[0209] In any of the preceding methods or any other embodiments of methods of the present disclosure, in said introducing step said regenerable plant cell may comprise a callus cell, an embryogenic callus cell, a gametic cell, a meristematic cell or a cell of an immature embryo. The regenerable plant cells may derive from an inbred maize plant.
[0210] In any of the preceding methods or any other embodiments of methods of the present disclosure, said regenerating step may comprise the following: (i) culturing said transformed plant cells in a media comprising an embryogenic promoting hormone until callus organization is observed; (ii) transferring said transformed plant cells of step (i) to a first media which includes a tissue organization promoting hormone; and (iii) subculturing said transformed plant cells after step (ii) onto a second media, to allow for shoot elongation, root development or both.
[0211] In any of the preceding methods or any other embodiments of methods of the present disclosure, the at least one agronomic characteristic may be selected from the group consisting of greenness, yield, growth rate, biomass, fresh weight at maturation, dry weight at maturation, fruit yield, seed yield, total plant nitrogen content, fruit nitrogen content, seed nitrogen content, nitrogen content in a vegetative tissue, total plant free amino acid content, fruit free amino acid content, seed free amino acid content, amino acid content in a vegetative tissue, total plant protein content, fruit protein content, seed protein content, protein content in a vegetative tissue, drought tolerance, nitrogen uptake, root lodging, harvest index, stalk lodging, plant height, ear height, ear length, salt tolerance, early seedling vigor and seedling emergence under low temperature stress. The alteration of at least one agronomic characteristic may be an increase in yield, greenness or biomass.
[0212] In any of the preceding methods or any other embodiments of methods of the present disclosure, the plant may exhibit the alteration of at least one agronomic characteristic when compared, under water limiting conditions, to a control plant not comprising said recombinant DNA construct.
[0213] In any of the preceding methods or any other embodiments of methods of the present disclosure, alternatives exist for introducing into a regenerable plant cell a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory sequence. For example, one may introduce into a regenerable plant cell a regulatory sequence (such as one or more enhancers, optionally as part of a transposable element) and then screen for an event in which the regulatory sequence is operably linked to an endogenous gene encoding a polypeptide of the instant disclosure.
[0214] Transgenic plants comprising or derived from plant cells or native plants with reduced Pre2 expression or activity of this disclosure can be further enhanced with stacked traits, e.g. a crop plant having an enhanced trait resulting from expression of DNA disclosed herein in combination with herbicide tolerance and/or pest resistance traits. For example, plants with reduced Pre2 expression can be stacked with other traits of agronomic interest, such as a trait providing herbicide resistance and/or insect resistance, such as using a gene from Bacillus thuringensis to provide resistance against one or more of lepidopteran, coliopteran, homopteran, hemiopteran and other insects. Known genes that confer tolerance to herbicides such as e.g., auxin, HPPD, glyphosate, dicamba, glufosinate, sulfonylurea, bromoxynil and norflurazon herbicides can be stacked either as a molecular stack or a breeding stack with plants expressing the traits disclosed herein. Polynucleotide molecules encoding proteins involved in herbicide tolerance include, but are not limited to, a polynucleotide molecule encoding 5-enolpyruvylshikimate-3-phosphate synthase (EPSPS) disclosed in U.S. Pat. Nos. 39,247; 6,566,587 and for imparting glyphosate tolerance; polynucleotide molecules encoding a glyphosate oxidoreductase (GOX) disclosed in U.S. Pat. No. 5,463,175 and a glyphosate-N-acetyl transferase (GAT) disclosed in U.S. Pat. Nos. 7,622,641; 7,462,481; 7,531,339; 7,527,955; 7,709,709; 7,714,188 and 7,666,643 also for providing glyphosate tolerance; dicamba monooxygenase disclosed in U.S. Pat. No. 7,022,896 and WO 2007/146706 A2 for providing dicamba tolerance; a polynucleotide molecule encoding AAD12 disclosed in US Patent Application Publication Number 2005/731044 or WO 2007/053482 A2 or encoding AAD1 disclosed in US 2011/0124503 A1 or U.S. Pat. No. 7,838,733 for providing tolerance to auxin herbicides (2,4-D); a polynucleotide molecule encoding hydroxyphenylpyruvate dioxygenase (HPPD) for providing tolerance to HPPD inhibitors (e.g., hydroxyphenylpyruvate dioxygenase) disclosed in e.g., U.S. Pat. No. 7,935,869; US 2009/0055976 A1 and US 2011/0023180 A1, each publication is herein incorporated by reference in its entirety.
[0215] Other examples of herbicide-tolerance traits that could be combined with the traits disclosed herein include those conferred by polynucleotides encoding an exogenous phosphinothricin acetyltransferase, as described in U.S. Pat. Nos. 5,969,213; 5,489,520; 5,550,318; 5,874,265; 5,919,675; 5,561,236; 5,648,477; 5,646,024; 6,177,616 and 5,879,903. Plants containing an exogenous phosphinothricin acetyltransferase can exhibit improved tolerance to glufosinate herbicides, which inhibit the enzyme glutamine synthase. Other examples of herbicide-tolerance traits include those conferred by polynucleotides conferring altered protoporphyrinogen oxidase (protox) activity, as described in U.S. Pat. Nos. 6,288,306 B1; 6,282,837 B1 and 5,767,373 and International Patent Publication WO 2001/12825. Plants containing such polynucleotides can exhibit improved tolerance to any of a variety of herbicides which target the protox enzyme (also referred to as "protox inhibitors").
[0216] The introduction of recombinant DNA constructs of the present disclosure into plants may be carried out by any suitable technique, including but not limited to direct DNA uptake, chemical treatment, electroporation, microinjection, cell fusion, infection, vector-mediated DNA transfer, bombardment or Agrobacterium-mediated transformation. Techniques for plant transformation and regeneration have been described in International Patent Publication WO 2009/006276, the contents of which are herein incorporated by reference.
[0217] The development or regeneration of plants containing the foreign, exogenous isolated nucleic acid fragment that encodes a protein of interest is well known in the art. The regenerated plants may be self-pollinated to provide homozygous transgenic plants. Otherwise, pollen obtained from the regenerated plants is crossed to seed-grown plants of agronomically important lines. Conversely, pollen from plants of these important lines is used to pollinate regenerated plants. A transgenic plant of the present disclosure containing a desired polypeptide is cultivated using methods well known to one skilled in the art.
TABLE-US-00003 TABLE 1A Expression of maize Pre2 in different tissues as compiled from MPSS-Signature Platform Expression Tissue (PPTM) Dev. Stage Treatment Leaf 2880 V5 ECB Kernel 1750 R1 Drought Stress Anther 1270 VT Control Apical Meristem, pre-floral 1110 V3 Endosperm 1080 R1 In vitro Immature Ear 800 V9 Pedicel and Basal Layer 710 R3 Root 560 V12 Hydroponic Lateral Branch Meristem 540 V8 Pericarp 460 R4 Stalk 390 Vn Colletotrichum Leaf midrib 370 V7 Nitrate 4 h Stalk internode 350 V10-V11 meristematic zone Germination Embryo 320 VE Root cortex 320 V1 Nitrate-4 hr Aleurone 280 R3 Stalk nodal plate 270 V10-V11 Vegetative Lateral 200 V8 Meristems Stalk rind 170 V10-V11 Root stele 100 V1 Nitrate-4 hr Germination Scutellum 90 VE Tassel Spikelet 90 VT Tilt Herbicide Pollen 70 VT Silk 30 R1
TABLE-US-00004 TABLE 1B Expression of maize Pre2 in different tissues as compiled from MPSS-Classic Platform Tissue Expression (PPTM) Dev. Stage Treatment Embryo 990 R2 Aerial Vegetative 950 Vn Apical Meristem 820 Vn Root 770 V6-V8 Stalk 760 V6 Immature ear 760 Vn Stalk Node 580 V12-V13 Ear Shoot 530 V11 Leaf 500 V6-V8 Transgene Pericarp 490 R4 Stalk Internode Rind 440 V12-V13 Leaf-base 390 V3 Leaf Whorl ECB 390 V5 ECB infestation Endosperm 380 R5 Stalk Internode 340 VT Pedicel 340 R1-R2 Drought stress Kernel 340 R2 Tassel Spikelet 320 VT Root Tip Meristem 300 V6 Ovary 290 Vn Silk 290 VT Tassel 280 Vn Pollen 280 VT Stem, Sheath 260 V7-V8 Ear 230 V15-R1 Stalk Internode Pith 220 VT Mesocotyl 110 VE Stalk Leaf Pulvinus 100 VT Husk 80 R1 Stalk Node 40 V12-V13
TABLE-US-00005 TABLE 1C Expression of maize Pre2 in different tissues as compiled from Solexa-WgT Platform Tissue Expression (PPTM) Dev. Stage Tassel 359.04 V6 Root 349.75 V19 Immature Ear 319.93 V8 Embryo 270.21 VE Leaf 230.42 V19 Kernel 211.82 R2 Root Hair 188.91 V1 Endosperm 173.4 R4 Pericarp 137.11 R4 Stalk 94.79 V8 Pollen 52.79 R1
EXAMPLES
[0218] The Examples described below form part of the detailed description of the disclosure. The present disclosure is further illustrated in the following Examples, in which parts and percentages are by weight and degrees are Celsius, unless otherwise stated. It should be understood that these Examples, while indicating preferred embodiments of the disclosure, are given by way of illustration only. From the above discussion and these Examples, one skilled in the art can ascertain the essential characteristics of this disclosure, and without departing from the spirit and scope thereof, can make various changes and modifications of the disclosure to adapt it to various usages and conditions. Thus, various modifications of the disclosure in addition to those shown and described herein will be apparent to those skilled in the art from the foregoing description. Such modifications are also intended to fall within the scope of the appended claims.
Example 1
Characterization of the Pre-Mature Senescence2 (Pre2) Mutation in Maize
[0219] Forward genetics was used to clone a pre-mature senescence2 (pre2) mutation isolated from a highly Mu-active stock. The senescing phenotype of pre2, which inherits in a recessive manner, is apparent 2-3 weeks prior to anthesis. Like natural senescence, the pre2 phenotype starts from the lowermost leaves and then spreads to the top of the plant in a progressive fashion (FIG. 1A). We have cloned a candidate gene for pre2 mutation using SAIFF protocol (Selective Amplification of Insertion Flanking Fragments). The candidate gene co-segregates completely with the phenotype in a population of 500 segregating F2 plants (FIG. 1B). The pre2 encodes a conserved protein of no previously known function and is expressed at very low level (less than 100 PPM) in almost all parts of corn plant. The pre2 mutant phenotype was found to be the result of an interference of the insertion in differential splicing of intron1 in the transcript (FIG. 2A), which further leads to an early termination codon in its peptide. The Mu insertion in the mutant resulted in expression 4 different species of mRNA with variable expression levels (FIG. 2A). In addition to wild type mRNA, the mutant also expresses mRNAs with 122, 170 and 373 bp insertions which due to pre mature stop codons translated into predicted polypeptides of 113, 49 and 113 amino acid residues in addition to 1271 amino acid wild type polypeptide (FIG. 2A). Reverse genetics and allelic test of two independent mutant alleles (pre2-2 and pre2-3) provided proof-of-validation that the right gene for pre2 mutation had been cloned (FIG. 2C). Only a few partial ESTs representing 3' end of the gene were found in the database, thus a full length cDNA of 3.9 kb was amplified using RT-PCR (FIG. 2B) and cloned into a cloning vector. The maize pre2 gene includes of 13 exons and 12 introns and has 1271 amino acid long peptide. The Zmpre2 gene was mapped to chr4 on bin 189 cM. The maize Pre2 gene expression was compiled from different libraries developed by DuPont-Pioneer using various corn tissues at different developmental stages under different treatments. The gene expression value measured in PPTM by using three platforms, MPSS-Signature, MPSS-Classic and Solexa-WgT, is summarized in Table 1A, 1B, and 10. The Pre2 gene expression is enhanced under drought stress, insect infestation, disease inoculation, herbicide spray, and Nitrate application. The Pre2 is expressing in almost all plant parts of corn with maximum expression in leaf at V5 stage followed by kernel, anther, embryo, apical meristem, and root at V6-V8 stage.
Example 2
Identification and Characterization of the Pre2 Knock-Out Mutant in Arabidopsis
[0220] Homologous sequence of Pre2 in Arabidopsis was identified by using corn candidate gene sequence for pre-mature senescence2 as query. Then by using Atpre2 gene sequence, three independent T-DNA insertional alleles (Salk_017615, Salk_079273, Salk_107247) were identified in the Arabidopsis T-DNA mutant database. As in both SALK_079273 and SALK_107247 lines the T-DNA is situated in the 3' UTR region of the candidate gene (FIG. 4; top panel), Salk_017615 was analyzed in which the T-DNA is present in the coding sequence. This mutant line was obtained from ABRC and plants were grown and subjected to PCR fingerprinting and RT-PCR analyses. PCR amplification of the T-DNA flanking sequences using gene specific primer along with T-DNA primer confirmed that the T-DNA insertion is present in exon10 of At-PRE2 gene (FIG. 4; upper panel). Genomic PCRs using gene and T-DNA specific primers also showed that all plants were having T-DNA in the Atpre2 gene (FIG. 3, 2.sup.nd panel from top). The gene specific primers flanking the T-DNA insertion will amplify DNA region in wild-type (WT) plants and right size PCR product was present in all plant except plant #11 and #25 (FIG. 3, 3.sup.rd panel from top) indicating that all plants except #11 and #25 were heterozygous for this insertion. PCR amplification of Actin in both mutant and wild type plants was used as control (FIG. 4; 4.sup.th panel from top). Based on these genotyping results plant #11 and 25 were identified as homozygous for T-DNA insertion. Expression of Pre2 is low in Arabidopsis and almost present in plant parts but highest was noticed in siliques and maturing seeds (FIG. 3). Furthermore, Reverse Transcriptase Polymerase Chain Reaction (RT-PCR) was performed on these plants and, but a full length transcript of AtPre2 mRNA was not detected in plant #11 and #25 (35 cycles) indicating that AtPre2 gene expression is knocked out in these two T-DNA mutants. We harvested seed from the two homozygous and all heterozygous plants. In order to identify and multiply the seed of WT-sib (+/+), seeds from the next generation from a self progeny of heterozygous plant were grown and PCR fingerprinting was repeated. The homozygous nature of T-DNA knock out in plant #11 and #25 was confirmed and the seeds were multiplied. Morphological traits from both homozygous plant #11 and #25 were compared with homozygous WT-sib (+/+) and heterozygous WT-sib (+/Pre2) at flowering. Both homozygous mutants were robust in growth with more pod numbers but were late in maturity by 4 to 5 days as compared to its WT-sibs (FIG. 5A). For measuring total biomass, 9 whole plants, each of knock out #11, knock out #25, homozygous WT, and heterozygous WT-sibs, were harvested and air dried for 14 days at room temperature. Total weight was determined by weighing and average and standard deviation were calculated for statistical analysis. The total biomass of both knockouts (combined) was found to be significantly higher (t test at P<0.01) when compared to both homozygous and heterozygous WT-sibs (FIG. 5B).
Example 3
Overexpression of Atpre2 in Arabidopsis
[0221] Multisite Gateway (Invitrogen) technology was used to generate plant expression vectors. A 3978 bp coding sequence of AtPre2 (at1g72390) was amplified by PCR using forward and reverse gene specific primers (GSP-F+GSP-R) and cloned in pENTR.D.TOPO. The final expression vector (pRG1261) contained herbicide and fluorescent marker for transgenic seed sorting. Quality check was performed on the resulting expression vector by restriction digestion mapping and transferred into Agrobacterium tumefaciens LB4404JT by electroporation. The co-integrated DNA from transformed Agrobacterium was transferred in E. coli DH10B and the plasmid DNA from this strain was used to check its quality again by restriction digestion. These overexpression vectors were transformed in to Arabidopsis thaliana ecotype Columbia-0 by Agobacterium mediated Floral-Dip' method (Clough and Bent, (1998) Plant Journal 16:735). T.sub.0 seeds were screened for T1 transformants in soil for herbicide resistance. For molecular analysis of the transgenic T1 events, RT-PCRs were conducted to detect the transgene expression, actin control and the presence of genomic DNA in the RNA preparations. Transgene expressing events were advanced for further studies. Overrexpression of ZmPre2 coding sequence in Arabidopsis resulted in a hypersensitive response to drought. (See, FIG. 6B).
Example 4
Sub-Cellular Localization and Regulation of Expression of Atpre2
[0222] In order to determine the sub-cellular localization AcGFP was fused in the c-terminal of AtPRE2. This fusion cassette was either driven by 35S promoter (pRG1263) or by ATPRE2 promoter (518 bp region upstream of start codon of Atpre2) in pRG1264. Similarly, in order to study the regulation of expression of AtPre2 in details, this 518 bp promoter region of Atpre2 was fused to GUS:RFP (a dual reporter) to generate pRG1265. All these constructs were transformed into Arabidopsis as described in Example 3.
Example 5
Drought Analysis of T-DNA Knockout Mutant and Over-Expressed Pre2 in Arabidopsis
[0223] Drought assay was performed on total 72 mutants and 72 wild-type sibs (WT) by using 8 pots (cells) for each. Each pot was sown to produce 9 mutant s or WT seedlings in a 3.times.3 array. Flats are configured with 8 square pots each in one experiment. Each pot was filled with Scotts.RTM. Metro-Mix.RTM. 200 soil. The soil was watered to saturation and then plants were grown under standard conditions of 16 hour light, 8 hour dark cycle; 22.degree. C.; "60% relative humidity). No additional water was given after day 16.sup.th.
[0224] Digital images of the plants were taken at the onset of visible drought stress symptoms. Images were taken once a day (at the same time of day), until the plants appear dessicated. Typically, four consecutive days of data is captured. Color analysis was employed for identifying potential drought tolerant lines. Color analysis can be used to measure the increase in the percentage of leaf area that falls into a yellow color bin. Using hue, saturation and intensity data ("HSI"), the yellow color bin consists of hues 35 to 45. Maintenance of leaf area was also used as another criterion for identifying potential drought tolerant lines, since Arabidopsis leaves wilt during drought stress. Maintenance of leaf area can be measured as reduction of rosette leaf area over time. Leaf area was measured in terms of the number of green pixels obtained using an imaging system. Mutant and control (e.g. wild-type) plants were grown side by side in flats and when wilting begins. From these data wilting profiles are determined based on the green pixel counts obtained over four consecutive days for activation-tagged or knockout mutant plants and accompanying control plants. The profile was selected from a series of measurements over the four day period that provided the largest degree of wilting. The ability to withstand drought was measured by the tendency of plants to resist wilting compared to control their WT-sib plants (FIG. 6A).
[0225] Software was used to analyze CCD images. Estimates of the leaf area of the Arabidopsis plants were obtained in terms of the number of green pixels. The data for each image was averaged to obtain estimates of mean and standard deviation for the green pixel counts for activation-tagged and wild-type plants. Parameters for a noise function were obtained by straight line regression of the squared deviation versus the mean pixel count using data for all images in a batch. Error estimates for the mean pixel count data were calculated using the fit parameters for the noise function. The mean pixel counts for activation-tagged and wild-type plants are summed to obtain an assessment of the overall leaf area for each image. The four-day interval with maximal wilting was obtained by selecting the interval that corresponds to the maximum difference in plant growth. The individual wilting responses of the activation-tagged, knockout mutants, and wild-type plants were obtained by normalization of the data using the value of the green pixel count of the first day in the interval. The drought tolerance of the activation-tagged or ko mutant plants compared to the wild-type plant was scored by summing the weighted difference between the wilting response of mutant or activation-tagged plants and wild-type plants over day two to day four; the weights were estimated by propagating the error in the data. A positive drought tolerance score corresponds to an activation-tagged or mutant plant with slower wilting compared to the wild-type plant. Significance of the difference in wilting response between activation-tagged and wild-type plants was obtained from the weighted sum of the squared deviations.
[0226] In drought assay the Atpre2 mutant plants were showing positive score greater than 0.9 with positive standard deviation in all flats. This demonstrated that these mutant plants outperformed significantly better than their wild type sibs used as control (FIG. 6B). The second control used in this experiment was ZmPre2 gene over expressed under 35S promoter in Arabidopsis. These plants became hypersensitive to drought stress (FIG. 6B) further authenticated these drought assay results.
Example 6
Analysis of Atpre2 Mutants on Low and High Nitrogen
[0227] For low nitrogen (Low N) plate assays, 32 mutant and 32 wild type plants were grown on square plates (15 mm.times.15 mm) containing 0.5.times.N-Free Hoagland's, 0.4 mM potassium nitrate, 0.1% sucrose, 1 mM MES and 0.25% Phytagel.TM. (Low N medium). Plates were kept for three days in the dark at 4.degree. C. to stratify seeds and then placed horizontally for nine days at 22.degree. C. light and 20.degree. C. dark. Plates were placed under sixteen hours light and eight hours dark, with an average light intensity of .about.200 mmol/m.sup.2/s. Plates were rotated and shuffled daily within each shelf. At day twelve (nine days of growth), seedling status was evaluated by imaging the entire plate. After masking the plate image to remove background color, two different measurements were collected for each individual plant: total rosette area, and the percentage of color that falls into a green color bin using hue, saturation and intensity data (HSI). The green color bin consists of hues 50 to 66. Total rosette area was used as a measure of plant biomass, whereas the green color bin was shown by dose-response studies to be an indicator of nitrogen assimilation. In this assay Atpre2 mutant plants showed a significantly higher total area (biomass) and green color (Bin2 area) (FIG. 7).
[0228] For high nitrogen (High N) root assays, 16 mutants and 16 wild type plants instead of 32 each were grown on plates in the same light and temperature conditions as described above. The plates were having the same medium except it was containing 60 mM of potassium nitrate. N and root biomass was measured by imaging. Four independent experiments were performed and the data revealed that in each case mutant plants were hyper-sensitive to higher concentration of nitrogen which leads to severe root growth inhibition as compared to its wild type sib plants (FIG. 8).
Example 7
Down-Regulation of Endogenous ZmPre2 mRNA by RNAi Studies
[0229] A genomic fragment of 450 bp (from 1189 to 1638nt of ZmPre2 CDS) was used in sense and antisense orientation with an intron (ST-SL2 intron2) as a spacer to make an inverted repeat/RNAi cassette. This cassette was driven by either Zm-UBI (constitutive promoter) and/or a putative ZM-SEE1 (senescence induced promoter) promoters. MOPAT driven by Zm-UBI promoter and PMI driven by OsACTIN promoter was used as selectable markers. In addition, RFP driven by a pericarp specific promoter LTP2 was also used to sort out the transgenic seeds (red) from their segregating non-transgenic sib seeds. Transgenic lines for the constructs were generated and molecular analyses, such as PCR-FP and RT-PCR, were performed for selection of transgenic events. Several lines with significantly reduced expression of ZmPre2 have been identified and are characterized in further experiments.
Example 8
Down-Regulation of Endogenous ZmPre2-mRNA by RNAi Studies
[0230] ZmPre2 RNAi suppression construct is transformed into a fast cycling corn line (FASTCORN) for further transgenic validation. A full length mRNA amplified by RT-PCR (FIG. 2A) was used to make both for over-expression (Ox) and RNAi constructs using Ubi promoter. Ten transgenic events for both were screened molecularly for copy number and Pre2 gene expression by QPCR. For phenotypic data on leaf area, leaf color, height etc. digital images of the plants at various growth stages were taken as described above. Data on total biomass and stay green traits were calculated by measuring the leaf area in terms of the number of green pixels obtained using a commercially available imaging system. Data for other traits such as ear length, ear width, maximum ear area and total seed number were obtained at the time of harvesting. Data was analyzed by applying paired t-test and presented as Z-score in FIG. 9. All ten events (RNAi construct) and all but two of the (Ox) had single copy and the relative gene expression in five out ten RNAi events was significantly low (ranging from 0.07 to 0.554) as compared to internal transgenic and non-transgenic controls. All but one Ox events had 2.times. more relative expression ranging from 2.171 to 2.897. Three RNAi events (1.4, 1.5 and 2.5) were found to have significantly higher ear length, ear width and total seed numbers (FIG. 9), which is relevant to their relative gene expression. However, pre-mature senescence phenotype was not observed in these events. This could be due to the fact that all the insertion mutant alleles for the native Pre2 gene were resulting from the partial interference and differential splicing of the introns in their mature transcript, whereas the RNAi mechanism is different than Mutator insertion mutants. On the other hand, these four RNAi events with higher seed numbers as compared to all overexpression (Ox) events are behaving similar to T-DNA knockouts in Arabidopsis. These four events also show higher biomass (FIG. 9A). Three RNAi events (namely 1.4, 1.5 and 2.5) were selected for conducting NUE Reproductive Assay in T1 generation under 4.0 mMol Nitrate-suboptimal nitrogen conditions. Two of three events (1.5 and 2.5) showed significant increase (percent change vs. Null) in silk count, ear length, ear width and ear area (FIG. 9B). In addition to these traits, event 2.5 also showed significant difference for Days to shed and days to silk as compared to its nulls. Thus, transgenic plants where the expression of the Pre2 mRNA has been modulated exhibit significant differences in one or more agronomic parameters of interest for crop plants.
Example 9
Characterization of Polypeptides Homologous to Pre2
[0231] The protein-coding regions of other genes homologous to the PRE2 amino acid sequences disclosed herein. FIGS. 10-11 present an alignment of a plurality of amino acid sequences set forth in SEQ ID NOS: 1-48.
[0232] Sequence alignments and percent identity calculations were performed using the MEGALIGN.RTM. program of the LASERGENE.RTM. bioinformatics computing suite (DNASTAR.RTM. Inc., Madison, Wis.). Multiple alignment of the sequences was performed using the Clustal W method of alignment (Higgins and Sharp (1989) CAB/OS. 5:151-153) with the default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=10). Default parameters for pairwise alignments using the Clustal method were KTUPLE=1, GAP PENALTY=3, WINDOW=5 and DIAGONALS SAVED=5.
[0233] The amino acid sequence of corn Pre2 peptide (ZmPRE2) has the following percent sequence identity with the homologs presented in FIGS. 10 and 11: Pre2 peptides of sorghum and grasses such as Sudan, Bahia and Resurrection were found to be 83% to 90% identical with corn at amino acid level whereas the rice peptide diverged from corn and showed 68%. Homologs in dicots including Arabidopsis, Soybean and Canola have 34%, 36%, and 35% identity, respectively at the global alignment level.
Example 10
Molecular Analysis of the PRE2 Homologs
[0234] Molecular analysis revealed several conserved regions/domain in the Pre2 homologs. Despite the overall sequence divergence along the full-length of the Pre2 polypeptides across a variety of species shown in FIG. 10 for example, several highly conserved domains were observed (FIG. 11). SEQ ID NOS: 27-48 represent a subset of conserved regions and domains across the Pre2 polypeptide region.
Example 11
Expression of Transgenes or Downregulation of Endogenous Genes in Soybean
[0235] Local Blast results using AtPre2 full length gene sequence as query showed that there are two copies of Pre2 gene in soybean and their partial sequences is aligned in a multiple alignment (FIG. 10). A partial EST sequence (PSO423639) of about 2800 bp in length was cloned. The expression pattern distribution of the ESTs or full-length cDNAs in the Tissue Library Browser indicate that Pre2 gene expression is very low in soybean and Pre2-ESTs have been expressed highest in seedling, mostly in shoot under biotic and abiotic stresses. Medium numbers of ESTs (20-30) have been detected in leaf, root, young cotyledons, low levels in reproductive tissues such as pod, seed and seed coat.
[0236] Sequences of both the partial Pre2 copies in soybean were aligned and the following consensus sequence of 147 bp (SEQ ID NO: 51) was selected to use in an RNAi construct using Arabidopsis UBI promoter. This construct is transformed into soybean.
[0237] Soybean embryos are bombarded with a plasmid comprising a preferred promoter operably linked to a heterologous nucleotide sequence comprising a suitable target RNAi sequence against Pre2 polynucleotide sequence or subsequence (e.g., SEQ ID NOS: 14, 16, 17 and 19), as follows. To induce somatic embryos, cotyledons of 3 to 5 mm in length are dissected from surface-sterilized, immature seeds of the soybean cultivar A2872, then cultured in the light or dark at 26.degree. C. on an appropriate agar medium for six to ten weeks. Somatic embryos producing secondary embryos are then excised and placed into a suitable liquid medium. After repeated selection for clusters of somatic embryos that multiply as early, globular-staged embryos, the suspensions are maintained as described below.
[0238] Soybean embryogenic suspension cultures can be maintained in 35 ml liquid media on a rotary shaker, 150 rpm, at 26.degree. C. with fluorescent lights on a 16:8 hour day/night schedule. Cultures are sub-cultured every two weeks by inoculating approximately 35 mg of tissue into 35 ml of liquid medium.
[0239] Soybean embryogenic suspension cultures may then be transformed by the method of particle gun bombardment (Klein, et al., (1987) Nature (London) 327:70-73, U.S. Pat. No. 4,945,050). A DuPont Biolistic.TM. PDS1000/HE instrument (helium retrofit) can be used for these transformations.
[0240] A selectable marker gene that can be used to facilitate soybean transformation is a transgene composed of the 35S promoter from Cauliflower Mosaic Virus (Odell, et al., (1985) Nature 313:810-812), the hygromycin phosphotransferase gene from plasmid pJR225 (from E. coli; Gritz, et al., (1983) Gene 25:179-188) and the 3' region of the nopaline synthase gene from the T-DNA of the Ti plasmid of Agrobacterium tumefaciens. The expression cassette of interest, comprising the preferred promoter and a heterologous Pre2 polynucleotide e.g., in the sense or anti-sense or hairpin orientation, can be isolated as a restriction fragment. This fragment can then be inserted into a unique restriction site of the vector carrying the marker gene.
[0241] To 50 .mu.l of a 60 mg/ml 1 .mu.m gold particle suspension is added (in order): 5 .mu.l DNA (1 .mu.g/.mu.l), 20 .mu.l spermidine (0.1 M) and 50 .mu.l CaCl2 (2.5 M). The particle preparation is then agitated for three minutes, spun in a microfuge for 10 seconds and the supernatant removed. The DNA-coated particles are then washed once in 400 .mu.l 70% ethanol and resuspended in 40 .mu.l of anhydrous ethanol. The DNA/particle suspension can be sonicated three times for one second each. Five microliters of the DNA-coated gold particles are then loaded on each macro carrier disk.
[0242] Approximately 300-400 mg of a two-week-old suspension culture is placed in an empty 60.times.5 mm petri dish and the residual liquid removed from the tissue with a pipette. For each transformation experiment, approximately 5-10 plates of tissue are normally bombarded. Membrane rupture pressure is set at 1100 psi, and the chamber is evacuated to a vacuum of 28 inches mercury. The tissue is placed approximately 3.5 inches away from the retaining screen and bombarded three times. Following bombardment, the tissue can be divided in half and placed back into liquid and cultured as described above.
[0243] Five to seven days post bombardment, the liquid media may be exchanged with fresh media and eleven to twelve days post-bombardment with fresh media containing 50 mg/ml hygromycin. This selective media can be refreshed weekly. Seven to eight weeks post-bombardment, green, transformed tissue may be observed growing from untransformed, necrotic embryogenic clusters. Isolated green tissue is removed and inoculated into individual flasks to generate new, clonally propagated, transformed embryogenic suspension cultures. Each new line may be treated as an independent transformation event. These suspensions can then be subcultured and maintained as clusters of immature embryos or regenerated into whole plants by maturation and germination of individual somatic embryos.
Example 12
Transformation of Maize Using Agrobacterium
[0244] Agrobacterium-mediated transformation of maize is performed for example, as described by Zhao, et al., (2006) Meth. Mol. Biol. 318:315-323 (see also, Zhao, et al., (2001) Mol. Breed. 8:323-333 and U.S. Pat. No. 5,981,840 issued Nov. 9, 1999, incorporated herein by reference). The transformation process involves bacterium innoculation, co-cultivation, resting, selection and plant regeneration.
[0245] 1. Immature Embryo Preparation:
[0246] Immature maize embryos are dissected from caryopses and placed in a 2 mL microtube containing 2 mL PHI-A medium.
[0247] 2. Agrobacterium Infection and Co-Cultivation of Immature Embryos:
[0248] 2.1 Infection Step:
[0249] PHI-A medium of (1) is removed with 1 mL micropipettor, and 1 mL of Agrobacterium suspension is added. The tube is gently inverted to mix. The mixture is incubated for 5 min at room temperature.
[0250] 2.2 Co-culture Step:
[0251] The Agrobacterium suspension is removed from the infection step with a 1 mL micropipettor. Using a sterile spatula the embryos are scraped from the tube and transferred to a plate of PHI-B medium in a 100.times.15 mm Petri dish. The embryos are oriented with the embryonic axis down on the surface of the medium. Plates with the embryos are cultured at 20.degree. C., in darkness, for three days. L-Cysteine can be used in the co-cultivation phase. With the standard binary vector, the co-cultivation medium supplied with 100-400 mg/L L-cysteine is critical for recovering stable transgenic events.
[0252] 3. Selection of Putative Transgenic Events:
[0253] To each plate of PHI-D medium in a 100.times.15 mm Petri dish, 10 embryos are transferred, maintaining orientation and the dishes are sealed with PARAFILM.RTM.. The plates are incubated in darkness at 28.degree. C. Actively growing putative events, as pale yellow embryonic tissue, are expected to be visible in six to to eight weeks. Embryos that produce no events may be brown and necrotic, and little friable tissue growth is evident. Putative transgenic embryonic tissue is subcultured to fresh PHI-D plates at two-three week intervals, depending on growth rate. The events are recorded.
[0254] 4. Regeneration of T0 plants:
[0255] Embryonic tissue propagated on PHI-D medium is subcultured to PHI-E medium (somatic embryo maturation medium), in 100.times.25 mm Petri dishes and incubated at 28.degree. C., in darkness, until somatic embryos mature, for about ten to eighteen days. Individual, matured somatic embryos with well-defined scutellum and coleoptile are transferred to PHI-F embryo germination medium and incubated at 28.degree. C. in the light (about 80 .mu.E from cool white or equivalent fluorescent lamps). In seven to ten days, regenerated plants, about 10 cm tall, are potted in horticultural mix and hardened-off using standard horticultural methods.
[0256] Media for Plant Transformation:
[0257] 1. PHI-A: 4 g/L CHU basal salts, 1.0 mL/L 1000.times. Eriksson's vitamin mix, 0.5 mg/L thiamin HCl, 1.5 mg/L 2,4-D, 0.69 g/L L-proline, 68.5 g/L sucrose, 36 g/L glucose, pH 5.2. Add 100 .mu.M acetosyringone (filter-sterilized).
[0258] 2. PHI-B: PHI-A without glucose, increase 2,4-D to 2 mg/L, reduce sucrose to 30 g/L and supplement with 0.85 mg/L silver nitrate (filter-sterilized), 3.0 g/L GELRITE.RTM., 100 .mu.M acetosyringone (filter-sterilized), pH 5.8.
[0259] 3. PHI-C: PHI-B without GELRITE.RTM. and acetosyringonee, reduce 2,4-D to 1.5 mg/L and supplemente with 8.0 g/L agar, 0.5 g/L 2-[N-morpholino]ethane-sulfonic acid (MES) buffer, 100 mg/L carbenicillin (filter-sterilized).
[0260] 4. PHI-D: PHI-C supplemented with 3 mg/L bialaphos (filter-sterilized).
[0261] 5. PHI-E: 4.3 g/L of Murashige and Skoog (MS) salts, (Gibco, BRL 11117-074), 0.5 mg/L nicotinic acid, 0.1 mg/L thiamine HCl, 0.5 mg/L pyridoxine HCl, 2.0 mg/L glycine, 0.1 g/L myo-inositol, 0.5 mg/L zeatin (Sigma, Cat. No. Z-0164), 1 mg/L indole acetic acid (IAA), 26.4 .mu.g/L abscisic acid (ABA), 60 g/L sucrose, 3 mg/L bialaphos (filter-sterilized), 100 mg/L carbenicillin (filter-sterilized), 8 g/L agar, pH 5.6.
[0262] 6. PHI-F: PHI-E without zeatin, IAA, ABA; reduce sucrose to 40 g/L; replacing agar with 1.5 g/L GELRITE.RTM.; pH 5.6.
[0263] Plants can be regenerated from the transgenic callus by first transferring clusters of tissue to N6 medium supplemented with 0.2 mg per liter of 2,4-D. After two weeks the tissue can be transferred to regeneration medium (Fromm, et al., (1990) Bio/Technology 8:833-839).
[0264] Transgenic T0 plants can be regenerated and their phenotype determined. T1 seed can be collected. T1 plants, and/or their progeny, can be grown and their phenotype determined.
Example 13
Transformation of Brassica with Pre2 Homologs Disclosed Herein
[0265] Canola transformation is accomplished for example, as described in Chen and Tulsieram, US Patent Application Publication Number 2007/0107077, incorporated herein by reference. Buds are collected from a donor line and sterilized. Buds are then homogenized, filtered, and washed to collect the microspores. The resultant microspore suspension was adjusted to a specified density and cultured for 2 days. Embryogenic microspores were then isolated via gradient centrifugation and cultured.
[0266] Gold particles coated with the DNA fragment were used for transformation. Biolistic transformation is carried out using the PDS-1000/He Particle Delivery System (Bio-Rad, Hercules, Calif.) as described by Klein, et al., (1987) Nature 327:70-73. Transformed embryogenic microspores are cultured in fresh medium in dark conditions for 10-12 days, then under dim light for 1-3 weeks. Green embryos are transferred to fresh medium and cultured for two weeks to select based on the marker gene used. Germinated shoots and/or plants were transferred to growth medium supplemented with selection component.
Example 14
Yield Analysis of Plants Transformed with Pre2 Targeting Constructs
[0267] A recombinant DNA construct containing a Pre2 down-regulating construct can be introduced into plants either by direct transformation or introgression from a separately transformed line.
[0268] Transgenic plants, either inbred or hybrid, can undergo more vigorous field-based experiments to study yield enhancement and/or stability under well-watered and water-limiting conditions.
[0269] Subsequent yield analysis can be done to determine whether plants that contain the constructs/sequences disclosed herein have an improvement in yield performance under water-limiting conditions, when compared to the control plants that do not contain the validated drought tolerant lead gene. Specifically, drought conditions can be imposed during the flowering and/or grain fill period for plants that contain the constructs/sequences disclosed herein and the control plants. Reduction in yield can be measured for both. Plants containing the constructs/sequences disclosed herein have less yield loss relative to the control plants, for example, at least 25% less yield loss, under water limiting conditions, or would have increased yield relative to the control plants under water non-limiting conditions.
[0270] The above method may be used to select transgenic plants with increased yield, under water-limiting conditions and/or well-watered conditions, when compared to a control plant not comprising said recombinant DNA construct.
Example 15
At-Pre2 Mutant is Hypersensitive to ABA
[0271] In earlier experiments At-Pre2 T-DNA knock out mutant showed a significant increase in biomass, improved growth on low N plates, and drought tolerant phenotype in soil. AT-PRE2 is a large protein of 1326 amino acid residues with unknown function. To elucidate the function of this protein, several experiments were conducted. One of such experiments included ABA response of Atpre2 mutant. Seeds of Atpre2 mutant and Col-0 WT (36 seeds of each WT and mutant with 3 replications) were grown on half MS media (without sucrose) with or without abscisic acid (1 .mu.M.+-.-cis, trans-ABA). The plates with seeds were kept at 4.degree. C. in dark for 3 days and then incubated in growth chamber under the long day growth conditions (16-h-light/8-h-dark cycle at 120-150 .mu.mol m-2 sec-1 and 20.degree. C. to 22.degree. C., with 75% humidity). Visible radicle tips (1-2 mm) were counted after 48 hrs as a germinated seed. In these multiple experiments Atpre2 mutant showed a hypersensitive response to ABA in a dosage dependent manner. The seed germination in mutant was reduced or delayed by more than 50% as compare to wild type in presence of 1 .mu.M ABA (FIG. 12). Searches of expression databases revealed that the endogenous AT-PRE2 gene expression was higher in guard cells in wild type plants and was down-regulated by ABA treatment both in seedling and leaf. In addition AtPRE2 was also up-regulated by nitrate in roots. These results indicate a direct or indirect role of AtPRE2 in ABA and N signaling/pathway.
Sequence CWU
1
1
51111674DNAZea mays 1aaagtagcat atttactgga ttctcctagt ttaagcttat
ttgataatct aatgcatatg 60ttgttctttt gatcacatct gttatttgtt tgatcattga
ataacttcaa ttaacactta 120tgtttcttag tgcctcacat ttttttaaaa tcgatatctc
tcttgatatg cactaagttg 180aaaggagaat tcatgataca tttatgcaat tagtgatcca
cttgatatat gataacattg 240tcttagaaaa ggatcattag ttgtagaact ctctcttgtg
cgtgggggag gtgagggatg 300agggtctctg atttgctgcc tatggtaccc gtgcgttaat
caaaaatatt atgtgaagac 360aagagacaat caataaaaaa ttttgagata tttttggtga
ataatttacg tgggtattgt 420tgtgagccgt cgcaacgcac gggtaaccgg ctagtctaaa
ctctaaagca gagctgttcc 480gtacagagtt ttggaataaa gctattatga aatactctgc
caaattttct agagtcgcaa 540acatcctcta attatttgag acaattgttg gagcgagtcc
acgcatgcaa gcgagtcctg 600acggtataaa cccagtccat cagtccgatc tgtacattta
ccggttgatt ggttccctgt 660gtccgtggct gcacgctcgc ccgagcctgg ctggtcagat
acatgcgttt tggcggtacg 720agcggatgca gacaattagc cttcaaatgg cttgttttgc
atcggcttgt gcagcccacg 780ccttcgatgt gcaggcaacc aaacatacgc tcaggtaaag
tcaatgcatg cagtgatcta 840ggataaaacg atgcgaccaa ccaatcatat gattagcgta
tgtggtcgcc gttcctgtgt 900ttgttaacct cacaaatcat agataggcaa aactgtctcg
atttttttcc agcccggcgt 960caccgtacac cgatctctcc ccccccaccc cacccccaac
atgctgcctc cgcccacggt 1020agtagccgcg agccgaccga cgctcgtcga cgcgggtacg
gggcgagtcg gtcatgctcc 1080tgacctttct ctacatgtgc cgtcgaggag gacatggtgg
cacctgccac acttaggtta 1140tcttggcgat gaggagtcca ggtctgttat attggacaat
catggctcgt agcgtgacag 1200cagtcagcat atgctatgga gttgtggtgg tgttgtgtcg
cttcagcggg ttcagggctg 1260ggaagacact cacattctct cgtccgtctc ggactgacgc
ctggtgcggg tgcctctcag 1320tttggagctg ctccgactgg gcttctttct ccgcttgtgt
gctctctccc tatatatcta 1380tcggtataat acatatgtcg cctccagatg ccaaggtctt
cgtcgtgtcc ttctccgaca 1440acgaacaggt atgtccgcct ctttccttcc cctcttgctc
tacgaaacct tggaagtgga 1500ggaggcgagc tctgatttgc tgtctatggt acccgtgcgt
taataaaaaa atattatgtg 1560aagactagag acaatcaata aaaaaatttt gagatatttt
tggtgaataa tttacgtggg 1620tattgttgtg agccgtcgca atgcacgggt aaccggctag
tctaaactct aaagcagagc 1680tgttccgtac agagttttgg aataaaacta ttatgaaata
ctctaccaaa ttttctagag 1740tcgcaaacat cctctaatta tttgagacaa ttgttggagc
gagtcaacgc atgcaagcga 1800gtcctggtat aaacccaatc catcagtccg atctatatat
ttaccggctg attggttccc 1860tgtgtccgtg gctgcacgcc tgcccgagcc tgactggtcg
gatatatgcg ttttggcggt 1920acgaacggat gcatgcaatt agcctttaaa tgacttgttt
tgtatcggct tgtgcagccc 1980acgtcttcga tgtgcaggca accaaacata cactcagtta
aagtcaatgc gtgcagtgat 2040ctaggacaaa acgatgaaac caaccaatcg tatgattagc
gtatgcggcc gccgttcctg 2100cgtttgttaa cctcacaaat catagatagg caaaactgtc
acgatttttt tccagcccgg 2160cgtcaccgta caccgatctc tccccccccc cccgccaccc
accccccacc accacgcccg 2220acctcgtccg cggtgaaggt caaggagacg gcggaggaag
cctgacaacc gtgtggatgg 2280ggatctcgtt caagctgtcg aaggtcgggg tccgcgtgca
cccggccgcg cgctcggcgt 2340ccgcggcggt ggcggaaaag ccgggcgcgg gtgggaagga
gggttcgctg tctgagtcga 2400cacgcgaggt gaggcgctcg tggcttctat cgcttgcttg
tttggtttgt gtgtcgcttc 2460gagatggttt gggtgccaac agtggggggt gggggggggg
ggggggatca aggagcggaa 2520agcaatttgt cgaggaactg atgaaaaatc tgacctcgat
tttttttgtt ttcaggcgaa 2580tttcgttaat tcgctacaag gattaatatt tttggtgatt
tcggctcgaa agcttgcgtt 2640ggacaatcaa tcgcattttc gtttggagtg gtcaaatcct
tcggaaggac tgaacattca 2700aagacttttt tttggggggg gggggactcg tactttttcc
ctcttttttt gggtttaagc 2760tcgttttttt ggatggctat gtgtagcagt tcggctatag
tagctgaggg tgccaatttg 2820gcctgcttga actcagtatc taccaaacaa ctatttgtct
tgtgcaacac tctagctaat 2880tgtttgttat caattacctt acttttgatt gtctattggg
tttagagcat tcaggtgtgg 2940tttccaaggg attgacctaa tggggcgttt ggatccattc
attttagagg aactgaaatt 3000tacttaataa agtaacctat ttagcttgga atttgacatt
ccaccacttt acaaagttta 3060gatataagcc tatctcaaat ttatggagta gaggatgaga
aataatttta tatatcagta 3120gaatatgttt ctactctgca acttatagga cgctcttcga
ctcactactt tataaaaatg 3180tagcacataa atatcccgac atcttgttaa taatagtata
caaatatatt ttacataaaa 3240ccgtattagc ttaattgatg tgcctaaatt acttttatta
gaatggaatt caattccaag 3300gatctaaacg aggcaaagta tttgccatga agcaagggca
atgctcctaa tttccaataa 3360acataggatc accaatactg gagattcttt tgagttgtac
tagtatctgt tgagaccagg 3420gatgttatct tgtccagctc tttctgttgc acccttgctt
tagtattgaa gtaccttata 3480attttagttg gagcaatcaa gcaatgtaaa attagctagt
attggcatgg ataggtgtac 3540ctgaagtgct aaacttcaag tggacagtag atgatccaaa
tcttgttgcc agatcttttg 3600ttagcttaaa tgattggaga gaagatactt gcaacatgtt
taaaaaataa tttattttgt 3660tttgttggtt ttcttgttgt attcgctttt tgttaatttg
aatttgactg caattctctt 3720ttctccatga taactgggtt ttactatgat ggaatgctca
tttaatctct ttgtgcagga 3780caaaagaaaa gatgtcaatg gcatcaaaat tttaccagca
tgctccaaag aaattttgcc 3840aggtattttg gacaatttaa gatttttttg tctgtatcaa
ttttgccagg ctttgttgtt 3900gttttgtatt tagtctatgt tatgcactca acattgtatt
gcagatcatg aggtttcttt 3960cacattgagc ctctatgaga gaggttatct catttcaaag
tcagcacccg tgagttcttc 4020atctggaaat ttatgtagcg aatttcagtt actattcttg
ttgcattgtt ttttctggaa 4080ttcaagagaa aggcattcaa ctatgaatat attcctgaca
taaaatacat atatgttcag 4140atggatccta gtcagacctc aattcaggac ggcaaaacac
tgcatcccta tgatagagca 4200tcagaaaagt tgttctctgt aagtatggta tcacttgctt
gcaagttttg ttttagttgt 4260gtccttggat gacatgtcca tactccatag ttcatgcaat
gccataccaa aaatttggag 4320ccaaattagg tgtgaaaacc aaccaaattt ggttcatacc
gcatttactt tatttttagt 4380atgaacacga atttgaattg cttgaaatat gagttattgt
atgttgtaat gtcaaatatg 4440gatagagttg gggcaatgtt tgaggtctgt ttggaatgca
ggaatttcat aggaggaata 4500ggggaaaatt ctcgtgtttg gaacacatga atttcatagg
ggtaggggta aaatcttgtg 4560ttccaacagg gctttataat ttccaatcaa atgcaaaaac
ttgtcactga gattctatcc 4620aattgtagtc atttccattt atctttgtca tcgaaagaaa
cgggagttca cattaaattt 4680gtggaattct tcaaactaag gcttatgaca gtgaaatatg
tatattttct ttaccaaatt 4740cgaatataaa tagctggggt aaaccaaaac tttggatggc
aaaaagtcta taccatattt 4800gcatcaatat tgtttatgca aacctgaaat aatttcaggt
tggcgcaaaa ttatgaaatt 4860tggttggatg gaatatctat cgagtatggt atagtactat
agtcacacat atttcttttg 4920cgctctcaac caagaatgtc aaatctcatc tgaaaaaaaa
acaaaaatga gaagaatgtt 4980tcaaggaagt tttcaaatga gcacctctta catggtgatg
aagttttatt cttctatagg 5040actatatgat tgcaacattg gtgcgaccat atagtttgac
cttagcatcc tgtaggctgt 5100agccaagagc ccaagtttcc tgtgtatgag tattttcata
tactaccata ttagacgttt 5160tgagtactag acaaatatgt ttgctttgtt ttttagcctc
ctaactgatc gaccaggttt 5220atccatttag ctgtctaaag ataaaaattg atatacatga
ctaattataa ttacatgagt 5280ttcctcgtga tctgcaggct atcgaagctg ggaggctacc
tggcgatatt tttgatgaga 5340taccaagcaa gtactataat ggatcagttg tttgtgaggt
aagttgtttt atcacacata 5400agaaaggcta tgcatgcaat gctattgaac tgcaacatgc
tgaaaccttc tgaaatttat 5460tctcttataa gttgtggttg gtttctctga tacatggttc
aaaaagcatg ctggtacaat 5520ttctgtactg aggatttatg ctatatggga gaaatccttc
tttaaaagaa aaactagaag 5580tttggtgagc tttactgacg acatgttcta taatatgcca
acctaccagt actgtaccaa 5640cctttttcta acacttattt cagaaacaac cgttatgcat
tatcatgaag catcatgttg 5700tgtcatgtgc tcatggtcat gtgctactgt accttattga
taagagacca ttgagtcttt 5760agcagtactt cattgtctta catcgacata agtaatgagt
tctctttcta gatacatgac 5820taccgaaagc atgtgtccaa ccaagcgcct gcatcatctg
ctgagctagg atcaccaatt 5880gtgaataaag tacgactgcg aatgaccttt gaaaatgttg
taaaggacat tacccttcta 5940tctgatgatt cctggagtta cagggatttt atggtaagta
tgctgtggta acatctattc 6000tatgagttag aatctcaaca tggctcattt tggcatctgt
actcgtagtc tttatactct 6060aggatctata ggaaattgct tattgagaat gtattaactg
aatttagggc atgtttggat 6120acatgggcta attgctagct aaaattggtt ctagtgcatc
caaacaggag ggctaataga 6180tgggttaatt ttttagccaa gtctccaact agctgttagc
caaccgtagt taatttgggc 6240taatttttag ctccaactag taactattca tgtatccaaa
cgggccctta atcatttgtg 6300tacctaatac tcagcaattg taaagttagt tcttcaataa
ctgattagta acactggaat 6360agcatgatac agtaacaaaa atgtaaaata tatgtatggt
tggataacta attgaacttc 6420tgaaacagag taacctgaaa tttcagttgc tgcaatttaa
ctttctttgc tgaaccatat 6480gggctattct gatatgcatg tttatctagg aagctgaggc
ttgtattttg agagctctac 6540aaccggaact ttgcttagac cccacaccta aactggatcg
acttcatcag gatcctgttc 6600cgcataaggt atggacacat gctgaaaaga aatattatca
tggtaggtac atatgtctca 6660aactaagtct cttatgttaa ttgcagttga gccttggtat
agggaaaaag aggaggctga 6720ggcaaaatcc tgaagttgtc acatccagtc acatgtctca
tggtaaaaag gtttgcattg 6780ataggttacc tgaaagtgcc aaagctgatg agatgggcat
cactagcagt aatgcagctc 6840agcaggttgg tggtaacatt accatccaaa atatgtcagt
ctcaggtggt tctcagacac 6900ttagaccaaa taattcttca caagatgctg ccagaacgct
tttgcctcaa tctggtctac 6960agcaaacctt gtgttattct gctgctggta atgatcatat
ggcaggacca cctgccaatt 7020tttctggaac cagttcatgc atttcatctc atcagagcct
gattggttac agtgactctg 7080tggctgccaa cagccttcta tctgtgaaga gggaaatgca
ggatgcctcg cttcaagatc 7140ctaagagaat aaagcgaact ggtggtattg atgatgtaca
gcagcagcag ataaggcctc 7200aaccccttgg tgggcaggag atgcaatgga agaaccatca
actgcatcca caattagatg 7260ttaaggggat gcagtatgca tcttcactga gtggtcagag
atatccttct tcgatgatga 7320acaacatgca agatccagga tcttccttat attttagtca
tcagcaaaat ttgagatacg 7380atgctaagca agagcagatg gatggttctg ataagtcaaa
agacaccttg cagtctatgg 7440cacctgaaac ttccatgctg gatcagcagc aatcccaatc
tcaacattta ccacaacaat 7500cagtggcaag aaataatgtt ccaaacatgg gacagtggca
aaatactcgg ttcgcagctg 7560agaaggactt caaaaaagaa gacataattc agagaagaaa
gttagcacct agctctcgtg 7620cccctactgg gcctgtgatt cagtctccag tgtcctcgaa
atctggagag ttatcaggca 7680gttcaatggg tggccagttt ggttctgctg tgacatcagc
tgtaacaggg gtacagaaag 7740ataaatttgc tgcaaattcc ggtactgcag ttggatttcc
ttctgtagct tccagtccta 7800gtgattccat gcaccgaata caacagcctg ctgttgcttc
ctcaaagagg aaaacaaatt 7860ctgtccccaa aactcaaccg cctgtgagtg ctgttgggtc
tccagccagt gtttcaaaca 7920tgcatgcgct gctgaatgca agcagtccat cgattgggac
cacacctatg ggagaccaag 7980caatccttga taaatttgtg aaaattgata acatttccca
tcggtatagc ataatttcta 8040catctgctcc ctcccttcac gaatttttgt tgtcactttc
ctttctattc ttagtttctt 8100tggaagtctg tcatgggaga ctttttaagg aagttttggg
ttgcacggtg tgaatttgat 8160gtctaggcta ttttaaagct gagattcagc cctattactt
tggatggtca cacaaaaaaa 8220tgtcaggcta taatgtgcaa atgaactgtt tcaattcttt
atcaaagtta atcaacattt 8280taacctaaat aactagtccc tccagttcaa attgtaagtt
gttttggttt tttagatacc 8340tggttttcac tgtgtatata gacatagcac acatctaggt
gcatagcaga acctatgtac 8400ctagaaaagt caaaacaact tacaatttga aattgaggga
atgcctaaca aaataaaagg 8460gtgaagagtt aaaacatctt ttttaggacc ggagtttcta
aaaaaaaccc cggctgggga 8520gtgaaagacc accctcctgg tattaatgct tggagttgac
actcaaggat gcacacaacc 8580cactgatggc taacaagaga ccgaaacatt gatcctagcc
gagaaaatcc ccgacccatc 8640actaacgggt caacgtcaac cgtccactct gcaatgaccc
aatcagaggg tggcgtagag 8700gacatcgtaa cccgagagcg gatgaggcac atcgagggga
ttcttttaac caagccggaa 8760aattcatttc tgagaagaat cgaacccaag acttgtaggt
gctactcgga agcccttaac 8820caataggccc tttcgcggac cggattttct caactaacta
aaaacctgaa gaaagctttg 8880tgagtctaaa catgcttttt tagtattgaa tctcatgtac
aaagtgtctt ggtacctttt 8940atcagttgtt acaacgtaca aatgtggact atttagtcag
tttggtctgt agataccata 9000aagtttgttt aaatattgaa tttcttgaag tgaagtcagc
aatgcatata caacagcaac 9060aaagcctttt agtcccaatt aagttgtggg taggctaaag
ctaaaaccta actatgcatg 9120tatgtttttt tttgatatag atctcattat aaagtggcac
ataactggca cttgtggacg 9180atttgaaata tttcattttt ggccattgca ttgtgataat
atttttttct acatgcagtg 9240atcgttgtgt attcttttca ggtaccagct tttcaataag
aagaagtttg ataaaatatc 9300tcaaaagaaa accattatca atcgaaacca aaatgtagct
ggttgtctca acagttgttt 9360ccattctgag gattatatag ataccacaag acctctttgt
aattctatga ttagtggaac 9420tataaacaca tgcaagggta gggtaataaa ctttgtgagc
acaaaagaca tgtaccaagg 9480tatgctctat agacattttg ctgaaaaggt ccccaggaaa
gaaaagccac agcaccttca 9540gttaatctga ttcacattgt catacaggtc attcaaggcc
attcccggtt gattttaacg 9600aactgtctga tgaaactgta agaatgcaat atggagatat
aaaagatttt gatgatccaa 9660attcatatgg ttgtgtattc atattaccga caaaggtttg
ttgttatctc tcaaggtttc 9720cctgttgtcc tttgtagcat aaaggccctg aaacactagg
gcataatatt taactgctct 9780atttctgtcc taacttttca attatttgct ctggcagcac
tatgctgact tgtttgcggg 9840gcagcttatt tcccttgtaa gttagataac cctaaagccc
tgaatagtaa agatgttaag 9900tcaatcttct cattaacttt cgtacttttt gctctagatg
ttgcaagatg gacattctaa 9960agctgacgat gaagttgtgc gtagcacccc ttttgctaac
atcagtacac cctttggacc 10020tttaccaaac aacgtagtga gtgatgtaaa gcaagaggga
ggtgtaagcc aacaacttaa 10080tgccgcagcc catgcaaatg tggcacctgg aacacaaatg
caacagcttc ctgtcaatag 10140gatgcttcca tctgcaaatg gcaaccagat tctagcaatg
cagcaaggtt atatgcaagg 10200ggcagccatg cctccaagga gccagcatct tgaccaaaat
ttggttcagc agccgcagca 10260ccaacagcca caacagcaac cactgcagca aaatgctcaa
gcccaggtgc agcaaccatc 10320atctcttcca ctgaaccaga tgcaaagacc tcaggttctg
cctacgagcc cattatctca 10380gatgttgggg cctggctcaa atctcccaat gggctcaagt
cagataggta agaataaggc 10440tcctcccaca tctttgcagc ttcaaatgct acaggcacaa
ccccaacaac ctatgtctag 10500gaaagtgatg atggggcttg gctcagccat gaacatgggc
aatatggtta acaatgttgt 10560tggtcttggt ggcctcggaa atgttatggg aatgggcaac
gtgcggccaa tatcttcccc 10620catggcatcg atgtcaggct taggtaacaa ttccaatcca
atgaacatgg gaatggcatc 10680caatcttgct gcagctggac ttcggccagg catgaaccct
gctgctattg ccaaggtgcg 10740tatggggttg gcacagcaaa gggcagcagg catgtaccct
ggaatggttg gaatgcctgg 10800aagcagctca tcaatccttc ctagttcagc tggcttgtct
atgatgggcc agccgctaaa 10860cagaggcaac cttggccccc tccagagggc catgatgtcg
tctatgggcc ctccaaaaat 10920gccaggaggt aactttcagc tgaatgctca acagcaaata
cacctccagc atcagttgca 10980gcagctccaa cagaacccac agcagcagct ccaacagcta
cagcaacagc aacaaataca 11040acaactgcag cagcagcagc agcagcagct ccaacaacag
caactgcagc agcaacaaca 11100aatgggatct ccgttacagc aggcacaggt gggctcacct
gctggctcac agcaatcgcc 11160gatgatgcag cagcagcagc agcagcagca gcagataagc
cctcagcaga tgggacagca 11220ggctgcaatg agcccccagt tgagctcagg aactctgcag
caaatgagca ataacgtggc 11280caaccctgta gccactccag gccctcctcc aagcccgcag
ctgagctccg gtcaacagca 11340tagctaactc cccgatggag cagctgcaag gcgccattaa
gggaggtcct ggtagtagta 11400accggagtcc acttcttgcc tatggaaggt gtaaacactg
accaagatca ctctgttctc 11460ttgtttgctg tggtaaatga ggttaaatta ggtgtgttat
aagttatagg ccatagagga 11520cagctttaag gaccagcttt atgcttggat ttttatgctg
tacattgtag ttagtaggaa 11580tggtgtgttg gagctcggta atcagttcta tgcaagcatt
attcaattgg acagttttct 11640actcttgtag cttcatgttt aaatttaaat taaa
1167424164DNAZea mays 2atggggatct cgttcaagct
gtcgaaggtc ggggtccgcg tgcacccggc cgcgcgctcg 60gcgtccgcgg cggtggcgga
aaagccgggc gcgggtggga aggagggttc gctgtctgag 120tcgacacgcg aggacaaaag
aaaagatgtc aatggcatca aaattttacc agcatgctcc 180aaagaaattt tgccagatca
tgaggtttct ttcacattga gcctctatga gagaggttat 240ctcatttcaa agtcagcacc
catggatcct agtcagacct caattcagga cggcaaaaca 300ctgcatccct atgatagagc
atcagaaaag ttgttctctg ctatcgaagc tgggaggcta 360cctggcgata tttttgatga
gataccaagc aagtactata atggatcagt tgtttgtgag 420atacatgact accgaaagca
tgtgtccaac caagcgcctg catcatctgc tgagctagga 480tcaccaattg tgaataaagt
acgactgcga atgacctttg aaaatgttgt aaaggacatt 540acccttctat ctgatgattc
ctggagttac agggatttta tggaagctga ggcttgtatt 600ttgagagctc tacaaccgga
actttgctta gaccccacac ctaaactgga tcgacttcat 660caggatcctg ttccgcataa
gttgagcctt ggtataggga aaaagaggag gctgaggcaa 720aatcctgaag ttgtcacatc
cagtcacatg tctcatggta aaaaggtttg cattgatagg 780ttacctgaaa gtgccaaagc
tgatgagatg ggcatcacta gcagtaatgc agctcagcag 840gttggtggta acattaccat
ccaaaatatg tcagtctcag gtggttctca gacacttaga 900ccaaataatt cttcacaaga
tgctgccaga acgcttttgc ctcaatctgg tctacagcaa 960accttgtgtt attctgctgc
tggtaatgat catatggcag gaccacctgc caatttttct 1020ggaaccagtt catgcatttc
atctcatcag agcctgattg gttacagtga ctctgtggct 1080gccaacagcc ttctatctgt
gaagagggaa atgcaggatg cctcgcttca agatcctaag 1140agaataaagc gaactggtgg
tattgatgat gtacagcagc agcagataag gcctcaaccc 1200cttggtgggc aggagatgca
atggaagaac catcaactgc atccacaatt agatgttaag 1260gggatgcagt atgcatcttc
actgagtggt cagagatatc cttcttcgat gatgaacaac 1320atgcaagatc caggatcttc
cttatatttt agtcatcagc aaaatttgag atacgatgct 1380aagcaagagc agatggatgg
ttctgataag tcaaaagaca ccttgcagtc tatggcacct 1440gaaacttcca tgctggatca
gcagcaatcc caatctcaac atttaccaca acaatcagtg 1500gcaagaaata atgttccaaa
catgggacag tggcaaaata ctcggttcgc agctgagaag 1560gacttcaaaa aagaagacat
aattcagaga agaaagttag cacctagctc tcgtgcccct 1620actgggcctg tgattcagtc
tccagtgtcc tcgaaatctg gagagttatc aggcagttca 1680atgggtggcc agtttggttc
tgctgtgaca tcagctgtaa caggggtaca gaaagataaa 1740tttgctgcaa attccggtac
tgcagttgga tttccttctg tagcttccag tcctagtgat 1800tccatgcacc gaatacaaca
gcctgctgtt gcttcctcaa agaggaaaac aaattctgtc 1860cccaaaactc aaccgcctgt
gagtgctgtt gggtctccag ccagtgtttc aaacatgcat 1920gcgctgctga atgcaagcag
tccatcgatt gggaccacac ctatgggaga ccaagcaatc 1980cttgataaat ttgtgaaaat
tgataacatt tcccatcggt accagctttt caataagaag 2040aagtttgata aaatatctca
aaagaaaacc attatcaatc gaaaccaaaa tgtagctggt 2100tgtctcaaca gttgtttcca
ttctgaggat tatatagata ccacaagacc tctttgtaat 2160tctatgatta gtggaactat
aaacacatgc aagggtaggg taataaactt tgtgagcaca 2220aaagacatgt accaaggtca
ttcaaggcca ttcccggttg attttaacga actgtctgat 2280gaaactgtaa gaatgcaata
tggagatata aaagattttg atgatccaaa ttcatatggt 2340tgtgtattca tattaccgac
aaagcactat gctgacttgt ttgcggggca gcttatttcc 2400cttatgttgc aagatggaca
ttctaaagct gacgatgaag ttgtgcgtag cacccctttt 2460gctaacatca gtacaccctt
tggaccttta ccaaacaacg tagtgagtga tgtaaagcaa 2520gagggaggtg taagccaaca
acttaatgcc gcagcccatg caaatgtggc acctggaaca 2580caaatgcaac agcttcctgt
caataggatg cttccatctg caaatggcaa ccagattcta 2640gcaatgcagc aaggttatat
gcaaggggca gccatgcctc caaggagcca gcatcttgac 2700caaaatttgg ttcagcagcc
gcagcaccaa cagccacaac agcaaccact gcagcaaaat 2760gctcaagccc aggtgcagca
accatcatct cttccactga accagatgca aagacctcag 2820gttctgccta cgagcccatt
atctcagatg ttggggcctg gctcaaatct cccaatgggc 2880tcaagtcaga taggtaagaa
taaggctcct cccacatctt tgcagcttca aatgctacag 2940gcacaacccc aacaacctat
gtctaggaaa gtgatgatgg ggcttggctc agccatgaac 3000atgggcaata tggttaacaa
tgttgttggt cttggtggcc tcggaaatgt tatgggaatg 3060ggcaacgtgc ggccaatatc
ttcccccatg gcatcgatgt caggcttagg taacaattcc 3120aatccaatga acatgggaat
ggcatccaat cttgctgcag ctggacttcg gccaggcatg 3180aaccctgctg ctattgccaa
ggtgcgtatg gggttggcac agcaaagggc agcaggcatg 3240taccctggaa tggttggaat
gcctggaagc agctcatcaa tccttcctag ttcagctggc 3300ttgtctatga tgggccagcc
gctaaacaga ggcaaccttg gccccctcca gagggccatg 3360atgtcgtcta tgggccctcc
aaaaatgcca ggaggtaact ttcagctgaa tgctcaacag 3420caaatacacc tccagcatca
gttgcagcag ctccaacaga acccacagca gcagctccaa 3480cagctacagc aacagcaaca
aatacaacaa ctgcagcagc agcagcagca gcagctccaa 3540caacagcaac tgcagcagca
acaacaaatg ggatctccgt tacagcaggc acaggtgggc 3600tcacctgctg gctcacagca
atcgccgatg atgcagcagc agcagcagca gcagcagcag 3660ataagccctc agcagatggg
acagcaggct gcaatgagcc cccagttgag ctcaggaact 3720ctgcagcaaa tgagcaataa
cgtggccaac cctgtagcca ctccaggccc tcctccaagc 3780ccgcagctga gctccggtca
acagcatagc taactccccg atggagcagc tgcaaggcgc 3840cattaaggga ggtcctggta
gtagtaaccg gagtccactt cttgcctatg gaaggtgtaa 3900acactgacca agatcactct
gttctcttgt ttgctgtggt aaatgaggtt aaattaggtg 3960tgttataagt tataggccat
agaggacagc tttaaggacc agctttatgc ttggattttt 4020atgctgtaca ttgtagttag
taggaatggt gtgttggagc tcggtaatca gttctatgca 4080agcattattc aattggacag
ttttctactc ttgtagcttc atgtttaaat ttaaattaaa 4140aaaaaaaaaa aaaaaaaaaa
aaaa 416431270PRTZea mays 3Met
Gly Ile Ser Phe Lys Leu Ser Lys Val Gly Val Arg Val His Pro 1
5 10 15 Ala Ala Arg Ser Ala Ser
Ala Ala Val Ala Glu Lys Pro Gly Ala Gly 20
25 30 Gly Lys Glu Gly Ser Leu Ser Glu Ser Thr
Arg Glu Asp Lys Arg Lys 35 40
45 Asp Val Asn Gly Ile Lys Ile Leu Pro Ala Cys Ser Lys Glu
Ile Leu 50 55 60
Pro Asp His Glu Val Ser Phe Thr Leu Ser Leu Tyr Glu Arg Gly Tyr 65
70 75 80 Leu Ile Ser Lys Ser
Ala Pro Met Asp Pro Ser Gln Thr Ser Ile Gln 85
90 95 Asp Gly Lys Thr Leu His Pro Tyr Asp Arg
Ala Ser Glu Lys Leu Phe 100 105
110 Ser Ala Ile Glu Ala Gly Arg Leu Pro Gly Asp Ile Phe Asp Glu
Ile 115 120 125 Pro
Ser Lys Tyr Tyr Asn Gly Ser Val Val Cys Glu Ile His Asp Tyr 130
135 140 Arg Lys His Val Ser Asn
Gln Ala Pro Ala Ser Ser Ala Glu Leu Gly 145 150
155 160 Ser Pro Ile Val Asn Lys Val Arg Leu Arg Met
Thr Phe Glu Asn Val 165 170
175 Val Lys Asp Ile Thr Leu Leu Ser Asp Asp Ser Trp Ser Tyr Arg Asp
180 185 190 Phe Met
Glu Ala Glu Ala Cys Ile Leu Arg Ala Leu Gln Pro Glu Leu 195
200 205 Cys Leu Asp Pro Thr Pro Lys
Leu Asp Arg Leu His Gln Asp Pro Val 210 215
220 Pro His Lys Leu Ser Leu Gly Ile Gly Lys Lys Arg
Arg Leu Arg Gln 225 230 235
240 Asn Pro Glu Val Val Thr Ser Ser His Met Ser His Gly Lys Lys Val
245 250 255 Cys Ile Asp
Arg Leu Pro Glu Ser Ala Lys Ala Asp Glu Met Gly Ile 260
265 270 Thr Ser Ser Asn Ala Ala Gln Gln
Val Gly Gly Asn Ile Thr Ile Gln 275 280
285 Asn Met Ser Val Ser Gly Gly Ser Gln Thr Leu Arg Pro
Asn Asn Ser 290 295 300
Ser Gln Asp Ala Ala Arg Thr Leu Leu Pro Gln Ser Gly Leu Gln Gln 305
310 315 320 Thr Leu Cys Tyr
Ser Ala Ala Gly Asn Asp His Met Ala Gly Pro Pro 325
330 335 Ala Asn Phe Ser Gly Thr Ser Ser Cys
Ile Ser Ser His Gln Ser Leu 340 345
350 Ile Gly Tyr Ser Asp Ser Val Ala Ala Asn Ser Leu Leu Ser
Val Lys 355 360 365
Arg Glu Met Gln Asp Ala Ser Leu Gln Asp Pro Lys Arg Ile Lys Arg 370
375 380 Thr Gly Gly Ile Asp
Asp Val Gln Gln Gln Gln Ile Arg Pro Gln Pro 385 390
395 400 Leu Gly Gly Gln Glu Met Gln Trp Lys Asn
His Gln Leu His Pro Gln 405 410
415 Leu Asp Val Lys Gly Met Gln Tyr Ala Ser Ser Leu Ser Gly Gln
Arg 420 425 430 Tyr
Pro Ser Ser Met Met Asn Asn Met Gln Asp Pro Gly Ser Ser Leu 435
440 445 Tyr Phe Ser His Gln Gln
Asn Leu Arg Tyr Asp Ala Lys Gln Glu Gln 450 455
460 Met Asp Gly Ser Asp Lys Ser Lys Asp Thr Leu
Gln Ser Met Ala Pro 465 470 475
480 Glu Thr Ser Met Leu Asp Gln Gln Gln Ser Gln Ser Gln His Leu Pro
485 490 495 Gln Gln
Ser Val Ala Arg Asn Asn Val Pro Asn Met Gly Gln Trp Gln 500
505 510 Asn Thr Arg Phe Ala Ala Glu
Lys Asp Phe Lys Lys Glu Asp Ile Ile 515 520
525 Gln Arg Arg Lys Leu Ala Pro Ser Ser Arg Ala Pro
Thr Gly Pro Val 530 535 540
Ile Gln Ser Pro Val Ser Ser Lys Ser Gly Glu Leu Ser Gly Ser Ser 545
550 555 560 Met Gly Gly
Gln Phe Gly Ser Ala Val Thr Ser Ala Val Thr Gly Val 565
570 575 Gln Lys Asp Lys Phe Ala Ala Asn
Ser Gly Thr Ala Val Gly Phe Pro 580 585
590 Ser Val Ala Ser Ser Pro Ser Asp Ser Met His Arg Ile
Gln Gln Pro 595 600 605
Ala Val Ala Ser Ser Lys Arg Lys Thr Asn Ser Val Pro Lys Thr Gln 610
615 620 Pro Pro Val Ser
Ala Val Gly Ser Pro Ala Ser Val Ser Asn Met His 625 630
635 640 Ala Leu Leu Asn Ala Ser Ser Pro Ser
Ile Gly Thr Thr Pro Met Gly 645 650
655 Asp Gln Ala Ile Leu Asp Lys Phe Val Lys Ile Asp Asn Ile
Ser His 660 665 670
Arg Tyr Gln Leu Phe Asn Lys Lys Lys Phe Asp Lys Ile Ser Gln Lys
675 680 685 Lys Thr Ile Ile
Asn Arg Asn Gln Asn Val Ala Gly Cys Leu Asn Ser 690
695 700 Cys Phe His Ser Glu Asp Tyr Ile
Asp Thr Thr Arg Pro Leu Cys Asn 705 710
715 720 Ser Met Ile Ser Gly Thr Ile Asn Thr Cys Lys Gly
Arg Val Ile Asn 725 730
735 Phe Val Ser Thr Lys Asp Met Tyr Gln Gly His Ser Arg Pro Phe Pro
740 745 750 Val Asp Phe
Asn Glu Leu Ser Asp Glu Thr Val Arg Met Gln Tyr Gly 755
760 765 Asp Ile Lys Asp Phe Asp Asp Pro
Asn Ser Tyr Gly Cys Val Phe Ile 770 775
780 Leu Pro Thr Lys His Tyr Ala Asp Leu Phe Ala Gly Gln
Leu Ile Ser 785 790 795
800 Leu Met Leu Gln Asp Gly His Ser Lys Ala Asp Asp Glu Val Val Arg
805 810 815 Ser Thr Pro Phe
Ala Asn Ile Ser Thr Pro Phe Gly Pro Leu Pro Asn 820
825 830 Asn Val Val Ser Asp Val Lys Gln Glu
Gly Gly Val Ser Gln Gln Leu 835 840
845 Asn Ala Ala Ala His Ala Asn Val Ala Pro Gly Thr Gln Met
Gln Gln 850 855 860
Leu Pro Val Asn Arg Met Leu Pro Ser Ala Asn Gly Asn Gln Ile Leu 865
870 875 880 Ala Met Gln Gln Gly
Tyr Met Gln Gly Ala Ala Met Pro Pro Arg Ser 885
890 895 Gln His Leu Asp Gln Asn Leu Val Gln Gln
Pro Gln His Gln Gln Pro 900 905
910 Gln Gln Gln Pro Leu Gln Gln Asn Ala Gln Ala Gln Val Gln Gln
Pro 915 920 925 Ser
Ser Leu Pro Leu Asn Gln Met Gln Arg Pro Gln Val Leu Pro Thr 930
935 940 Ser Pro Leu Ser Gln Met
Leu Gly Pro Gly Ser Asn Leu Pro Met Gly 945 950
955 960 Ser Ser Gln Ile Gly Lys Asn Lys Ala Pro Pro
Thr Ser Leu Gln Leu 965 970
975 Gln Met Leu Gln Ala Gln Pro Gln Gln Pro Met Ser Arg Lys Val Met
980 985 990 Met Gly
Leu Gly Ser Ala Met Asn Met Gly Asn Met Val Asn Asn Val 995
1000 1005 Val Gly Leu Gly Gly
Leu Gly Asn Val Met Gly Met Gly Asn Val 1010 1015
1020 Arg Pro Ile Ser Ser Pro Met Ala Ser Met
Ser Gly Leu Gly Asn 1025 1030 1035
Asn Ser Asn Pro Met Asn Met Gly Met Ala Ser Asn Leu Ala Ala
1040 1045 1050 Ala Gly
Leu Arg Pro Gly Met Asn Pro Ala Ala Ile Ala Lys Val 1055
1060 1065 Arg Met Gly Leu Ala Gln Gln
Arg Ala Ala Gly Met Tyr Pro Gly 1070 1075
1080 Met Val Gly Met Pro Gly Ser Ser Ser Ser Ile Leu
Pro Ser Ser 1085 1090 1095
Ala Gly Leu Ser Met Met Gly Gln Pro Leu Asn Arg Gly Asn Leu 1100
1105 1110 Gly Pro Leu Gln Arg
Ala Met Met Ser Ser Met Gly Pro Pro Lys 1115 1120
1125 Met Pro Gly Gly Asn Phe Gln Leu Asn Ala
Gln Gln Gln Ile His 1130 1135 1140
Leu Gln His Gln Leu Gln Gln Leu Gln Gln Asn Pro Gln Gln Gln
1145 1150 1155 Leu Gln
Gln Leu Gln Gln Gln Gln Gln Ile Gln Gln Leu Gln Gln 1160
1165 1170 Gln Gln Gln Gln Gln Leu Gln
Gln Gln Gln Leu Gln Gln Gln Gln 1175 1180
1185 Gln Met Gly Ser Pro Leu Gln Gln Ala Gln Val Gly
Ser Pro Ala 1190 1195 1200
Gly Ser Gln Gln Ser Pro Met Met Gln Gln Gln Gln Gln Gln Gln 1205
1210 1215 Gln Gln Ile Ser Pro
Gln Gln Met Gly Gln Gln Ala Ala Met Ser 1220 1225
1230 Pro Gln Leu Ser Ser Gly Thr Leu Gln Gln
Met Ser Asn Asn Val 1235 1240 1245
Ala Asn Pro Val Ala Thr Pro Gly Pro Pro Pro Ser Pro Gln Leu
1250 1255 1260 Ser Ser
Gly Gln Gln His Ser 1265 1270 44170DNAOryza sativa
4atggggatct cgttcaagct gtccaaggtg ggcgtccggg tccaccccgc cgcgcgggtg
60gccgccccgg cgccggcggc ggtcgcggcg gagaaggcgg ccgagaagga ggcgaagcgc
120gaggatggtg ttgttgaaag agctagtgat gccaatggca tcacgatttc accagcatgc
180tctaggataa ttttgccaga gcacgaggtt tccttcactt tcagtctgta tgatagaggc
240tatctcattg caaagtcagc agcgatggat ccttgccagc catcaataca ggatggaaaa
300acacttcatc cctatgacaa ggcgtctgaa aaattgtttt ctgcaattga atctgggaga
360ctgcctgaag atatacttga tgagatacca agcaagtact acaatggatc agtcatctgt
420gagatacgtg attatcgaaa gcatgcttcc aatcaagcac ctgcaccatc tgctgagcta
480ggactacctg ttgtgaataa agtgaggctg caaatgactt ttgaaaatgt tgtaagggac
540attcctcggc tatctgatga ttcctggagt taccgagatt tcatggaagc tgaggcacgg
600attgtgaaag ttctacaacc agcactttgt ttagatccta ctcctaagtt ggaccgactt
660tgtcaggatc ctgttcctca taagctgaac cttggtattg gaaaaaagag aaggctaagg
720cagaatcctg aagttgttgt cacatccaat aacatgtctc atggcaaaaa ggtgtgcata
780gacagggttt ctgaaaatat gaaatcagat gagatgggta tttcaggtgg caatgctgtt
840catcaaggcc ttgataacac tgccatccaa aatatgtcag gtggctctca gacatttaga
900ccagctaatt tttcaatgct gtcccaaacc agtatccagc aaactgtcaa ttatcctgct
960attggtaatg atcgtggggc agggactcct atgaactatg ctggaatcaa ttcaagcatt
1020tcatctccac aaaacttgat ggcttacaat gagacaacca atggcctttt atctgtgaag
1080agagaaatgg cagatgcccc actacaagac cctaagagag taaaaacaac ggtcagtgtt
1140gatgatatgc agcagcagca gcaaacaagg catcagccag ctggacttgg tgggcaggag
1200atgcagtgga agaatcaaca gctgcagcaa ttagatgtca agggcatgca gtatgctgct
1260tcggttgggc agagatatac tcatcctcat gtgcaagaac cagcttccat ttattcgaac
1320cagctaggta tgagatatgg agctaagcaa gagcagatgg atggcatgga caagtcaaaa
1380gacaccttgc aagctatggc acctgaaaat tctgtgctgg atcaacaaca acctcaggcc
1440ccacatttgt cacagcaagc aggcccacga aacatgcaac agtggcagaa tcctcgtttt
1500tcaggtgaga aggacttgaa gaaagaagaa atgcttcaga gaaggaagat agctgctact
1560tctcgtgtct cttctgtacc aatggttcag tctccagtct cctcaaaatc tggggagata
1620tcaagcagtt caatgagtgc ccagtttggc gctgctgtga catctgctgt aatgggatca
1680cagaaagaca agttccctgc aaattccaat cctgcagtag tgggctatcc ccctgttgct
1740tctagcccta gtgattcaat gcaccggatg cagcagcctt cagttgctcc ttcaaagaga
1800aaatcaaatt ctgttcccaa aactcaaccg cctgtgagtg gtgtagggtc tccagccagt
1860gtttcaaaca tgcatgctgt actgaatgct agcagcccat caattgggac tgcacctatg
1920ggtgatcaag caatccttga gagatttgtc aaaattgatg ccatatctca aaggtgcaag
1980ctgcacagca agaagaacaa agttgacaat atacctcaga gaaaaccgat tatcaatgca
2040agccaagaga aagttgctac agttctctcc aattgctttc atgctgaaga ttttagagat
2100gaaataaaac ctctttgtaa ctctatgttg ggtggaacaa tgaattcctt taagactaga
2160atactaaact ttgtggtcaa caaccgcatg taccaaggcc ctacaaagcc attccgtatc
2220attttcaagg agaagcatga tggaacagtg gcgatgcaat atggagatcc agaagatttt
2280gacaatcaga actcatatga gtgtacactg atattgccca ccaagtacca cgctgatctg
2340cttgcgaagc aacttattat ccggatggac cgagaaggcc ataccaaggc agacgatcaa
2400gttgcgctta gcacccctcc tggtaacctc agtgcattat caggaatttt accagacaac
2460acggtaaatg atgtgaaaca agaaggtggt attagccatc agctaaatgc tgcagctcat
2520gcaaatatga cacctggaac ccctttacaa caacaccctg ccaataggat gcttccatct
2580gtgaataacc aagcgttaat gcagcaagga tacatgcagg gggcaaacat gcctccgagg
2640agtcaacagc ttgaccagaa tttgattcag cagcagcaac agcagccgcc gcagctgcag
2700caaaatgcac aagcacaact gcagcaacca gcatctcttc ctctcaacca gatgcagaga
2760cctcaacttc taccaacgaa cccattatct cagatgctgg ggaatactgg ctccaatctt
2820ccgatggcct caagccacat gggtaacaag gtcgctccta attctgtgca gcttcagatg
2880atgcagcagc agcaacagtc gaggaaaatg atgatgggcc tcggctcgcc tgccaacatg
2940ggtaatatgg ttaacaatgt tgttggcctc aacaatattg gaaatgttat gggaatgggc
3000aatgtgcggc caatgtcgtc cccaatggga aacatgtcag gcttagggaa caaccccaat
3060cagatgagcc ttggaatggt atccagtctc tctgcacctg ggattcgtcc aggtatgaca
3120catgctgcta ttgccaagat gcgaatgggg ttgatacagc agcaaagagc agcaggcatt
3180tacccccaga ctagcatggt cggaatgcct gggagcagtt ctccgattct tcctggttct
3240gccaatttgt ccatgatgaa tcagctaaac agaagcaaca ttaacccttt gcagcgggcc
3300atgatgggtc caccaaagat gccaggcagt aattacccgt tgactccgca acagcaaatg
3360caactccagc aacagttcca acagaacccg ctgcagcagc agcaactgca gcaactccaa
3420caacagcagc agcaacaaca acaacagcaa atccagcagc agcagcagca gcaacagcaa
3480cagcagcagc agcagcagca aattcagcag cagcaacaac aaatgggctc tccgttacag
3540caggcggcac aggtgggctc acctgctggt tcgcagcagt cattggtgat gtcgcagcat
3600cagcaaataa gcccacagca aatggccgcg atgagtccac agctgagctc aggcaccatg
3660cagcaagtga ataacaatgt tatcaaccac gtagccacac caggccctcc tcctagcccg
3720cagctcagct cacagaccca tgggtcggtc aacagcatcg caaactcccc aatggagcag
3780ttgcaaggtg ccaataaagg aggtccaggg agcatgtagt gacggcaaat aattgtttct
3840gtgatggaca tacaaaataa tgcaaggtat aaatatcggc agtgatcagc actttttctt
3900atttgttgtg gtaaatgatg ttaaagttag gtgtcctgta agttatagcc aatagatgaa
3960gatattatgg aggatcagcc ttacgcaggg atttctgatg ttgtagattt tagataatga
4020aattagtacc tttaggggat tggtactgat gaaagttttg ttcaatggga ctactttctt
4080gtttaaatta attatcaagt ttgtgtaata gctatgtaac cgtggtgctt attaataagt
4140atcttcattt gattgtggaa attttgccct
417051272PRTOryza sativa 5Met Gly Ile Ser Phe Lys Leu Ser Lys Val Gly Val
Arg Val His Pro 1 5 10
15 Ala Ala Arg Val Ala Ala Pro Ala Pro Ala Ala Val Ala Ala Glu Lys
20 25 30 Ala Ala Glu
Lys Glu Ala Lys Arg Glu Asp Gly Val Val Glu Arg Ala 35
40 45 Ser Asp Ala Asn Gly Ile Thr Ile
Ser Pro Ala Cys Ser Arg Ile Ile 50 55
60 Leu Pro Glu His Glu Val Ser Phe Thr Phe Ser Leu Tyr
Asp Arg Gly 65 70 75
80 Tyr Leu Ile Ala Lys Ser Ala Ala Met Asp Pro Cys Gln Pro Ser Ile
85 90 95 Gln Asp Gly Lys
Thr Leu His Pro Tyr Asp Lys Ala Ser Glu Lys Leu 100
105 110 Phe Ser Ala Ile Glu Ser Gly Arg Leu
Pro Glu Asp Ile Leu Asp Glu 115 120
125 Ile Pro Ser Lys Tyr Tyr Asn Gly Ser Val Ile Cys Glu Ile
Arg Asp 130 135 140
Tyr Arg Lys His Ala Ser Asn Gln Ala Pro Ala Pro Ser Ala Glu Leu 145
150 155 160 Gly Leu Pro Val Val
Asn Lys Val Arg Leu Gln Met Thr Phe Glu Asn 165
170 175 Val Val Arg Asp Ile Pro Arg Leu Ser Asp
Asp Ser Trp Ser Tyr Arg 180 185
190 Asp Phe Met Glu Ala Glu Ala Arg Ile Val Lys Val Leu Gln Pro
Ala 195 200 205 Leu
Cys Leu Asp Pro Thr Pro Lys Leu Asp Arg Leu Cys Gln Asp Pro 210
215 220 Val Pro His Lys Leu Asn
Leu Gly Ile Gly Lys Lys Arg Arg Leu Arg 225 230
235 240 Gln Asn Pro Glu Val Val Val Thr Ser Asn Asn
Met Ser His Gly Lys 245 250
255 Lys Val Cys Ile Asp Arg Val Ser Glu Asn Met Lys Ser Asp Glu Met
260 265 270 Gly Ile
Ser Gly Gly Asn Ala Val His Gln Gly Leu Asp Asn Thr Ala 275
280 285 Ile Gln Asn Met Ser Gly Gly
Ser Gln Thr Phe Arg Pro Ala Asn Phe 290 295
300 Ser Met Leu Ser Gln Thr Ser Ile Gln Gln Thr Val
Asn Tyr Pro Ala 305 310 315
320 Ile Gly Asn Asp Arg Gly Ala Gly Thr Pro Met Asn Tyr Ala Gly Ile
325 330 335 Asn Ser Ser
Ile Ser Ser Pro Gln Asn Leu Met Ala Tyr Asn Glu Thr 340
345 350 Thr Asn Gly Leu Leu Ser Val Lys
Arg Glu Met Ala Asp Ala Pro Leu 355 360
365 Gln Asp Pro Lys Arg Val Lys Thr Thr Val Ser Val Asp
Asp Met Gln 370 375 380
Gln Gln Gln Gln Thr Arg His Gln Pro Ala Gly Leu Gly Gly Gln Glu 385
390 395 400 Met Gln Trp Lys
Asn Gln Gln Leu Gln Gln Leu Asp Val Lys Gly Met 405
410 415 Gln Tyr Ala Ala Ser Val Gly Gln Arg
Tyr Thr His Pro His Val Gln 420 425
430 Glu Pro Ala Ser Ile Tyr Ser Asn Gln Leu Gly Met Arg Tyr
Gly Ala 435 440 445
Lys Gln Glu Gln Met Asp Gly Met Asp Lys Ser Lys Asp Thr Leu Gln 450
455 460 Ala Met Ala Pro Glu
Asn Ser Val Leu Asp Gln Gln Gln Pro Gln Ala 465 470
475 480 Pro His Leu Ser Gln Gln Ala Gly Pro Arg
Asn Met Gln Gln Trp Gln 485 490
495 Asn Pro Arg Phe Ser Gly Glu Lys Asp Leu Lys Lys Glu Glu Met
Leu 500 505 510 Gln
Arg Arg Lys Ile Ala Ala Thr Ser Arg Val Ser Ser Val Pro Met 515
520 525 Val Gln Ser Pro Val Ser
Ser Lys Ser Gly Glu Ile Ser Ser Ser Ser 530 535
540 Met Ser Ala Gln Phe Gly Ala Ala Val Thr Ser
Ala Val Met Gly Ser 545 550 555
560 Gln Lys Asp Lys Phe Pro Ala Asn Ser Asn Pro Ala Val Val Gly Tyr
565 570 575 Pro Pro
Val Ala Ser Ser Pro Ser Asp Ser Met His Arg Met Gln Gln 580
585 590 Pro Ser Val Ala Pro Ser Lys
Arg Lys Ser Asn Ser Val Pro Lys Thr 595 600
605 Gln Pro Pro Val Ser Gly Val Gly Ser Pro Ala Ser
Val Ser Asn Met 610 615 620
His Ala Val Leu Asn Ala Ser Ser Pro Ser Ile Gly Thr Ala Pro Met 625
630 635 640 Gly Asp Gln
Ala Ile Leu Glu Arg Phe Val Lys Ile Asp Ala Ile Ser 645
650 655 Gln Arg Cys Lys Leu His Ser Lys
Lys Asn Lys Val Asp Asn Ile Pro 660 665
670 Gln Arg Lys Pro Ile Ile Asn Ala Ser Gln Glu Lys Val
Ala Thr Val 675 680 685
Leu Ser Asn Cys Phe His Ala Glu Asp Phe Arg Asp Glu Ile Lys Pro 690
695 700 Leu Cys Asn Ser
Met Leu Gly Gly Thr Met Asn Ser Phe Lys Thr Arg 705 710
715 720 Ile Leu Asn Phe Val Val Asn Asn Arg
Met Tyr Gln Gly Pro Thr Lys 725 730
735 Pro Phe Arg Ile Ile Phe Lys Glu Lys His Asp Gly Thr Val
Ala Met 740 745 750
Gln Tyr Gly Asp Pro Glu Asp Phe Asp Asn Gln Asn Ser Tyr Glu Cys
755 760 765 Thr Leu Ile Leu
Pro Thr Lys Tyr His Ala Asp Leu Leu Ala Lys Gln 770
775 780 Leu Ile Ile Arg Met Asp Arg Glu
Gly His Thr Lys Ala Asp Asp Gln 785 790
795 800 Val Ala Leu Ser Thr Pro Pro Gly Asn Leu Ser Ala
Leu Ser Gly Ile 805 810
815 Leu Pro Asp Asn Thr Val Asn Asp Val Lys Gln Glu Gly Gly Ile Ser
820 825 830 His Gln Leu
Asn Ala Ala Ala His Ala Asn Met Thr Pro Gly Thr Pro 835
840 845 Leu Gln Gln His Pro Ala Asn Arg
Met Leu Pro Ser Val Asn Asn Gln 850 855
860 Ala Leu Met Gln Gln Gly Tyr Met Gln Gly Ala Asn Met
Pro Pro Arg 865 870 875
880 Ser Gln Gln Leu Asp Gln Asn Leu Ile Gln Gln Gln Gln Gln Gln Pro
885 890 895 Pro Gln Leu Gln
Gln Asn Ala Gln Ala Gln Leu Gln Gln Pro Ala Ser 900
905 910 Leu Pro Leu Asn Gln Met Gln Arg Pro
Gln Leu Leu Pro Thr Asn Pro 915 920
925 Leu Ser Gln Met Leu Gly Asn Thr Gly Ser Asn Leu Pro Met
Ala Ser 930 935 940
Ser His Met Gly Asn Lys Val Ala Pro Asn Ser Val Gln Leu Gln Met 945
950 955 960 Met Gln Gln Gln Gln
Gln Ser Arg Lys Met Met Met Gly Leu Gly Ser 965
970 975 Pro Ala Asn Met Gly Asn Met Val Asn Asn
Val Val Gly Leu Asn Asn 980 985
990 Ile Gly Asn Val Met Gly Met Gly Asn Val Arg Pro Met Ser
Ser Pro 995 1000 1005
Met Gly Asn Met Ser Gly Leu Gly Asn Asn Pro Asn Gln Met Ser 1010
1015 1020 Leu Gly Met Val Ser
Ser Leu Ser Ala Pro Gly Ile Arg Pro Gly 1025 1030
1035 Met Thr His Ala Ala Ile Ala Lys Met Arg
Met Gly Leu Ile Gln 1040 1045 1050
Gln Gln Arg Ala Ala Gly Ile Tyr Pro Gln Thr Ser Met Val Gly
1055 1060 1065 Met Pro
Gly Ser Ser Ser Pro Ile Leu Pro Gly Ser Ala Asn Leu 1070
1075 1080 Ser Met Met Asn Gln Leu Asn
Arg Ser Asn Ile Asn Pro Leu Gln 1085 1090
1095 Arg Ala Met Met Gly Pro Pro Lys Met Pro Gly Ser
Asn Tyr Pro 1100 1105 1110
Leu Thr Pro Gln Gln Gln Met Gln Leu Gln Gln Gln Phe Gln Gln 1115
1120 1125 Asn Pro Leu Gln Gln
Gln Gln Leu Gln Gln Leu Gln Gln Gln Gln 1130 1135
1140 Gln Gln Gln Gln Gln Gln Gln Ile Gln Gln
Gln Gln Gln Gln Gln 1145 1150 1155
Gln Gln Gln Gln Gln Gln Gln Gln Gln Ile Gln Gln Gln Gln Gln
1160 1165 1170 Gln Met
Gly Ser Pro Leu Gln Gln Ala Ala Gln Val Gly Ser Pro 1175
1180 1185 Ala Gly Ser Gln Gln Ser Leu
Val Met Ser Gln His Gln Gln Ile 1190 1195
1200 Ser Pro Gln Gln Met Ala Ala Met Ser Pro Gln Leu
Ser Ser Gly 1205 1210 1215
Thr Met Gln Gln Val Asn Asn Asn Val Ile Asn His Val Ala Thr 1220
1225 1230 Pro Gly Pro Pro Pro
Ser Pro Gln Leu Ser Ser Gln Thr His Gly 1235 1240
1245 Ser Val Asn Ser Ile Ala Asn Ser Pro Met
Glu Gln Leu Gln Gly 1250 1255 1260
Ala Asn Lys Gly Gly Pro Gly Ser Met 1265
1270 63984DNASorghum bicolor 6atggggatct cgttcaagct gtccaaggtc
ggggtccgcg tgcacccggc cgcgcgctcg 60gcgtccgcgg cgctggcaca ggcggcggag
gcggaaaagc cggccacggg ggagaaggag 120gggtccctgt ctgagtcgag acgcgaggac
aacttcgttg agagaggaaa agatgtcaat 180ggaatcaaaa ttttaccagc gtgctccaag
gaaattttgc cagatcatga ggtttctttc 240acatttagcc tctatgagag aggttatctc
atttcaaagt cagcatctat ggatcctagt 300cagacctcaa tccaggacag caaaacactg
catccctatg atagagcatc ggaaaagtta 360ttctctgcca ttgaagctgg aaggctacca
ggcgatattc ttgatgagat accaagcaag 420tactataatg gatcagttgt ttgtgagata
cgtgactacc gaaagcatgt gtccaaccaa 480gcgcctgcat catctgctga gctaggttta
cctattgtga ataaagtgcg actacgaatg 540acctttgaga atgttgtaaa ggacattacc
cttctatctg atgattcctg gacttacagg 600gattttgtgg aagctgaggc tcgcattgtg
agagctctac aaccagaact ttgcttagac 660cctacaccta aactggatcg actttgtcag
gatcctgttc cgcataagtt gagcctcggt 720ataggaaaaa agaggaggct gaggcaaaat
cctgaagttg ttgtcacatc cagtaacatg 780tctcatggta aaaaggtttg cattgatagg
ttacctgaaa atgccaaagt tgatgacatg 840ggcatcacca gcagtaatgc agctcagcag
gttggtgata acattaccat ccaaaatatc 900tcggtctcgg gtggttctca gacacttaga
ccaaataatt cttcacaaga tgctgccaga 960atgcttttgt cccaatctgg tctacagcaa
gcattaagtt attctgctgc tggtaatgat 1020cgtatggcag gactgcctgc caatttttct
ggaatcaatt caagcatttc atctccccag 1080agcatgattg gttacaatga cactgtggct
gccaatggcc ttctatctgt gaagagagaa 1140atgcaagatg ccccgcttca agatcctaag
agaataaagc caactggtgg cattgatgat 1200gtacagcagc agcagataag gcctcaaccc
cttggtgggc tggagatgca atggaagaac 1260catcaactgc atccacaatt agatgtcaag
gggatgcagt atgcatcttc actgagtggt 1320cagagatatc cttcttcgat gatgaacaac
atgcaagatc caggatcttc cttatatttc 1380aatcatcagc aaaatttgag atacggtgct
aagcaagagc agatggatgg ttctgataag 1440tcgaaagacg ccttgcagtc tatggcacct
gaaagttcca tgctggatca gcagcaatcc 1500caggctcaac atttaccaca gcaatcagcg
gcaagaaaca atgttccaaa catgggacag 1560tggcaaaata ctcggttcgc agctgagaag
gacttgaaaa aagaagaaat aattccaaga 1620agaaaattag cacctagctc tcgtgcccct
tctgggccta tggttcagtc tccagtgtcc 1680tcgaaatctg gagagatatc aagcagttca
atgggtggcc agtttggttc tgctgtgaca 1740tcagctgtaa taggggcaca gaaagataaa
tttgctgcaa attccagtgc tgcagttgga 1800tttccttctg tagcttccag ccctaatgat
tccatgcacc gaatacaaca gccagctgtt 1860gcttcctcaa agaggaaaac aaattctgtc
cccaaaactc aaccgcctgt gagtgctgtt 1920gggtctccag ccagtgtttc aaatatgcat
gctccgctga atgcgagcag cccatcgatt 1980gggaccacac ctatgggaga ccaagcaatc
cttgataaat ttgcaaaaat tgataatatt 2040tcccatcggt accagcttct caataagaag
aacaaggttg ataaaatatc tcaaaagaaa 2100accattacca atcaaagtca tccagatgta
gctagatgtc tcaatagttg tttccattct 2160gaggattata tagatacaac aagacctctt
tgtaattcta tgattagtgg aactataaac 2220acgtgcaaga ctagggtaat aaactttgtg
agcacaaacc gcatgtacca aggtcattca 2280aggccattcc aggttatttt caaggaaatt
tctgatgaaa ctgtaaaaat gcaatatgga 2340gatctagaag attttgatgg tccgaatgcg
catgattgtg tattcatatt accaacaaag 2400tactatgctg acttgcttgc agagcagctt
attcccctta tgttgcaaga tgggcattct 2460aaagctgatg ataaagtcgt gcgcggcacc
ccccttgcta acctcagtac gctgtctgga 2520attttaccag acaatttagt gagtgatgta
aagcaagagg gaggtgtaag ccaacaactt 2580aatgctgcag cccatgcaaa tgtgccacct
ggaacacaga tgcaacagct tcctgtcaat 2640aggatgcttt catctgcgag tagcaaccag
gttctagcaa tgcagcaagg ttatatgcaa 2700ggggcagcca tgcctgcaag gagccagcaa
cttgaccaaa atttggttca gcagccgcag 2760cagcaacagc cacagcagca gccactgcag
caaaatgctc aagcccagat gcagcaacca 2820tcctctcttc cactgaacca gatgcaaaga
cctcagcttc tgcccacgag cccattatca 2880cagatgttgg ggcctggctc aaatctcaca
atgggctcaa gccagatagg taacaataag 2940gctcctcctt catccttgca gcttcagatg
ctacaggcac aacagcaaca acctatgtct 3000aggaaagtga tgatgggcct cggctcagcc
atgaacatgg gcaatatggt taacaatgtt 3060gttggtcttg gtggccttgg taatgttatg
ggaatgggca acgtgcgtcc aatatcctcc 3120cccatgggat cgatgtcagg cttaggtaac
aattccaatc caatgaacat gggaatggca 3180tccaatcttg ctgcagctgg acttcggcca
ggtatgaacc ctgctacttt tgccaagatg 3240cgtatcggtt tggcacaaca aagggcagca
ggcatgtatc ctggaatggt tggaatgcct 3300ggaagcagct ctccaatcct tcctagttca
gctggcttat ctatgatggg ccagccgcta 3360aacagaagca accttggtcc cctgcagagg
gccatgatgt cgtctatggg ccctccaaaa 3420attccaggag gtaactttca gctgaacgcg
caacagcaaa tgcagctcca gcagcagttg 3480cagcagcagc agcagctcca acagaacccc
cagcaacagc agcagctcca tcagaacccg 3540cagcagcagc aactgcagca gctacagcaa
cagcaacaaa tacagcaaca actgcagcag 3600cagcagcagc tccaacaaca actgcagcag
caacagcagc agcaacaaca acaacaaatg 3660ggatctccgt tacagcaggc acaggtgggc
tcacctgctg gctcgcagca gtcgctgatg 3720atgcagcagc agcagcagat aagcccacag
caaatgggac agcaggctgc catgagcccc 3780cagttgagct caggaacgct gcagcaaatg
agcaataacg tggtcaaccc tgtagccact 3840ccaggtcctc ccccaagccc gcagctgagc
tcccagaccc atgggtcgga aggtgtaaac 3900actggccaag atcactatgt tttctttgtt
gtggtaaatg aggttaaatt aggtgtgtta 3960tacatttaca ttcttgacag ataa
398471327PRTSorghum bicolor 7Met Gly Ile
Ser Phe Lys Leu Ser Lys Val Gly Val Arg Val His Pro 1 5
10 15 Ala Ala Arg Ser Ala Ser Ala Ala
Leu Ala Gln Ala Ala Glu Ala Glu 20 25
30 Lys Pro Ala Thr Gly Glu Lys Glu Gly Ser Leu Ser Glu
Ser Arg Arg 35 40 45
Glu Asp Asn Phe Val Glu Arg Gly Lys Asp Val Asn Gly Ile Lys Ile 50
55 60 Leu Pro Ala Cys
Ser Lys Glu Ile Leu Pro Asp His Glu Val Ser Phe 65 70
75 80 Thr Phe Ser Leu Tyr Glu Arg Gly Tyr
Leu Ile Ser Lys Ser Ala Ser 85 90
95 Met Asp Pro Ser Gln Thr Ser Ile Gln Asp Ser Lys Thr Leu
His Pro 100 105 110
Tyr Asp Arg Ala Ser Glu Lys Leu Phe Ser Ala Ile Glu Ala Gly Arg
115 120 125 Leu Pro Gly Asp
Ile Leu Asp Glu Ile Pro Ser Lys Tyr Tyr Asn Gly 130
135 140 Ser Val Val Cys Glu Ile Arg Asp
Tyr Arg Lys His Val Ser Asn Gln 145 150
155 160 Ala Pro Ala Ser Ser Ala Glu Leu Gly Leu Pro Ile
Val Asn Lys Val 165 170
175 Arg Leu Arg Met Thr Phe Glu Asn Val Val Lys Asp Ile Thr Leu Leu
180 185 190 Ser Asp Asp
Ser Trp Thr Tyr Arg Asp Phe Val Glu Ala Glu Ala Arg 195
200 205 Ile Val Arg Ala Leu Gln Pro Glu
Leu Cys Leu Asp Pro Thr Pro Lys 210 215
220 Leu Asp Arg Leu Cys Gln Asp Pro Val Pro His Lys Leu
Ser Leu Gly 225 230 235
240 Ile Gly Lys Lys Arg Arg Leu Arg Gln Asn Pro Glu Val Val Val Thr
245 250 255 Ser Ser Asn Met
Ser His Gly Lys Lys Val Cys Ile Asp Arg Leu Pro 260
265 270 Glu Asn Ala Lys Val Asp Asp Met Gly
Ile Thr Ser Ser Asn Ala Ala 275 280
285 Gln Gln Val Gly Asp Asn Ile Thr Ile Gln Asn Ile Ser Val
Ser Gly 290 295 300
Gly Ser Gln Thr Leu Arg Pro Asn Asn Ser Ser Gln Asp Ala Ala Arg 305
310 315 320 Met Leu Leu Ser Gln
Ser Gly Leu Gln Gln Ala Leu Ser Tyr Ser Ala 325
330 335 Ala Gly Asn Asp Arg Met Ala Gly Leu Pro
Ala Asn Phe Ser Gly Ile 340 345
350 Asn Ser Ser Ile Ser Ser Pro Gln Ser Met Ile Gly Tyr Asn Asp
Thr 355 360 365 Val
Ala Ala Asn Gly Leu Leu Ser Val Lys Arg Glu Met Gln Asp Ala 370
375 380 Pro Leu Gln Asp Pro Lys
Arg Ile Lys Pro Thr Gly Gly Ile Asp Asp 385 390
395 400 Val Gln Gln Gln Gln Ile Arg Pro Gln Pro Leu
Gly Gly Leu Glu Met 405 410
415 Gln Trp Lys Asn His Gln Leu His Pro Gln Leu Asp Val Lys Gly Met
420 425 430 Gln Tyr
Ala Ser Ser Leu Ser Gly Gln Arg Tyr Pro Ser Ser Met Met 435
440 445 Asn Asn Met Gln Asp Pro Gly
Ser Ser Leu Tyr Phe Asn His Gln Gln 450 455
460 Asn Leu Arg Tyr Gly Ala Lys Gln Glu Gln Met Asp
Gly Ser Asp Lys 465 470 475
480 Ser Lys Asp Ala Leu Gln Ser Met Ala Pro Glu Ser Ser Met Leu Asp
485 490 495 Gln Gln Gln
Ser Gln Ala Gln His Leu Pro Gln Gln Ser Ala Ala Arg 500
505 510 Asn Asn Val Pro Asn Met Gly Gln
Trp Gln Asn Thr Arg Phe Ala Ala 515 520
525 Glu Lys Asp Leu Lys Lys Glu Glu Ile Ile Pro Arg Arg
Lys Leu Ala 530 535 540
Pro Ser Ser Arg Ala Pro Ser Gly Pro Met Val Gln Ser Pro Val Ser 545
550 555 560 Ser Lys Ser Gly
Glu Ile Ser Ser Ser Ser Met Gly Gly Gln Phe Gly 565
570 575 Ser Ala Val Thr Ser Ala Val Ile Gly
Ala Gln Lys Asp Lys Phe Ala 580 585
590 Ala Asn Ser Ser Ala Ala Val Gly Phe Pro Ser Val Ala Ser
Ser Pro 595 600 605
Asn Asp Ser Met His Arg Ile Gln Gln Pro Ala Val Ala Ser Ser Lys 610
615 620 Arg Lys Thr Asn Ser
Val Pro Lys Thr Gln Pro Pro Val Ser Ala Val 625 630
635 640 Gly Ser Pro Ala Ser Val Ser Asn Met His
Ala Pro Leu Asn Ala Ser 645 650
655 Ser Pro Ser Ile Gly Thr Thr Pro Met Gly Asp Gln Ala Ile Leu
Asp 660 665 670 Lys
Phe Ala Lys Ile Asp Asn Ile Ser His Arg Tyr Gln Leu Leu Asn 675
680 685 Lys Lys Asn Lys Val Asp
Lys Ile Ser Gln Lys Lys Thr Ile Thr Asn 690 695
700 Gln Ser His Pro Asp Val Ala Arg Cys Leu Asn
Ser Cys Phe His Ser 705 710 715
720 Glu Asp Tyr Ile Asp Thr Thr Arg Pro Leu Cys Asn Ser Met Ile Ser
725 730 735 Gly Thr
Ile Asn Thr Cys Lys Thr Arg Val Ile Asn Phe Val Ser Thr 740
745 750 Asn Arg Met Tyr Gln Gly His
Ser Arg Pro Phe Gln Val Ile Phe Lys 755 760
765 Glu Ile Ser Asp Glu Thr Val Lys Met Gln Tyr Gly
Asp Leu Glu Asp 770 775 780
Phe Asp Gly Pro Asn Ala His Asp Cys Val Phe Ile Leu Pro Thr Lys 785
790 795 800 Tyr Tyr Ala
Asp Leu Leu Ala Glu Gln Leu Ile Pro Leu Met Leu Gln 805
810 815 Asp Gly His Ser Lys Ala Asp Asp
Lys Val Val Arg Gly Thr Pro Leu 820 825
830 Ala Asn Leu Ser Thr Leu Ser Gly Ile Leu Pro Asp Asn
Leu Val Ser 835 840 845
Asp Val Lys Gln Glu Gly Gly Val Ser Gln Gln Leu Asn Ala Ala Ala 850
855 860 His Ala Asn Val
Pro Pro Gly Thr Gln Met Gln Gln Leu Pro Val Asn 865 870
875 880 Arg Met Leu Ser Ser Ala Ser Ser Asn
Gln Val Leu Ala Met Gln Gln 885 890
895 Gly Tyr Met Gln Gly Ala Ala Met Pro Ala Arg Ser Gln Gln
Leu Asp 900 905 910
Gln Asn Leu Val Gln Gln Pro Gln Gln Gln Gln Pro Gln Gln Gln Pro
915 920 925 Leu Gln Gln Asn
Ala Gln Ala Gln Met Gln Gln Pro Ser Ser Leu Pro 930
935 940 Leu Asn Gln Met Gln Arg Pro Gln
Leu Leu Pro Thr Ser Pro Leu Ser 945 950
955 960 Gln Met Leu Gly Pro Gly Ser Asn Leu Thr Met Gly
Ser Ser Gln Ile 965 970
975 Gly Asn Asn Lys Ala Pro Pro Ser Ser Leu Gln Leu Gln Met Leu Gln
980 985 990 Ala Gln Gln
Gln Gln Pro Met Ser Arg Lys Val Met Met Gly Leu Gly 995
1000 1005 Ser Ala Met Asn Met Gly
Asn Met Val Asn Asn Val Val Gly Leu 1010 1015
1020 Gly Gly Leu Gly Asn Val Met Gly Met Gly Asn
Val Arg Pro Ile 1025 1030 1035
Ser Ser Pro Met Gly Ser Met Ser Gly Leu Gly Asn Asn Ser Asn
1040 1045 1050 Pro Met Asn
Met Gly Met Ala Ser Asn Leu Ala Ala Ala Gly Leu 1055
1060 1065 Arg Pro Gly Met Asn Pro Ala Thr
Phe Ala Lys Met Arg Ile Gly 1070 1075
1080 Leu Ala Gln Gln Arg Ala Ala Gly Met Tyr Pro Gly Met
Val Gly 1085 1090 1095
Met Pro Gly Ser Ser Ser Pro Ile Leu Pro Ser Ser Ala Gly Leu 1100
1105 1110 Ser Met Met Gly Gln
Pro Leu Asn Arg Ser Asn Leu Gly Pro Leu 1115 1120
1125 Gln Arg Ala Met Met Ser Ser Met Gly Pro
Pro Lys Ile Pro Gly 1130 1135 1140
Gly Asn Phe Gln Leu Asn Ala Gln Gln Gln Met Gln Leu Gln Gln
1145 1150 1155 Gln Leu
Gln Gln Gln Gln Gln Leu Gln Gln Asn Pro Gln Gln Gln 1160
1165 1170 Gln Gln Leu His Gln Asn Pro
Gln Gln Gln Gln Leu Gln Gln Leu 1175 1180
1185 Gln Gln Gln Gln Gln Ile Gln Gln Gln Leu Gln Gln
Gln Gln Gln 1190 1195 1200
Leu Gln Gln Gln Leu Gln Gln Gln Gln Gln Gln Gln Gln Gln Gln 1205
1210 1215 Gln Met Gly Ser Pro
Leu Gln Gln Ala Gln Val Gly Ser Pro Ala 1220 1225
1230 Gly Ser Gln Gln Ser Leu Met Met Gln Gln
Gln Gln Gln Ile Ser 1235 1240 1245
Pro Gln Gln Met Gly Gln Gln Ala Ala Met Ser Pro Gln Leu Ser
1250 1255 1260 Ser Gly
Thr Leu Gln Gln Met Ser Asn Asn Val Val Asn Pro Val 1265
1270 1275 Ala Thr Pro Gly Pro Pro Pro
Ser Pro Gln Leu Ser Ser Gln Thr 1280 1285
1290 His Gly Ser Glu Gly Val Asn Thr Gly Gln Asp His
Tyr Val Phe 1295 1300 1305
Phe Val Val Val Asn Glu Val Lys Leu Gly Val Leu Tyr Ile Tyr 1310
1315 1320 Ile Leu Asp Arg
1325 84500DNAPaspalum notatum 8caaccgcgtc tcccaacacc gagctcacct
catcacacgc ccctctcctc ccccctaacc 60ccctcgctcg tcggcggcga gagagacggc
ggcggaggct gtggagcagg aagcctaggt 120gtacgccgcg gggcggcgtc ccctgtgggg
atggggatct cgttcaagat atccaaggtc 180ggcgtccgcg tgcacccggg cgcgcgctcg
gcttcagcga cgcaggcgca ggcggaaaag 240ccggccgcgg tcgacaagga gggatccgtg
tctgactcga gaggcgaggg tgactttgtt 300gagggagcaa aagatatcaa tggaatcata
atttcaccag catgctcgag ggaaatttcg 360cctgatcatg aggtttcttt cacattcagc
ctttatgaca gaggttatct catttcaaag 420tcagcagcta tggattccaa ccagacctca
attcaggatg gtaaaacact acatccctat 480gatagagcat cagaaaagtt attctcttct
attgaagctg ggaggctgcc tggtgatatt 540cttgatgata taccaagcaa gtactacagt
gggtcagttg tttgtgagat acgtgactac 600agaaagcatg tgtccaatca agttcctgca
tcatctgctg agctaggatt acctatcgtg 660aataaagtac aactgcgaat gacctttgag
aatgttgtga aagacatttc acttctatct 720gatgattcct ggagttacag ggattttgtg
gaagctgagg ctcgtattgt gagagtccta 780caaccagaac tttgcttaga ccctactcct
aaactggatc gactttatca ggatcctgtt 840cctcataagt tgagccttgg tattggaaag
aagaggaggc tgaggcaaaa tcctgaagtt 900gttgtcacat ccagtaacat gtctcatggt
aaaaaagttt gcattgatag gttacctgaa 960aataccaaag cagatgaaat gggcatcgca
ggcagtaatg cagctcacca ggttggtgat 1020aacataacca tccaaaatat tccgggtggt
catcagccac ttagaccaaa taatgcttca 1080caagatgctg ccagaatgct attgtcccaa
acccaacctg gtatacagca aacagtaagt 1140tattctgcca ttggtaatga tcgtatggca
ggaccacctg ccaatttttc tggaatcagt 1200tcaagcattt catctcctca gagcatgatt
ggttacaatg acactgtttc tgccaatggc 1260cttctatctg tgaagaggga aatgcaagat
gttccacttc aagatcctaa gagaataaag 1320ccaactggtg gtactgatga cgtacagcag
cagcagacaa ggcatcaacc ccttggtggg 1380caggagatgc aatggaagaa tcaactgcat
ccacaattag atgtcaaggg gatgcagtat 1440gcatcttcat tgagtagtca gagatatcct
acttcgttga tgaacaatat gcaagattca 1500ggatcttcct tctatttcaa tcagcaaggt
ttgagataca gtgctaagca ggagcagatg 1560gatggttccg ataggtcgaa agatgcattg
cagtctatgg cacctgaaag ttctatgctg 1620gaccagcagc agtcccaggc tcaacattta
tcacagcaat cagcagcaag aaataatgtt 1680ccaaacatgg cacagtggca gaatagggca
gctgagaagg acctgaaaaa agaagaaata 1740attcagagaa gaaagttagc acctagctct
cgtgcccctt ctgggccaat ggttcagtct 1800ccagtgtcct caaaatctgg agagatatca
agcagttcca tgggtggtca gttcggttct 1860gctgtgacat cagctgtaat aggggcacag
aaagataaat ttgctgcaaa ttccagtgct 1920gcagttggat acccttcagt agtttccagt
cctagtgatt ccatgcaccg aatacaacaa 1980cctgctgttg ctccttcaaa gaggaaatca
aattctgtcc ctaaaaatca accacctgtg 2040agcgctgttg ggtctccagc tagtgtttca
aatatgcacg ctccgctgaa tgcaagcagc 2100ccatcagttg gcaccgcacc tatgggagac
caagcaatcc ttgataaatt tgcaaaaatt 2160gaaaatcttt cccatcggta ccagcttcac
aataagaaga agaaggttga tacgatacct 2220caaagaaaac ccataaccaa aagccaagaa
gtcgttagat gtctgtccag ttgttttcat 2280actgaggatt atatagatac aacaagacct
ctttgtaatt ctatgattag tggaactata 2340aacacatgca agagtagggt aataaacttt
gtgagcacaa accgcattta ccaaggtcat 2400gaaaggccat tccaggttgt ctttaaggaa
atgcctgatg aaactgtgag aatgcaatat 2460ggagatcaag aagattttga tggcccgaat
tcatatgatt gtgtattcat attaccaacg 2520aagtactatg ctgacttgct tgcagagcag
cttatacccc tgatgttgca agatgggcat 2580tctaaagctg atgataaagt tcgtggcacc
catcctgcta acctcagtac actgtcagga 2640attttaccag acaatttagt gagtgacgta
aagcaagagg gaggtgtaag ccagcaactt 2700aatgctgcag cccatgcaaa tgcgacacct
ggaacaccaa tgcaacaact tcctgtcaat 2760aggatgcttt catctgcaaa tagcaaccag
gttctaccaa tgcagccagg gtatatgcaa 2820ggggcagcca tgcctccaag gagtcaacaa
cttgaccaaa atttggttca gcagtcacag 2880cagcaccagc cacagcagca accagtgcag
caaaatgctc aagcacagat gcagcaacct 2940tcttctcttc cactcaacca gatgcagaga
cctcaacttc taccaacaag cccattatct 3000cagatgttgg ggcctggctc aaatctccca
atgggctcaa gtcaaatggg taacaataag 3060cagcctacag ccaattcctt gcagcttcag
atgctacagc aagcacaaca gcaacagcct 3120atgtctagga aagggatgat ggggcttggc
tcagccatga acatgggcaa tatggttaac 3180aatgtcgtta gtgtcggtgg cctaatgggc
aatgtgcggc caatatcctc ccccatggga 3240tcgatgtcag gcttaggcaa caataccaat
ccaatgaaca tgggaatgcc atcaaacctt 3300gctgctggac ttcggccagg tatgagcgca
gctactattg ccaagatgcg aatggcacag 3360caaagggcag gcatgtatcc tcagactgga
atggttggaa tgcctggcag cagctctcca 3420atccttccta gttcagctaa cttgaccatg
atgaatcatc cgctaaatag gagcaacctc 3480aaccccctgc aaagggccat gatgtcttct
atgggccctc caaagatgcc aggaggtaac 3540tttcagctga acccccagca gcaaatgcag
ctccagcagc tgcagcagca gcagcagcag 3600ctccaacaga acccacagca gcagcagcag
cagctccaac agcagcagca gcagcagcag 3660ctccagcagc agcagcagca gcagctccca
cagcaacaac tgcagcaaat gcaacagcta 3720cagcagcagc agctgcaaca acagctgcag
ctgcagcaac agcaacagca aatgggatct 3780ccacggcagc aggcgcaggt gggatcacca
gctggctcgc agcagtcgtt gatgatgcag 3840cagcagataa gccctccgca aatgggacag
catgctgcaa tgagccccca gttgagctca 3900ggaactctgc agcaaatgag caacaacgtg
gccaaccctg tagccactcc aggtccgccc 3960ccaagcccgc aactgagctc ccagacgcat
gggtcagtga acagcattgc caactcccca 4020atggagcagc tgcaaggcgc caataaggga
ggaccaggta gcatgtaata actggaaata 4080ctttggttca cttcttggcc agtatgatat
atagtaggaa ggtgtaaaga ttggccatga 4140tcactgtgat ttcttgttgt gataaatggg
attaattagg tgtgttgtaa gttatagatc 4200atagacggta ccttgtaaga actggcttta
tggttggatt cttgatgtta tagattgtag 4260ttagtaggag tggtgtgtgt aggcgctggg
caatcggtac tggggcaagc attgttcaat 4320tggacagtgt tctcttctgg tgtttaaatt
gaaatgatca gagaattgtg aactgctaca 4380taggttcgcc agtagttttg ctatgtttct
atcttgtaac gtttgcaatc gcaatatgat 4440ccctgacaaa cactgctaaa cgtttcgacc
tgttctgttt ctttcacggc ttattgcagc 450091305PRTPaspalum notatum 9Met Gly
Ile Ser Phe Lys Ile Ser Lys Val Gly Val Arg Val His Pro 1 5
10 15 Gly Ala Arg Ser Ala Ser Ala
Thr Gln Ala Gln Ala Glu Lys Pro Ala 20 25
30 Ala Val Asp Lys Glu Gly Ser Val Ser Asp Ser Arg
Gly Glu Gly Asp 35 40 45
Phe Val Glu Gly Ala Lys Asp Ile Asn Gly Ile Ile Ile Ser Pro Ala
50 55 60 Cys Ser Arg
Glu Ile Ser Pro Asp His Glu Val Ser Phe Thr Phe Ser 65
70 75 80 Leu Tyr Asp Arg Gly Tyr Leu
Ile Ser Lys Ser Ala Ala Met Asp Ser 85
90 95 Asn Gln Thr Ser Ile Gln Asp Gly Lys Thr Leu
His Pro Tyr Asp Arg 100 105
110 Ala Ser Glu Lys Leu Phe Ser Ser Ile Glu Ala Gly Arg Leu Pro
Gly 115 120 125 Asp
Ile Leu Asp Asp Ile Pro Ser Lys Tyr Tyr Ser Gly Ser Val Val 130
135 140 Cys Glu Ile Arg Asp Tyr
Arg Lys His Val Ser Asn Gln Val Pro Ala 145 150
155 160 Ser Ser Ala Glu Leu Gly Leu Pro Ile Val Asn
Lys Val Gln Leu Arg 165 170
175 Met Thr Phe Glu Asn Val Val Lys Asp Ile Ser Leu Leu Ser Asp Asp
180 185 190 Ser Trp
Ser Tyr Arg Asp Phe Val Glu Ala Glu Ala Arg Ile Val Arg 195
200 205 Val Leu Gln Pro Glu Leu Cys
Leu Asp Pro Thr Pro Lys Leu Asp Arg 210 215
220 Leu Tyr Gln Asp Pro Val Pro His Lys Leu Ser Leu
Gly Ile Gly Lys 225 230 235
240 Lys Arg Arg Leu Arg Gln Asn Pro Glu Val Val Val Thr Ser Ser Asn
245 250 255 Met Ser His
Gly Lys Lys Val Cys Ile Asp Arg Leu Pro Glu Asn Thr 260
265 270 Lys Ala Asp Glu Met Gly Ile Ala
Gly Ser Asn Ala Ala His Gln Val 275 280
285 Gly Asp Asn Ile Thr Ile Gln Asn Ile Pro Gly Gly His
Gln Pro Leu 290 295 300
Arg Pro Asn Asn Ala Ser Gln Asp Ala Ala Arg Met Leu Leu Ser Gln 305
310 315 320 Thr Gln Pro Gly
Ile Gln Gln Thr Val Ser Tyr Ser Ala Ile Gly Asn 325
330 335 Asp Arg Met Ala Gly Pro Pro Ala Asn
Phe Ser Gly Ile Ser Ser Ser 340 345
350 Ile Ser Ser Pro Gln Ser Met Ile Gly Tyr Asn Asp Thr Val
Ser Ala 355 360 365
Asn Gly Leu Leu Ser Val Lys Arg Glu Met Gln Asp Val Pro Leu Gln 370
375 380 Asp Pro Lys Arg Ile
Lys Pro Thr Gly Gly Thr Asp Asp Val Gln Gln 385 390
395 400 Gln Gln Thr Arg His Gln Pro Leu Gly Gly
Gln Glu Met Gln Trp Lys 405 410
415 Asn Gln Leu His Pro Gln Leu Asp Val Lys Gly Met Gln Tyr Ala
Ser 420 425 430 Ser
Leu Ser Ser Gln Arg Tyr Pro Thr Ser Leu Met Asn Asn Met Gln 435
440 445 Asp Ser Gly Ser Ser Phe
Tyr Phe Asn Gln Gln Gly Leu Arg Tyr Ser 450 455
460 Ala Lys Gln Glu Gln Met Asp Gly Ser Asp Arg
Ser Lys Asp Ala Leu 465 470 475
480 Gln Ser Met Ala Pro Glu Ser Ser Met Leu Asp Gln Gln Gln Ser Gln
485 490 495 Ala Gln
His Leu Ser Gln Gln Ser Ala Ala Arg Asn Asn Val Pro Asn 500
505 510 Met Ala Gln Trp Gln Asn Arg
Ala Ala Glu Lys Asp Leu Lys Lys Glu 515 520
525 Glu Ile Ile Gln Arg Arg Lys Leu Ala Pro Ser Ser
Arg Ala Pro Ser 530 535 540
Gly Pro Met Val Gln Ser Pro Val Ser Ser Lys Ser Gly Glu Ile Ser 545
550 555 560 Ser Ser Ser
Met Gly Gly Gln Phe Gly Ser Ala Val Thr Ser Ala Val 565
570 575 Ile Gly Ala Gln Lys Asp Lys Phe
Ala Ala Asn Ser Ser Ala Ala Val 580 585
590 Gly Tyr Pro Ser Val Val Ser Ser Pro Ser Asp Ser Met
His Arg Ile 595 600 605
Gln Gln Pro Ala Val Ala Pro Ser Lys Arg Lys Ser Asn Ser Val Pro 610
615 620 Lys Asn Gln Pro
Pro Val Ser Ala Val Gly Ser Pro Ala Ser Val Ser 625 630
635 640 Asn Met His Ala Pro Leu Asn Ala Ser
Ser Pro Ser Val Gly Thr Ala 645 650
655 Pro Met Gly Asp Gln Ala Ile Leu Asp Lys Phe Ala Lys Ile
Glu Asn 660 665 670
Leu Ser His Arg Tyr Gln Leu His Asn Lys Lys Lys Lys Val Asp Thr
675 680 685 Ile Pro Gln Arg
Lys Pro Ile Thr Lys Ser Gln Glu Val Val Arg Cys 690
695 700 Leu Ser Ser Cys Phe His Thr Glu
Asp Tyr Ile Asp Thr Thr Arg Pro 705 710
715 720 Leu Cys Asn Ser Met Ile Ser Gly Thr Ile Asn Thr
Cys Lys Ser Arg 725 730
735 Val Ile Asn Phe Val Ser Thr Asn Arg Ile Tyr Gln Gly His Glu Arg
740 745 750 Pro Phe Gln
Val Val Phe Lys Glu Met Pro Asp Glu Thr Val Arg Met 755
760 765 Gln Tyr Gly Asp Gln Glu Asp Phe
Asp Gly Pro Asn Ser Tyr Asp Cys 770 775
780 Val Phe Ile Leu Pro Thr Lys Tyr Tyr Ala Asp Leu Leu
Ala Glu Gln 785 790 795
800 Leu Ile Pro Leu Met Leu Gln Asp Gly His Ser Lys Ala Asp Asp Lys
805 810 815 Val Arg Gly Thr
His Pro Ala Asn Leu Ser Thr Leu Ser Gly Ile Leu 820
825 830 Pro Asp Asn Leu Val Ser Asp Val Lys
Gln Glu Gly Gly Val Ser Gln 835 840
845 Gln Leu Asn Ala Ala Ala His Ala Asn Ala Thr Pro Gly Thr
Pro Met 850 855 860
Gln Gln Leu Pro Val Asn Arg Met Leu Ser Ser Ala Asn Ser Asn Gln 865
870 875 880 Val Leu Pro Met Gln
Pro Gly Tyr Met Gln Gly Ala Ala Met Pro Pro 885
890 895 Arg Ser Gln Gln Leu Asp Gln Asn Leu Val
Gln Gln Ser Gln Gln His 900 905
910 Gln Pro Gln Gln Gln Pro Val Gln Gln Asn Ala Gln Ala Gln Met
Gln 915 920 925 Gln
Pro Ser Ser Leu Pro Leu Asn Gln Met Gln Arg Pro Gln Leu Leu 930
935 940 Pro Thr Ser Pro Leu Ser
Gln Met Leu Gly Pro Gly Ser Asn Leu Pro 945 950
955 960 Met Gly Ser Ser Gln Met Gly Asn Asn Lys Gln
Pro Thr Ala Asn Ser 965 970
975 Leu Gln Leu Gln Met Leu Gln Gln Ala Gln Gln Gln Gln Pro Met Ser
980 985 990 Arg Lys
Gly Met Met Gly Leu Gly Ser Ala Met Asn Met Gly Asn Met 995
1000 1005 Val Asn Asn Val Val
Ser Val Gly Gly Leu Met Gly Asn Val Arg 1010 1015
1020 Pro Ile Ser Ser Pro Met Gly Ser Met Ser
Gly Leu Gly Asn Asn 1025 1030 1035
Thr Asn Pro Met Asn Met Gly Met Pro Ser Asn Leu Ala Ala Gly
1040 1045 1050 Leu Arg
Pro Gly Met Ser Ala Ala Thr Ile Ala Lys Met Arg Met 1055
1060 1065 Ala Gln Gln Arg Ala Gly Met
Tyr Pro Gln Thr Gly Met Val Gly 1070 1075
1080 Met Pro Gly Ser Ser Ser Pro Ile Leu Pro Ser Ser
Ala Asn Leu 1085 1090 1095
Thr Met Met Asn His Pro Leu Asn Arg Ser Asn Leu Asn Pro Leu 1100
1105 1110 Gln Arg Ala Met Met
Ser Ser Met Gly Pro Pro Lys Met Pro Gly 1115 1120
1125 Gly Asn Phe Gln Leu Asn Pro Gln Gln Gln
Met Gln Leu Gln Gln 1130 1135 1140
Leu Gln Gln Gln Gln Gln Gln Leu Gln Gln Asn Pro Gln Gln Gln
1145 1150 1155 Gln Gln
Gln Leu Gln Gln Gln Gln Gln Gln Gln Gln Leu Gln Gln 1160
1165 1170 Gln Gln Gln Gln Gln Leu Pro
Gln Gln Gln Leu Gln Gln Met Gln 1175 1180
1185 Gln Leu Gln Gln Gln Gln Leu Gln Gln Gln Leu Gln
Leu Gln Gln 1190 1195 1200
Gln Gln Gln Gln Met Gly Ser Pro Arg Gln Gln Ala Gln Val Gly 1205
1210 1215 Ser Pro Ala Gly Ser
Gln Gln Ser Leu Met Met Gln Gln Gln Ile 1220 1225
1230 Ser Pro Pro Gln Met Gly Gln His Ala Ala
Met Ser Pro Gln Leu 1235 1240 1245
Ser Ser Gly Thr Leu Gln Gln Met Ser Asn Asn Val Ala Asn Pro
1250 1255 1260 Val Ala
Thr Pro Gly Pro Pro Pro Ser Pro Gln Leu Ser Ser Gln 1265
1270 1275 Thr His Gly Ser Val Asn Ser
Ile Ala Asn Ser Pro Met Glu Gln 1280 1285
1290 Leu Gln Gly Ala Asn Lys Gly Gly Pro Gly Ser Met
1295 1300 1305 104062DNASorghum
bicolor subsp. drummondii 10tccctgtctg agtcgagacg cgaggacaac ttcgttgaga
gaggaaaaga tgtcaatgga 60atcaaaattt taccagcgtg ctccaaggaa attttgccag
atcatgaggt ttctttcaca 120tttagcctct atgagagagg ttatctcatt tcaaagtcag
catctatgga tcctagtcag 180acctcaatcc aggacagcaa aacactgcat ccctatgata
gagcatcgga aaagttattc 240tctgccattg aagctggaag gctaccaggc gatattcttg
atgagatacc aagcaagtac 300tataatggat cagttgtttg tgagatacgt gactaccgaa
agcatgtgtc caaccaagcg 360cctgcatcat ctgctgagct aggtttacct attgtgaata
aagtgcgact acgaatgacc 420tttgagaatg ttgtaaagga cattaccctt ctatctgatg
attcctggac ttacagggat 480tttgtggaag ctgaggctcg cattgtgaga gctctacaac
cagaactttg cttagaccct 540acacctaaac tggatcgact ttgtcaggat cctgttccgc
ataagttgag cctcggtata 600ggaaaaaaga ggaggctgag gcaaaatcct gaagttgttg
tcacatccag taacatgtct 660catggtaaaa aggtttgcat tgataggtta cctgaaaatg
ccaaagttga tgacatgggc 720atcaccagca gtaatgcagc tcagcaggtt ggtgataaca
ttaccatcca aaatatctcg 780gtctcgggtg gttctcagac acttagacca aataattctt
cacaagatgc tgccagaatg 840cttttgtccc aatctggtct acagcaagca ttaagttatt
ctgctgctgg taatgatcgt 900atggcaggac tgcctgccaa tttttctgga atcaattcaa
gcatttcatc tccccagagc 960atgattggtt acaatgacac tgtggctgcc aatggccttc
tatctgtgaa gagagaaatg 1020caagatgccc cgcttcaaga tcctaagaga ataaagccaa
ctggtggcat tgatgatgta 1080cagcagcagc agataaggcc tcaacccctt ggtgggctgg
agatgcaatg gaagaaccat 1140caactgcatc cacaattaga tgtcaagggg atgcagtatg
catcttcact gagtggtcag 1200agatatcctt cttcgatgat gaacaacatg caagatccag
gatcttcctt atatttcaat 1260catcagcaaa atttgagata cggtgctaag caagagcaga
tggatggttc tgataagtcg 1320aaagacgcct tgcagtctat ggcacctgaa agttccatgc
tggatcagca gcaatcccag 1380gctcaacatt taccacagca atcagcggca agaaacaatg
ttccaaacat gggacagtgg 1440caaaatactc ggttcgcagc tgagaaggac ttgaaaaaag
aagaaataat tccaagaaga 1500aaattagcac ctagctctcg tgccccttct gggcctatgg
ttcagtctcc agtgtcctcg 1560aaatctggag agatatcaag cagttcaatg ggtggccagt
ttggttctgc tgtgacatca 1620gctgtaatag gggcacagaa agataaattt gctgcaaatt
ccagtgctgc agttggattt 1680ccttctgtag cttccagccc taatgattcc atgcaccgaa
tacaacagcc agctgttgct 1740tcctcaaaga ggaaaacaaa ttctgtcccc aaaactcaac
cgcctgtgag tgctgttggg 1800tctccagcca gtgtttcaaa tatgcatgct ccgctgaatg
cgagcagccc atcgattggg 1860accacaccta tgggagacca agcaatcctt gataaatttg
caaaaattga taatatttcc 1920catcggtacc agcttctcaa taagaagaac aaggttgata
aaatatctca aaagaaaacc 1980attaccaatc aaagtcatcc agatgtagct agatgtctca
atagttgttt ccattctgag 2040gattatatag atacaacaag acctctttgt aattctatga
ttagtggaac tataaacacg 2100tgcaagacta gggtaataaa ctttgtgagc acaaaccgca
tgtaccaagg tcattcaagg 2160ccattccagg ttattttcaa ggaaatttct gatgaaactg
taaaaatgca atatggagat 2220ctagaagatt ttgatggtcc gaatgcgcat gattgtgtat
tcatattacc aacaaagtac 2280tatgctgact tgcttgcaga gcagcttatt ccccttatgt
tgcaagatgg gcattctaaa 2340gctgatgata aagtcgtgcg cggcaccccc cttgctaacc
tcagtacgct gtctggaatt 2400ttaccagaca atttagtgag tgatgtaaag caagagggag
gtgtaagcca acaacttaat 2460gctgcagccc atgcaaatgt gccacctgga acacagatgc
aacagcttcc tgtcaatagg 2520atgctttcat ctgcgagtag caaccaggtt ctagcaatgc
agcaaggtta tatgcaaggg 2580gcagccatgc ctgcaaggag ccagcaactt gaccaaaatt
tggttcagca gccgcagcag 2640caacagccac agcagcagcc actgcagcaa aatgctcaag
cccagatgca gcaaccatcc 2700tctcttccac tgaaccagat gcaaagacct cagcttctgc
ccacgagccc attatcacag 2760atgttggggc ctggctcaaa tctcacaatg ggctcaagcc
agataggtaa caataaggct 2820cctccttcat ccttgcagct tcagatgcta caggcacaac
agcaacaacc tatgtctagg 2880aaagtgatga tgggcctcgg ctcagccatg aacatgggca
atatggttaa caatgttgtt 2940ggtcttggtg gccttggtaa tgttatggga atgggcaacg
tgcgtccaat atcctccccc 3000atgggatcga tgtcaggctt aggtaacaat tccaatccaa
tgaacatggg aatggcatcc 3060aatcttgctg cagctggact tcggccaggt atgaaccctg
ctacttttgc caagatgcgt 3120atcggtttgg cacaacaaag ggcagcaggc atgtatcctg
gaatggttgg aatgcctgga 3180agcagctctc caatccttcc tagttcagct ggcttatcta
tgatgggcca gccgctaaac 3240agaagcaacc ttggtcccct gcagagggcc atgatgtcgt
ctatgggccc tccaaaaatt 3300ccaggaggta actttcagct gaacgcgcaa cagcaaatgc
agctccagca gcagttgcag 3360cagcagcagc agctccaaca gaacccccag caacagcagc
agctccatca gaacccgcag 3420cagcagcaac tgcagcagct acagcaacag caacaaatac
agcaacaact gcagcagcag 3480cagcagctcc aacaacaact gcagcagcaa cagcagcagc
aacaacaaca acaaatggga 3540tctccgttac agcaggcaca ggtgggctca cctgctggct
cgcagcagtc gctgatgatg 3600cagcagcagc agcagataag cccacagcaa atgggacagc
aggctgccat gagcccccag 3660ttgagctcag gaacgctgca gcaaatgagc aataacgtgg
tcaaccctgt agccactcca 3720ggtcctcccc caagcccgca gctgagctcc cagacccatg
ggtcggtaag cagcatagct 3780aactccccga tggagcagct gcaaggcgcc agtaagggag
gtcccggtag catgtaacca 3840caaataattg gttcacttct ttgcctatat atacagtgta
ggaaggtgta aacactggcc 3900aagatcacta tgttttcttt gttgtggtaa atgaggttaa
attaggtgtg ttatagtaag 3960ttatagacca tagatgatag cttgttaagg accgaccatc
tttatgcatg gatttctatg 4020ctgtagattg tagttagtag gaatggtagt cagttcttgt
ga 4062111278PRTPaspalum notatum 11Ser Leu Ser Glu
Ser Arg Arg Glu Asp Asn Phe Val Glu Arg Gly Lys 1 5
10 15 Asp Val Asn Gly Ile Lys Ile Leu Pro
Ala Cys Ser Lys Glu Ile Leu 20 25
30 Pro Asp His Glu Val Ser Phe Thr Phe Ser Leu Tyr Glu Arg
Gly Tyr 35 40 45
Leu Ile Ser Lys Ser Ala Ser Met Asp Pro Ser Gln Thr Ser Ile Gln 50
55 60 Asp Ser Lys Thr Leu
His Pro Tyr Asp Arg Ala Ser Glu Lys Leu Phe 65 70
75 80 Ser Ala Ile Glu Ala Gly Arg Leu Pro Gly
Asp Ile Leu Asp Glu Ile 85 90
95 Pro Ser Lys Tyr Tyr Asn Gly Ser Val Val Cys Glu Ile Arg Asp
Tyr 100 105 110 Arg
Lys His Val Ser Asn Gln Ala Pro Ala Ser Ser Ala Glu Leu Gly 115
120 125 Leu Pro Ile Val Asn Lys
Val Arg Leu Arg Met Thr Phe Glu Asn Val 130 135
140 Val Lys Asp Ile Thr Leu Leu Ser Asp Asp Ser
Trp Thr Tyr Arg Asp 145 150 155
160 Phe Val Glu Ala Glu Ala Arg Ile Val Arg Ala Leu Gln Pro Glu Leu
165 170 175 Cys Leu
Asp Pro Thr Pro Lys Leu Asp Arg Leu Cys Gln Asp Pro Val 180
185 190 Pro His Lys Leu Ser Leu Gly
Ile Gly Lys Lys Arg Arg Leu Arg Gln 195 200
205 Asn Pro Glu Val Val Val Thr Ser Ser Asn Met Ser
His Gly Lys Lys 210 215 220
Val Cys Ile Asp Arg Leu Pro Glu Asn Ala Lys Val Asp Asp Met Gly 225
230 235 240 Ile Thr Ser
Ser Asn Ala Ala Gln Gln Val Gly Asp Asn Ile Thr Ile 245
250 255 Gln Asn Ile Ser Val Ser Gly Gly
Ser Gln Thr Leu Arg Pro Asn Asn 260 265
270 Ser Ser Gln Asp Ala Ala Arg Met Leu Leu Ser Gln Ser
Gly Leu Gln 275 280 285
Gln Ala Leu Ser Tyr Ser Ala Ala Gly Asn Asp Arg Met Ala Gly Leu 290
295 300 Pro Ala Asn Phe
Ser Gly Ile Asn Ser Ser Ile Ser Ser Pro Gln Ser 305 310
315 320 Met Ile Gly Tyr Asn Asp Thr Val Ala
Ala Asn Gly Leu Leu Ser Val 325 330
335 Lys Arg Glu Met Gln Asp Ala Pro Leu Gln Asp Pro Lys Arg
Ile Lys 340 345 350
Pro Thr Gly Gly Ile Asp Asp Val Gln Gln Gln Gln Ile Arg Pro Gln
355 360 365 Pro Leu Gly Gly
Leu Glu Met Gln Trp Lys Asn His Gln Leu His Pro 370
375 380 Gln Leu Asp Val Lys Gly Met Gln
Tyr Ala Ser Ser Leu Ser Gly Gln 385 390
395 400 Arg Tyr Pro Ser Ser Met Met Asn Asn Met Gln Asp
Pro Gly Ser Ser 405 410
415 Leu Tyr Phe Asn His Gln Gln Asn Leu Arg Tyr Gly Ala Lys Gln Glu
420 425 430 Gln Met Asp
Gly Ser Asp Lys Ser Lys Asp Ala Leu Gln Ser Met Ala 435
440 445 Pro Glu Ser Ser Met Leu Asp Gln
Gln Gln Ser Gln Ala Gln His Leu 450 455
460 Pro Gln Gln Ser Ala Ala Arg Asn Asn Val Pro Asn Met
Gly Gln Trp 465 470 475
480 Gln Asn Thr Arg Phe Ala Ala Glu Lys Asp Leu Lys Lys Glu Glu Ile
485 490 495 Ile Pro Arg Arg
Lys Leu Ala Pro Ser Ser Arg Ala Pro Ser Gly Pro 500
505 510 Met Val Gln Ser Pro Val Ser Ser Lys
Ser Gly Glu Ile Ser Ser Ser 515 520
525 Ser Met Gly Gly Gln Phe Gly Ser Ala Val Thr Ser Ala Val
Ile Gly 530 535 540
Ala Gln Lys Asp Lys Phe Ala Ala Asn Ser Ser Ala Ala Val Gly Phe 545
550 555 560 Pro Ser Val Ala Ser
Ser Pro Asn Asp Ser Met His Arg Ile Gln Gln 565
570 575 Pro Ala Val Ala Ser Ser Lys Arg Lys Thr
Asn Ser Val Pro Lys Thr 580 585
590 Gln Pro Pro Val Ser Ala Val Gly Ser Pro Ala Ser Val Ser Asn
Met 595 600 605 His
Ala Pro Leu Asn Ala Ser Ser Pro Ser Ile Gly Thr Thr Pro Met 610
615 620 Gly Asp Gln Ala Ile Leu
Asp Lys Phe Ala Lys Ile Asp Asn Ile Ser 625 630
635 640 His Arg Tyr Gln Leu Leu Asn Lys Lys Asn Lys
Val Asp Lys Ile Ser 645 650
655 Gln Lys Lys Thr Ile Thr Asn Gln Ser His Pro Asp Val Ala Arg Cys
660 665 670 Leu Asn
Ser Cys Phe His Ser Glu Asp Tyr Ile Asp Thr Thr Arg Pro 675
680 685 Leu Cys Asn Ser Met Ile Ser
Gly Thr Ile Asn Thr Cys Lys Thr Arg 690 695
700 Val Ile Asn Phe Val Ser Thr Asn Arg Met Tyr Gln
Gly His Ser Arg 705 710 715
720 Pro Phe Gln Val Ile Phe Lys Glu Ile Ser Asp Glu Thr Val Lys Met
725 730 735 Gln Tyr Gly
Asp Leu Glu Asp Phe Asp Gly Pro Asn Ala His Asp Cys 740
745 750 Val Phe Ile Leu Pro Thr Lys Tyr
Tyr Ala Asp Leu Leu Ala Glu Gln 755 760
765 Leu Ile Pro Leu Met Leu Gln Asp Gly His Ser Lys Ala
Asp Asp Lys 770 775 780
Val Val Arg Gly Thr Pro Leu Ala Asn Leu Ser Thr Leu Ser Gly Ile 785
790 795 800 Leu Pro Asp Asn
Leu Val Ser Asp Val Lys Gln Glu Gly Gly Val Ser 805
810 815 Gln Gln Leu Asn Ala Ala Ala His Ala
Asn Val Pro Pro Gly Thr Gln 820 825
830 Met Gln Gln Leu Pro Val Asn Arg Met Leu Ser Ser Ala Ser
Ser Asn 835 840 845
Gln Val Leu Ala Met Gln Gln Gly Tyr Met Gln Gly Ala Ala Met Pro 850
855 860 Ala Arg Ser Gln Gln
Leu Asp Gln Asn Leu Val Gln Gln Pro Gln Gln 865 870
875 880 Gln Gln Pro Gln Gln Gln Pro Leu Gln Gln
Asn Ala Gln Ala Gln Met 885 890
895 Gln Gln Pro Ser Ser Leu Pro Leu Asn Gln Met Gln Arg Pro Gln
Leu 900 905 910 Leu
Pro Thr Ser Pro Leu Ser Gln Met Leu Gly Pro Gly Ser Asn Leu 915
920 925 Thr Met Gly Ser Ser Gln
Ile Gly Asn Asn Lys Ala Pro Pro Ser Ser 930 935
940 Leu Gln Leu Gln Met Leu Gln Ala Gln Gln Gln
Gln Pro Met Ser Arg 945 950 955
960 Lys Val Met Met Gly Leu Gly Ser Ala Met Asn Met Gly Asn Met Val
965 970 975 Asn Asn
Val Val Gly Leu Gly Gly Leu Gly Asn Val Met Gly Met Gly 980
985 990 Asn Val Arg Pro Ile Ser Ser
Pro Met Gly Ser Met Ser Gly Leu Gly 995 1000
1005 Asn Asn Ser Asn Pro Met Asn Met Gly Met
Ala Ser Asn Leu Ala 1010 1015 1020
Ala Ala Gly Leu Arg Pro Gly Met Asn Pro Ala Thr Phe Ala Lys
1025 1030 1035 Met Arg
Ile Gly Leu Ala Gln Gln Arg Ala Ala Gly Met Tyr Pro 1040
1045 1050 Gly Met Val Gly Met Pro Gly
Ser Ser Ser Pro Ile Leu Pro Ser 1055 1060
1065 Ser Ala Gly Leu Ser Met Met Gly Gln Pro Leu Asn
Arg Ser Asn 1070 1075 1080
Leu Gly Pro Leu Gln Arg Ala Met Met Ser Ser Met Gly Pro Pro 1085
1090 1095 Lys Ile Pro Gly Gly
Asn Phe Gln Leu Asn Ala Gln Gln Gln Met 1100 1105
1110 Gln Leu Gln Gln Gln Leu Gln Gln Gln Gln
Gln Leu Gln Gln Asn 1115 1120 1125
Pro Gln Gln Gln Gln Gln Leu His Gln Asn Pro Gln Gln Gln Gln
1130 1135 1140 Leu Gln
Gln Leu Gln Gln Gln Gln Gln Ile Gln Gln Gln Leu Gln 1145
1150 1155 Gln Gln Gln Gln Leu Gln Gln
Gln Leu Gln Gln Gln Gln Gln Gln 1160 1165
1170 Gln Gln Gln Gln Gln Met Gly Ser Pro Leu Gln Gln
Ala Gln Val 1175 1180 1185
Gly Ser Pro Ala Gly Ser Gln Gln Ser Leu Met Met Gln Gln Gln 1190
1195 1200 Gln Gln Ile Ser Pro
Gln Gln Met Gly Gln Gln Ala Ala Met Ser 1205 1210
1215 Pro Gln Leu Ser Ser Gly Thr Leu Gln Gln
Met Ser Asn Asn Val 1220 1225 1230
Val Asn Pro Val Ala Thr Pro Gly Pro Pro Pro Ser Pro Gln Leu
1235 1240 1245 Ser Ser
Gln Thr His Gly Ser Val Ser Ser Ile Ala Asn Ser Pro 1250
1255 1260 Met Glu Gln Leu Gln Gly Ala
Ser Lys Gly Gly Pro Gly Ser Met 1265 1270
1275 123458DNAResurrection grass 12gttgacagag caaataatat
caatggcgtc aaaattttta cagggtgctc caacgaaatt 60ttgccagagc atgaggtttc
tttcacattc agcctctatg acagaggtta tctcatttca 120aagtcaccag caatggatcc
tagccagacc tcagttcagg atggcaaaac actgcatccc 180tatgatagag catcggaaaa
attattctca gctattgaag ctggaaggct acctggcgat 240attcttgatg agataccaag
caagtactat aatggatcag ttgtttgtga gatacgtgac 300taccgaaagc gtatatccaa
tcaaacgcct gcgtcatctg ctgagctagg acttcccatc 360gtgaataaag tacgtctgcg
gatgacattt gagaacgttg tgaaggacat tacactgcta 420tctgatgatt cttggagtta
cagggatttt gtggaagctg aggcacgtat tgtcagagct 480ctacaaccag aactttgctt
agaccctact cctaaattgg accggctttg tcaggatcct 540gtccctcata agttgaacct
tggtattgga aaaaagagga ggatgaggca aaatcctgaa 600gttgttgtca catccagtaa
catgtctcat ggcaaaaagg tgtgcattga taggttgtct 660gaaaacggca aagcagatga
gatgggcatc acaggtggca atgcagctca ccaggctgtt 720gatagtgtta ccattcagaa
tacttcaggt gttcctcaac cacttagacc aaataattct 780tcacaagatg ctgccagaat
gcttttgtcg caatctggta tacagcaaac tatgagttat 840tctgctgtgg gcaatgatcg
tatggcagga tctcctgcca attttactgg aatcagttca 900agtatttcat ctcctcagaa
catgatgact tacaatgatg ccgcctctgc caacggcctt 960ctttctgtga agagggaaat
gcaagatgct ccactgcaag atcctaataa gagaataaag 1020tctggtggca ttgatgatgc
acagcagcag cagttgaggc ctcaatccct tggcggacag 1080gagatgcaat ggaagaacca
acagctgcat ccacaattag aggtcaaggg gatgcagtat 1140gctgcttctt cattgggtgg
tcagagatat ccttctccga tgatgaacaa tatgccagat 1200tcaggagctt ccttctattt
caatcagcag ggtatgagat atggggctaa gcaagagcag 1260atggatggtt ctgataggtt
gaaagacagc ttggcacctg aaggttctat gctggatcag 1320cagcagtccc aggctcaact
cttgtcacaa caatcaactg caagaaacaa tattcccaac 1380atgacacagt ggcagaatac
caggttttca gttgagaagg acatgaaaaa agatgaaatt 1440aaccagagaa gaaagttagc
tcccaactcc cgtgcccctt ctgggccaat ggttcagtct 1500ccagtgtcct ctaaatctgg
agagatatct agcagttcaa tgggtggtca gtttggttct 1560gctgtgacat cagctgcaat
aggggtacaa aaagataagt ttgcagcaaa ctccagtgct 1620gcagttggat acccttctgt
agcttcgagc cctagtgatt ctatgcaccg ggtacaacag 1680cccgctgttg ctccttcaaa
gaggaaaaca aattcagttc caaaaactca accacctgtg 1740agcggtgtag ggtctccagc
cagtgtttca aatatgcagt ctatgctgaa tgctaacagc 1800ccatcgattg ggaccgcacc
tgtgggagac caagcgatca acgatagatt cgcgaaaatt 1860gatgctcttt cccagcggta
ccagctgcat agtaagaaga acaaagttga taagatacca 1920caaaggaaac ccctgattgg
tgcaagccaa gatgtagcta gtaaactctc cagttgcttc 1980catacagagg attatataga
tacaatgaga cctatctgta attctatgat tactggatca 2040ataaacacgt gcaagactag
aataattaat cttgtgagca caaaccgcat gtaccaaggt 2100catgcgaggc cattccgggt
cattttcaag gaaatgcctg atgaaactgt aaaaatgcaa 2160tatggggatt tagaagattt
tgatggtccg aactcaccgg attgtgtatt catattacca 2220acgaagtact atgccgactt
gctcggagag caacttattc ccctgatgtt gaaagatggt 2280cattcgaagg cagatgatca
agttgttcgt ggcacccctc ctggcaacct cagcgcacta 2340tcaggaattt taccagacaa
tccaccaagt gacataaagc aagagggagg tgtaagccag 2400caactcaatg caaatatggc
acctggaaca ccgatgcaac agcttcctgg caataggatg 2460ctttcatctg caaatagcaa
ccaggcccta gcaatgcagc aaggttacat gcaacaaggg 2520gcaaccatgc ctccaaggag
tcaacaactt gacccaaata tggtccagca gccgcagcca 2580ccgccgcctc agcagcagca
gcaaccgctg cagcaaaatg ctcaagcaca gcttcagcaa 2640ccatcatctc ttcctctcaa
ccagatgcag agacctcaaa tattaccaac gagcccatta 2700tctcagatga tggggcctgg
ttccaatctt ccaatgggct caagccagat gggtaacaat 2760aagtctgctc ctacttccct
tcagcttcag atgctacagc aggcacagca gcaacagcct 2820atgtctagga aggtgatgat
ggggcttggc ggacttggtt cagccatgaa catgagcaac 2880atggttaaca atgtcgtggg
cctcggtggt attggaaatg ttatgggaat gggcaatgtg 2940aggccaattt cctccccgat
gggatcaatg tccttgggca acaattccaa tccaatgaac 3000cttggaatga catcaaacct
agctgcagcc ggacttcgtc caggcatgaa ccctgctact 3060cttgcgaaga tgcgtatggc
acagcaaagg gcagcaggaa tatatcccca gactggaatg 3120gttggaatgc ctgggagcag
ttctcctgtg tccatgatgg gccatccatt gaatcgaagc 3180aacctcaacc cattgcagag
ggccatgatg tcttccatgg gccctccgaa gataccagga 3240ggtaactttc cgctgaacgc
tcaacagcaa atgcagctac aacagcagtt gcaacagcag 3300cagcagcagc tccagcagaa
cccacagcag caacagcaac tacagcagca gcagcagcag 3360cagctccaac agagcccaca
gcagcagctt catcagcagc aaatgcaaca acagctacag 3420cagcaacagc tgcaacaact
acagcagcag cagcaaca 3458131152PRTResurrection
grass 13Val Asp Arg Ala Asn Asn Ile Asn Gly Val Lys Ile Phe Thr Gly Cys 1
5 10 15 Ser Asn Glu
Ile Leu Pro Glu His Glu Val Ser Phe Thr Phe Ser Leu 20
25 30 Tyr Asp Arg Gly Tyr Leu Ile Ser
Lys Ser Pro Ala Met Asp Pro Ser 35 40
45 Gln Thr Ser Val Gln Asp Gly Lys Thr Leu His Pro Tyr
Asp Arg Ala 50 55 60
Ser Glu Lys Leu Phe Ser Ala Ile Glu Ala Gly Arg Leu Pro Gly Asp 65
70 75 80 Ile Leu Asp Glu
Ile Pro Ser Lys Tyr Tyr Asn Gly Ser Val Val Cys 85
90 95 Glu Ile Arg Asp Tyr Arg Lys Arg Ile
Ser Asn Gln Thr Pro Ala Ser 100 105
110 Ser Ala Glu Leu Gly Leu Pro Ile Val Asn Lys Val Arg Leu
Arg Met 115 120 125
Thr Phe Glu Asn Val Val Lys Asp Ile Thr Leu Leu Ser Asp Asp Ser 130
135 140 Trp Ser Tyr Arg Asp
Phe Val Glu Ala Glu Ala Arg Ile Val Arg Ala 145 150
155 160 Leu Gln Pro Glu Leu Cys Leu Asp Pro Thr
Pro Lys Leu Asp Arg Leu 165 170
175 Cys Gln Asp Pro Val Pro His Lys Leu Asn Leu Gly Ile Gly Lys
Lys 180 185 190 Arg
Arg Met Arg Gln Asn Pro Glu Val Val Val Thr Ser Ser Asn Met 195
200 205 Ser His Gly Lys Lys Val
Cys Ile Asp Arg Leu Ser Glu Asn Gly Lys 210 215
220 Ala Asp Glu Met Gly Ile Thr Gly Gly Asn Ala
Ala His Gln Ala Val 225 230 235
240 Asp Ser Val Thr Ile Gln Asn Thr Ser Gly Val Pro Gln Pro Leu Arg
245 250 255 Pro Asn
Asn Ser Ser Gln Asp Ala Ala Arg Met Leu Leu Ser Gln Ser 260
265 270 Gly Ile Gln Gln Thr Met Ser
Tyr Ser Ala Val Gly Asn Asp Arg Met 275 280
285 Ala Gly Ser Pro Ala Asn Phe Thr Gly Ile Ser Ser
Ser Ile Ser Ser 290 295 300
Pro Gln Asn Met Met Thr Tyr Asn Asp Ala Ala Ser Ala Asn Gly Leu 305
310 315 320 Leu Ser Val
Lys Arg Glu Met Gln Asp Ala Pro Leu Gln Asp Pro Asn 325
330 335 Lys Arg Ile Lys Ser Gly Gly Ile
Asp Asp Ala Gln Gln Gln Gln Leu 340 345
350 Arg Pro Gln Ser Leu Gly Gly Gln Glu Met Gln Trp Lys
Asn Gln Gln 355 360 365
Leu His Pro Gln Leu Glu Val Lys Gly Met Gln Tyr Ala Ala Ser Ser 370
375 380 Leu Gly Gly Gln
Arg Tyr Pro Ser Pro Met Met Asn Asn Met Pro Asp 385 390
395 400 Ser Gly Ala Ser Phe Tyr Phe Asn Gln
Gln Gly Met Arg Tyr Gly Ala 405 410
415 Lys Gln Glu Gln Met Asp Gly Ser Asp Arg Leu Lys Asp Ser
Leu Ala 420 425 430
Pro Glu Gly Ser Met Leu Asp Gln Gln Gln Ser Gln Ala Gln Leu Leu
435 440 445 Ser Gln Gln Ser
Thr Ala Arg Asn Asn Ile Pro Asn Met Thr Gln Trp 450
455 460 Gln Asn Thr Arg Phe Ser Val Glu
Lys Asp Met Lys Lys Asp Glu Ile 465 470
475 480 Asn Gln Arg Arg Lys Leu Ala Pro Asn Ser Arg Ala
Pro Ser Gly Pro 485 490
495 Met Val Gln Ser Pro Val Ser Ser Lys Ser Gly Glu Ile Ser Ser Ser
500 505 510 Ser Met Gly
Gly Gln Phe Gly Ser Ala Val Thr Ser Ala Ala Ile Gly 515
520 525 Val Gln Lys Asp Lys Phe Ala Ala
Asn Ser Ser Ala Ala Val Gly Tyr 530 535
540 Pro Ser Val Ala Ser Ser Pro Ser Asp Ser Met His Arg
Val Gln Gln 545 550 555
560 Pro Ala Val Ala Pro Ser Lys Arg Lys Thr Asn Ser Val Pro Lys Thr
565 570 575 Gln Pro Pro Val
Ser Gly Val Gly Ser Pro Ala Ser Val Ser Asn Met 580
585 590 Gln Ser Met Leu Asn Ala Asn Ser Pro
Ser Ile Gly Thr Ala Pro Val 595 600
605 Gly Asp Gln Ala Ile Asn Asp Arg Phe Ala Lys Ile Asp Ala
Leu Ser 610 615 620
Gln Arg Tyr Gln Leu His Ser Lys Lys Asn Lys Val Asp Lys Ile Pro 625
630 635 640 Gln Arg Lys Pro Leu
Ile Gly Ala Ser Gln Asp Val Ala Ser Lys Leu 645
650 655 Ser Ser Cys Phe His Thr Glu Asp Tyr Ile
Asp Thr Met Arg Pro Ile 660 665
670 Cys Asn Ser Met Ile Thr Gly Ser Ile Asn Thr Cys Lys Thr Arg
Ile 675 680 685 Ile
Asn Leu Val Ser Thr Asn Arg Met Tyr Gln Gly His Ala Arg Pro 690
695 700 Phe Arg Val Ile Phe Lys
Glu Met Pro Asp Glu Thr Val Lys Met Gln 705 710
715 720 Tyr Gly Asp Leu Glu Asp Phe Asp Gly Pro Asn
Ser Pro Asp Cys Val 725 730
735 Phe Ile Leu Pro Thr Lys Tyr Tyr Ala Asp Leu Leu Gly Glu Gln Leu
740 745 750 Ile Pro
Leu Met Leu Lys Asp Gly His Ser Lys Ala Asp Asp Gln Val 755
760 765 Val Arg Gly Thr Pro Pro Gly
Asn Leu Ser Ala Leu Ser Gly Ile Leu 770 775
780 Pro Asp Asn Pro Pro Ser Asp Ile Lys Gln Glu Gly
Gly Val Ser Gln 785 790 795
800 Gln Leu Asn Ala Asn Met Ala Pro Gly Thr Pro Met Gln Gln Leu Pro
805 810 815 Gly Asn Arg
Met Leu Ser Ser Ala Asn Ser Asn Gln Ala Leu Ala Met 820
825 830 Gln Gln Gly Tyr Met Gln Gln Gly
Ala Thr Met Pro Pro Arg Ser Gln 835 840
845 Gln Leu Asp Pro Asn Met Val Gln Gln Pro Gln Pro Pro
Pro Pro Gln 850 855 860
Gln Gln Gln Gln Pro Leu Gln Gln Asn Ala Gln Ala Gln Leu Gln Gln 865
870 875 880 Pro Ser Ser Leu
Pro Leu Asn Gln Met Gln Arg Pro Gln Ile Leu Pro 885
890 895 Thr Ser Pro Leu Ser Gln Met Met Gly
Pro Gly Ser Asn Leu Pro Met 900 905
910 Gly Ser Ser Gln Met Gly Asn Asn Lys Ser Ala Pro Thr Ser
Leu Gln 915 920 925
Leu Gln Met Leu Gln Gln Ala Gln Gln Gln Gln Pro Met Ser Arg Lys 930
935 940 Val Met Met Gly Leu
Gly Gly Leu Gly Ser Ala Met Asn Met Ser Asn 945 950
955 960 Met Val Asn Asn Val Val Gly Leu Gly Gly
Ile Gly Asn Val Met Gly 965 970
975 Met Gly Asn Val Arg Pro Ile Ser Ser Pro Met Gly Ser Met Ser
Leu 980 985 990 Gly
Asn Asn Ser Asn Pro Met Asn Leu Gly Met Thr Ser Asn Leu Ala 995
1000 1005 Ala Ala Gly Leu
Arg Pro Gly Met Asn Pro Ala Thr Leu Ala Lys 1010
1015 1020 Met Arg Met Ala Gln Gln Arg Ala
Ala Gly Ile Tyr Pro Gln Thr 1025 1030
1035 Gly Met Val Gly Met Pro Gly Ser Ser Ser Pro Val Ser
Met Met 1040 1045 1050
Gly His Pro Leu Asn Arg Ser Asn Leu Asn Pro Leu Gln Arg Ala 1055
1060 1065 Met Met Ser Ser Met
Gly Pro Pro Lys Ile Pro Gly Gly Asn Phe 1070 1075
1080 Pro Leu Asn Ala Gln Gln Gln Met Gln Leu
Gln Gln Gln Leu Gln 1085 1090 1095
Gln Gln Gln Gln Gln Leu Gln Gln Asn Pro Gln Gln Gln Gln Gln
1100 1105 1110 Leu Gln
Gln Gln Gln Gln Gln Gln Leu Gln Gln Ser Pro Gln Gln 1115
1120 1125 Gln Leu His Gln Gln Gln Met
Gln Gln Gln Leu Gln Gln Gln Gln 1130 1135
1140 Leu Gln Gln Leu Gln Gln Gln Gln Gln 1145
1150 143978DNAArabidopsis thaliana 14atgggtgtct
cgtttaagat atcgaaggtt ggtagaaagt ttcgacctaa gatttctact 60gaattggcta
ctcctgattc cccaaaagca atcgttctat ctgggaaacc aaaggccact 120gatgatagca
atattggcga tgtttccggg ttttcgaagc catctttacc cgatatatct 180ccagatcatg
aagtttcctt catattgagc ctctatccaa atgggtactc tataggaaaa 240acctctgagg
ctatgcaaca gatatcgttt cgagatgttc caaaggtctt acatccgtat 300gatagggcag
cagagggtct cctttcggct attgaggctg gcaggcttcc tggggacatt 360ttggaagata
taccttgcaa atttgtggat ggggtggtta tatgtgaggt gcatgactat 420cggaaacata
cctcatctca agtctctcct gtgataaata aattgcgcct taagatgtca 480ctcgagaatg
tggtaaaaga tattccatca atgtcagaca actcatggac gtacggtgat 540ctcatggaag
tggagtccag gatattaaaa gccttacaac ctgaactctg tctggatcct 600ttacccagac
ttgataggct gagtaaaaat cctttgactg ctaagctcga tttgtcgctt 660tctactttgc
ggagaaagag attaaggcaa atggcagaag tgacagtcat gtctcagaat 720aagattcagg
ggaaaaaggt gtgcattgat cggcttcctg aaagttcaga gcgaggaaat 780ttgccagggc
atttgataat gcagcaaacc aataacaacc aggctattca aaaccttggt 840actaatatgc
tggcgggatt aagaagtcag ccgttgcaag atgcaccaaa ttcctctctg 900gccttggtac
cacctcagca acaaaggtac atgggaattg gaagtacaag aaacacgcag 960gatcaaggat
caaattctgt cagtgtctct ggcgcttcgc ctggtggact agatgcgatg 1020ctgccttatg
gctctgatag tatgaaccct ggtacatctt ttcatagaaa gagagaaagt 1080caagaaggac
aaatgtcttc tatgcctggc ttgaataagc gaacaagggt ttcacatatg 1140ggtcctgatg
gggttccgca gcaacagtta gggcaacgta tggatggcct tcatggatcc 1200gatacaaatt
ggaaaaatac gcttctacaa caccaagaca tgctaggcag aagtattcag 1260tatccaaata
caagtattca gaggttttca ccacaccaaa tggaaggggt tatgaatcag 1320gaaggtggtc
ccatgcaatt tccagcttca caacaggggg gaatgaaata cacttcaaaa 1380gaggagccat
ttgagactgg taaaattgat ggcggcacca gaaacaatat tccgggggtg 1440ggaagtgatg
caaatgattt agatccacgt attcagtcaa ggatgcccca taatgcattc 1500attagatcaa
atttccctca aacatcctgg aatgttaatc ctggccagca gattgaaaaa 1560gagccgaaaa
aagaagaaca atttagtcgt aggatatcgg ctcaaagtcc tcgtttgtcg 1620gcaggtggtc
caccgcagtc cccactttca tcgaagtctg gtgagttttc tggtggttca 1680atggggaccc
actatggagc agttgcagca gctcagaagg acaaggctgt tacttctatt 1740cctgctattg
gtgctactca gtcagtgggt tctagtgcta atgaagctat gcagcaaagg 1800caacaccaag
cccaaatggc tgcaaaacgg agaacaaatt ctcttcctaa gacgcaagtt 1860attagcactg
ttggttctcc tgttagtgtc aatactatta gtgtcccagt taatgcaagg 1920agcccttcag
tgggacccca aactttgggc gatcacgcaa tcttggacag attttcaaag 1980attgaacgag
ttgctgctag gtaccaacta aactgcaaaa agcataaggt ggatgagtac 2040tctcgaagac
ctcgcgtgta tgctaaacag ccccttactg tttgtttatc aaacctgtct 2100aacgaagagg
tcttcaaaga cgaggacgaa gcattatcaa aatctatatt tggtggcagt 2160atgaatacat
acaagaccag agtcattcac tttggtcaga tggaacgtgt aatgcaaggt 2220tcggtccctt
ccttcatccc tagaaaccga acaagactgg tgatgtcaga gaaggccgtc 2280gatgggacag
tagcatggta tcaaggggac gtagatgaag gggatgtttt tcaggctgaa 2340gattttctct
tagcgttgcc caatacacac atcgccgatc tacttgctac tcaatttaaa 2400tcactgatgg
cccgtgaagg atacatgatt gaagaacata ttatggcaaa gccaaaccgt 2460ggggatactg
gcccaatcag cagccatcca aattctgcgg gtggttatcc aagaggttat 2520tctgcaaacg
atatgcaaca gtatggagat gcagttgcag ggcaagcgtc tggtgaggca 2580tcaaaacatg
ggaatactgg aaatacgccg aataactcaa cccagaatat tcttgcaaat 2640gcaaggatgg
ttcctccaac aaattctcaa gccttgcaaa tgtctcaagg actgctgtct 2700ggtgtctcca
tgcctatgca accacaacag cttgacccac aacagtcagc gctactgtca 2760tcacattcac
agcagaaaaa tcaacagtca atgtttacac agcaacagca tccacaaatg 2820cagagacctt
ccatgatact gcctacaaat ccactatcag ccatcaactc gatgagccag 2880agctctggta
tgcagccggg tggtcagatg gccaacaagt attcgcctct ccaactgcag 2940atgttacagc
agcagcagca ggcggcagtg cagaagaaga taatgatggg gctaggatca 3000ggtgtaggca
tgggtatggg tatgggcatg ggtatgggta tgggaagcat gggaaatagt 3060attgctgggc
ttggagcttt aggcaaccaa ttgaatatgg caggaagagg tatgggggga 3120accggaatct
catcgtcaat gtctgttcct ggcatcggta atatgggcca gaacccaatg 3180aatctgaatc
cagcatcaaa tttgaatgct ataagccagc aactccgatc tggtgcatta 3240acaccacaac
aaaacgctct gtttacacag attaggatgg gcatggcaaa ccgaggaggt 3300gtaatgggtg
ctcctcaaac cgggataagt ggcgtgtcag gtactaggca gatgcacccc 3360agctcagctg
gtctttccat gttggatcag aacagagcta atctgcagcg agctgctgct 3420atgggtaaca
tgggcccacc caagctgatg cctggaatga tgaatcttta catgaatcaa 3480caacaacagc
agcagcaact ccagcagcaa ccccaacaac aacagttgca gcatcagcaa 3540cagttacagc
agcctatgtc tcagccatct cagcagctag ctcagtctcc gcagcagcag 3600cagcagctac
aacaacatga acagcctcaa caagcacagc agcagcagca ggcaacagca 3660tcccctcttc
agtctgtact atcaccaccc caagtagggt caccatcagc tggaattacc 3720caacagcagc
tacaacagtc cagtccccag caaatgagtc agagaactcc aatgagtccc 3780cagcaagtga
accaaagaac tcctatgagt cctcagataa gctcgggtgc aatgcatccc 3840atgagcacaa
gcaacctcga gggttgtcca gcgagtccac agcttagctc tcagacaatg 3900ggttctgttg
gtagcatcac taattctcca atggagcttc aaggtcccaa aaacaactct 3960gctggtaata
attcttga
3978151325PRTArabidopsis thaliana 15Met Gly Val Ser Phe Lys Ile Ser Lys
Val Gly Arg Lys Phe Arg Pro 1 5 10
15 Lys Ile Ser Thr Glu Leu Ala Thr Pro Asp Ser Pro Lys Ala
Ile Val 20 25 30
Leu Ser Gly Lys Pro Lys Ala Thr Asp Asp Ser Asn Ile Gly Asp Val
35 40 45 Ser Gly Phe Ser
Lys Pro Ser Leu Pro Asp Ile Ser Pro Asp His Glu 50
55 60 Val Ser Phe Ile Leu Ser Leu Tyr
Pro Asn Gly Tyr Ser Ile Gly Lys 65 70
75 80 Thr Ser Glu Ala Met Gln Gln Ile Ser Phe Arg Asp
Val Pro Lys Val 85 90
95 Leu His Pro Tyr Asp Arg Ala Ala Glu Gly Leu Leu Ser Ala Ile Glu
100 105 110 Ala Gly Arg
Leu Pro Gly Asp Ile Leu Glu Asp Ile Pro Cys Lys Phe 115
120 125 Val Asp Gly Val Val Ile Cys Glu
Val His Asp Tyr Arg Lys His Thr 130 135
140 Ser Ser Gln Val Ser Pro Val Ile Asn Lys Leu Arg Leu
Lys Met Ser 145 150 155
160 Leu Glu Asn Val Val Lys Asp Ile Pro Ser Met Ser Asp Asn Ser Trp
165 170 175 Thr Tyr Gly Asp
Leu Met Glu Val Glu Ser Arg Ile Leu Lys Ala Leu 180
185 190 Gln Pro Glu Leu Cys Leu Asp Pro Leu
Pro Arg Leu Asp Arg Leu Ser 195 200
205 Lys Asn Pro Leu Thr Ala Lys Leu Asp Leu Ser Leu Ser Thr
Leu Arg 210 215 220
Arg Lys Arg Leu Arg Gln Met Ala Glu Val Thr Val Met Ser Gln Asn 225
230 235 240 Lys Ile Gln Gly Lys
Lys Val Cys Ile Asp Arg Leu Pro Glu Ser Ser 245
250 255 Glu Arg Gly Asn Leu Pro Gly His Leu Ile
Met Gln Gln Thr Asn Asn 260 265
270 Asn Gln Ala Ile Gln Asn Leu Gly Thr Asn Met Leu Ala Gly Leu
Arg 275 280 285 Ser
Gln Pro Leu Gln Asp Ala Pro Asn Ser Ser Leu Ala Leu Val Pro 290
295 300 Pro Gln Gln Gln Arg Tyr
Met Gly Ile Gly Ser Thr Arg Asn Thr Gln 305 310
315 320 Asp Gln Gly Ser Asn Ser Val Ser Val Ser Gly
Ala Ser Pro Gly Gly 325 330
335 Leu Asp Ala Met Leu Pro Tyr Gly Ser Asp Ser Met Asn Pro Gly Thr
340 345 350 Ser Phe
His Arg Lys Arg Glu Ser Gln Glu Gly Gln Met Ser Ser Met 355
360 365 Pro Gly Leu Asn Lys Arg Thr
Arg Val Ser His Met Gly Pro Asp Gly 370 375
380 Val Pro Gln Gln Gln Leu Gly Gln Arg Met Asp Gly
Leu His Gly Ser 385 390 395
400 Asp Thr Asn Trp Lys Asn Thr Leu Leu Gln His Gln Asp Met Leu Gly
405 410 415 Arg Ser Ile
Gln Tyr Pro Asn Thr Ser Ile Gln Arg Phe Ser Pro His 420
425 430 Gln Met Glu Gly Val Met Asn Gln
Glu Gly Gly Pro Met Gln Phe Pro 435 440
445 Ala Ser Gln Gln Gly Gly Met Lys Tyr Thr Ser Lys Glu
Glu Pro Phe 450 455 460
Glu Thr Gly Lys Ile Asp Gly Gly Thr Arg Asn Asn Ile Pro Gly Val 465
470 475 480 Gly Ser Asp Ala
Asn Asp Leu Asp Pro Arg Ile Gln Ser Arg Met Pro 485
490 495 His Asn Ala Phe Ile Arg Ser Asn Phe
Pro Gln Thr Ser Trp Asn Val 500 505
510 Asn Pro Gly Gln Gln Ile Glu Lys Glu Pro Lys Lys Glu Glu
Gln Phe 515 520 525
Ser Arg Arg Ile Ser Ala Gln Ser Pro Arg Leu Ser Ala Gly Gly Pro 530
535 540 Pro Gln Ser Pro Leu
Ser Ser Lys Ser Gly Glu Phe Ser Gly Gly Ser 545 550
555 560 Met Gly Thr His Tyr Gly Ala Val Ala Ala
Ala Gln Lys Asp Lys Ala 565 570
575 Val Thr Ser Ile Pro Ala Ile Gly Ala Thr Gln Ser Val Gly Ser
Ser 580 585 590 Ala
Asn Glu Ala Met Gln Gln Arg Gln His Gln Ala Gln Met Ala Ala 595
600 605 Lys Arg Arg Thr Asn Ser
Leu Pro Lys Thr Gln Val Ile Ser Thr Val 610 615
620 Gly Ser Pro Val Ser Val Asn Thr Ile Ser Val
Pro Val Asn Ala Arg 625 630 635
640 Ser Pro Ser Val Gly Pro Gln Thr Leu Gly Asp His Ala Ile Leu Asp
645 650 655 Arg Phe
Ser Lys Ile Glu Arg Val Ala Ala Arg Tyr Gln Leu Asn Cys 660
665 670 Lys Lys His Lys Val Asp Glu
Tyr Ser Arg Arg Pro Arg Val Tyr Ala 675 680
685 Lys Gln Pro Leu Thr Val Cys Leu Ser Asn Leu Ser
Asn Glu Glu Val 690 695 700
Phe Lys Asp Glu Asp Glu Ala Leu Ser Lys Ser Ile Phe Gly Gly Ser 705
710 715 720 Met Asn Thr
Tyr Lys Thr Arg Val Ile His Phe Gly Gln Met Glu Arg 725
730 735 Val Met Gln Gly Ser Val Pro Ser
Phe Ile Pro Arg Asn Arg Thr Arg 740 745
750 Leu Val Met Ser Glu Lys Ala Val Asp Gly Thr Val Ala
Trp Tyr Gln 755 760 765
Gly Asp Val Asp Glu Gly Asp Val Phe Gln Ala Glu Asp Phe Leu Leu 770
775 780 Ala Leu Pro Asn
Thr His Ile Ala Asp Leu Leu Ala Thr Gln Phe Lys 785 790
795 800 Ser Leu Met Ala Arg Glu Gly Tyr Met
Ile Glu Glu His Ile Met Ala 805 810
815 Lys Pro Asn Arg Gly Asp Thr Gly Pro Ile Ser Ser His Pro
Asn Ser 820 825 830
Ala Gly Gly Tyr Pro Arg Gly Tyr Ser Ala Asn Asp Met Gln Gln Tyr
835 840 845 Gly Asp Ala Val
Ala Gly Gln Ala Ser Gly Glu Ala Ser Lys His Gly 850
855 860 Asn Thr Gly Asn Thr Pro Asn Asn
Ser Thr Gln Asn Ile Leu Ala Asn 865 870
875 880 Ala Arg Met Val Pro Pro Thr Asn Ser Gln Ala Leu
Gln Met Ser Gln 885 890
895 Gly Leu Leu Ser Gly Val Ser Met Pro Met Gln Pro Gln Gln Leu Asp
900 905 910 Pro Gln Gln
Ser Ala Leu Leu Ser Ser His Ser Gln Gln Lys Asn Gln 915
920 925 Gln Ser Met Phe Thr Gln Gln Gln
His Pro Gln Met Gln Arg Pro Ser 930 935
940 Met Ile Leu Pro Thr Asn Pro Leu Ser Ala Ile Asn Ser
Met Ser Gln 945 950 955
960 Ser Ser Gly Met Gln Pro Gly Gly Gln Met Ala Asn Lys Tyr Ser Pro
965 970 975 Leu Gln Leu Gln
Met Leu Gln Gln Gln Gln Gln Ala Ala Val Gln Lys 980
985 990 Lys Ile Met Met Gly Leu Gly Ser
Gly Val Gly Met Gly Met Gly Met 995 1000
1005 Gly Met Gly Met Gly Met Gly Ser Met Gly Asn
Ser Ile Ala Gly 1010 1015 1020
Leu Gly Ala Leu Gly Asn Gln Leu Asn Met Ala Gly Arg Gly Met
1025 1030 1035 Gly Gly Thr
Gly Ile Ser Ser Ser Met Ser Val Pro Gly Ile Gly 1040
1045 1050 Asn Met Gly Gln Asn Pro Met Asn
Leu Asn Pro Ala Ser Asn Leu 1055 1060
1065 Asn Ala Ile Ser Gln Gln Leu Arg Ser Gly Ala Leu Thr
Pro Gln 1070 1075 1080
Gln Asn Ala Leu Phe Thr Gln Ile Arg Met Gly Met Ala Asn Arg 1085
1090 1095 Gly Gly Val Met Gly
Ala Pro Gln Thr Gly Ile Ser Gly Val Ser 1100 1105
1110 Gly Thr Arg Gln Met His Pro Ser Ser Ala
Gly Leu Ser Met Leu 1115 1120 1125
Asp Gln Asn Arg Ala Asn Leu Gln Arg Ala Ala Ala Met Gly Asn
1130 1135 1140 Met Gly
Pro Pro Lys Leu Met Pro Gly Met Met Asn Leu Tyr Met 1145
1150 1155 Asn Gln Gln Gln Gln Gln Gln
Gln Leu Gln Gln Gln Pro Gln Gln 1160 1165
1170 Gln Gln Leu Gln His Gln Gln Gln Leu Gln Gln Pro
Met Ser Gln 1175 1180 1185
Pro Ser Gln Gln Leu Ala Gln Ser Pro Gln Gln Gln Gln Gln Leu 1190
1195 1200 Gln Gln His Glu Gln
Pro Gln Gln Ala Gln Gln Gln Gln Gln Ala 1205 1210
1215 Thr Ala Ser Pro Leu Gln Ser Val Leu Ser
Pro Pro Gln Val Gly 1220 1225 1230
Ser Pro Ser Ala Gly Ile Thr Gln Gln Gln Leu Gln Gln Ser Ser
1235 1240 1245 Pro Gln
Gln Met Ser Gln Arg Thr Pro Met Ser Pro Gln Gln Val 1250
1255 1260 Asn Gln Arg Thr Pro Met Ser
Pro Gln Ile Ser Ser Gly Ala Met 1265 1270
1275 His Pro Met Ser Thr Ser Asn Leu Glu Gly Cys Pro
Ala Ser Pro 1280 1285 1290
Gln Leu Ser Ser Gln Thr Met Gly Ser Val Gly Ser Ile Thr Asn 1295
1300 1305 Ser Pro Met Glu Leu
Gln Gly Pro Lys Asn Asn Ser Ala Gly Asn 1310 1315
1320 Asn Ser 1325 166411DNAArabidopsis
thaliana 16ctttctcttc cgatcgcatc ttcttcaaaa atttcccacc tgtgtttcac
aaattccatg 60tttatgaatt cttcattgct ctattcttag tcacctttga tttctctcgc
tttctatccg 120atccaattgt ttgatgatct tctctgtaac aagctcataa ggtttcaatt
tctctagctt 180tcttaaaatt cattcttcga tttcttcaat tctcgtgtct tttttatttc
tgtatcgttt 240attgacagta cctagacagg tttgagcttc atctctctgg agagaatcca
tgggtgtctc 300gtttaagata tcgaaggttg gtagaaagtt tcgacctaag atttctactg
aattggctac 360tcctgattcc ccaaaagcaa tcgttctatc tgggaaacca aaggtaattt
aacttagaat 420tttagttgta ttgtgttcca actaaattcg cttattttgg aaagttatat
agaaaattta 480ttacgtttgg ttcaggccac tgatgatagc aatattggcg atgtttccgg
gttttcgaag 540ccatctttac ccgatatatc tccaggtttg gatctcaacg aaccactttg
acacataatg 600ttttgctaaa ttctagctat gttgaattga gtgcattttg gtttctctgc
agatcatgaa 660gtttccttca tattgagcct ctatccaaat gggtactcta taggaaaaac
ctctgaggta 720tgtactgaga gtctatatga atttatttat cttgtgattt cttgtatttg
agttttaaaa 780ccttcacgtt ttcacaaatt tgagtttttg aataccaggc tatgcaacag
atatcgtttc 840gagatgttcc aaaggtctta catccgtatg atagggcagc agagggtctc
ctttcggtaa 900atctttcgaa ctatgttatt atagacttga tttgaacatg taatcaaagt
tttggtgaat 960gaattcaaag tacttagatt tagtaaatgt gaagatgatg ttttttttcc
ccacttgttc 1020tacccgaata atgcatttca ctgcactact tactcgcgtt ttgttaaata
cactttctga 1080gtttcattct actgagtaaa tgtttttaat ccctttgtac gctttatagg
ctattgaggc 1140tggcaggctt cctggggaca ttttggaaga tataccttgc aaatttgtgg
atggggtggt 1200tatatgtgag gtgagttatc tgcaattatt ttttgggata aagccttcca
taagttcttg 1260gaaacagtcc aaacgtatat aaatatattt aaaaagagct caacagaaat
tatctacact 1320taatcaagat taaaaaaatg tcgtaattat aagtacatgg aagtttatct
tccaaactca 1380attgtacatg tatttgattg tttctgaaac ataatggagt aactgggacc
agaagtaaac 1440ataaaaaacc tagttatact aatttttaat tgactgctgt gtaccatctt
acatcatcat 1500gttttcttta atttttggca catactattg taggtgcatg actatcggaa
acatacctca 1560tctcaagtct ctcctgtgat aaataaattg cgccttaaga tgtcactcga
gaatgtggta 1620aaagatattc catcaatgtc agacaactca tggacgtacg gtgatctcat
ggtaatcatg 1680gtagctcgtg gcttataggt cgtatatctg agcactgaaa ctattatctt
ctgtactgat 1740ccttacatca actgcaggaa gtggagtcca ggatattaaa agccttacaa
cctgaactct 1800gtctggatcc tttacccaga cttgataggc tgagtaaaaa tcctttgact
gctaaggtaa 1860tatctcatta aaaagactcc ttgtgctttc tgttctcagt tgtttattat
agtgtctaaa 1920atgttttttt ttctctactc gatagctcga tttgtcgctt tctactttgc
ggagaaagag 1980attaaggcaa atggcagaag tgacagtcat gtctcagaat aagattcagg
ggaaaaaggt 2040gtgcattgat cggcttcctg aaagttcaga gcgaggaaat ttgccagggc
atttgataat 2100gcagcaaacc aataacaacc aggctattca aaaccttggt actaatatgc
tggcgggatt 2160aagaagtcag ccgttgcaag atgcaccaaa ttcctctctg gccttggtac
cacctcagca 2220acaaaggtac atgggaattg gaagtacaag aaacacgcag gatcaaggat
caaattctgt 2280cagtgtctct ggcgcttcgc ctggtggact agatgcgatg ctgccttatg
gctctgatag 2340tatgaaccct ggtacatctt ttcatagaaa gagagaaagt caagaaggac
aaatgtcttc 2400tatgcctggc ttgaataagc gaacaagggt ttcacatatg ggtcctgatg
gggttccgca 2460gcaacagtta gggcaacgta tggatggcct tcatggatcc gatacaaatt
ggaaaaatac 2520gcttctacaa caccaagaca tgctaggcag aagtattcag tatccaaata
caagtattca 2580gaggttttca ccacaccaaa tggaaggggt tatgaatcag gaaggtggtc
ccatgcaatt 2640tccagcttca caacaggggg gaatgaaata cacttcaaaa gaggagccat
ttgagactgg 2700taaaattgat ggcggcacca gaaacaatat tccgggggtg ggaagtgatg
caaatgattt 2760agatccacgt attcagtcaa ggatgcccca taatgcattc attagatcaa
atttccctca 2820aacatcctgg aatgttaatc ctggccagca gattgaaaaa gagccgaaaa
aagaagaaca 2880atttagtcgt aggatatcgg ctcaaagtcc tcgtttgtcg gcaggtggtc
caccgcagtc 2940cccactttca tcgaagtctg gtgagttttc tggtggttca atggggaccc
actatggagc 3000agttgcagca gctcagaagg acaaggctgt tacttctatt cctgctattg
gtgctactca 3060gtcagtgggt tctagtgcta atgaagctat gcagcaaagg caacaccaag
cccaaatggc 3120tgcaaaacgg agaacaaatt ctcttcctaa gacgcaagtt attagcactg
ttggttctcc 3180tgttagtgtc aatactatta gtgtcccagt taatgcaagg agcccttcag
tgggacccca 3240aactttgggc gatcacgcaa tcttggacag attttcaaag attgaacgag
ttgctgctag 3300gtatgaatgt tatgaaacct ggtttgttga ttttattccc ttcaaattct
tttttatgat 3360ctttactttc acttatgtga tacttctcct gttttgattc tggctttacg
ctagagcatt 3420gctggcattg tcttattctc cttatatcat tgcatttata taaataaata
atgtttgttg 3480gtgcatgaac aagttctata tttcatagat tttatttttt ggttgatcca
gtttcttgtt 3540ccatttttag gtaccaacta aactgcaaaa agcataaggt ggatgagtac
tctcgaagac 3600ctcgcgtgta tgctaaacag ccccttactg tttgtttatc aaacctgtct
aacgaagagg 3660tcttcaaaga cgaggacgaa gcattatcaa aatctatatt tggtggcagt
atgaatacat 3720acaagaccag agtcattcac tttggtcaga tggaacgtgt aatgcaaggt
ctgtttttct 3780tttaactaga tatctggcta ttggtatatt tctttatgtg attgaccaga
ctccagtatc 3840ttttcaggtt cggtcccttc cttcatccct agaaaccgaa caagactggt
gatgtcagag 3900aaggccgtcg atgggacagt agcatggtat caaggggacg tagatgaagg
ggatgttttt 3960caggctgaag attttctctt agcgttgccc aatacagtaa gttcacagga
aatttgatag 4020ttatcatact cccctgcatt cttttttgat cagcaatata tcttcaactt
gcatgcacta 4080ccattcaatg taatgttgat tttacattta gtgatgttta taggttgtcg
ggtcatgttc 4140ttggggttta tgtctctgtt gtgaatgttt tgtgtaatta tgaatatggt
tggttggtct 4200atggatactt ctctcttgtt agttgcttat gctcgtttat ccttcttgtc
caatgcgatc 4260aaaagggaat ggacaatgga ttattaattt ttctcttatg tacgccactt
attttctgga 4320agctatgctg acttgcttat tcctcacttt gtcacagcac atcgccgatc
tacttgctac 4380tcaatttaaa tcactggtat ttctcgagtt ctgaatcaat tatttcatgt
tcctggttct 4440atggtaaagc tacttaaaga ttgatttata tgcttatgca gatggcccgt
gaaggataca 4500tgattgaaga acatattatg gcaaagccaa accgtgggga tactggccca
atcagcagcc 4560atccaaattc tgcgggtggt tatccaagag gttattctgc aaacgatatg
caacagtatg 4620gagatgcagt tgcagggcaa gcgtctggtg aggcatcaaa acatgggaat
actggaaata 4680cgccgaataa ctcaacccag aatattcttg caaatgcaag gatggttcct
ccaacaaatt 4740ctcaagcctt gcaaatgtct caaggactgc tgtctggtgt ctccatgcct
atgcaaccac 4800aacagcttga cccacaacag tcagcgctac tgtcatcaca ttcacagcag
aaaaatcaac 4860agtcaatgtt tacacagcaa cagcatccac aaatgcagag accttccatg
atactgccta 4920caaatccact atcagccatc aactcgatga gccagagctc tggtatgcag
ccgggtggtc 4980agatggccaa caagtattcg cctctccaac tgcagatgtt acagcagcag
cagcaggcgg 5040cagtgcagaa gaagataatg atggggctag gatcaggtgt aggcatgggt
atgggtatgg 5100gcatgggtat gggtatggga agcatgggaa atagtattgc tgggcttgga
gctttaggca 5160accaattgaa tatggcagga agaggtatgg ggggaaccgg aatctcatcg
tcaatgtctg 5220ttcctggcat cggtaatatg ggccagaacc caatgaatct gaatccagca
tcaaatttga 5280atgctataag ccagcaactc cgatctggtg cattaacacc acaacaaaac
gctctgttta 5340cacagattag gatgggcatg gcaaaccgag gaggtgtaat gggtgctcct
caaaccggga 5400taagtggcgt gtcaggtact aggcagatgc accccagctc agctggtctt
tccatgttgg 5460atcagaacag agctaatctg cagcgagctg ctgctatggg taacatgggc
ccacccaagc 5520tgatgcctgg aatgatgaat ctttacatga atcaacaaca acagcagcag
caactccagc 5580agcaacccca acaacaacag ttgcagcatc agcaacagtt acagcagcct
atgtctcagc 5640catctcagca gctagctcag tctccgcagc agcagcagca gctacaacaa
catgaacagc 5700ctcaacaagc acagcagcag cagcaggcaa cagcatcccc tcttcagtct
gtactatcac 5760caccccaagt agggtcacca tcagctggaa ttacccaaca gcagctacaa
cagtccagtc 5820cccagcaaat gagtcagaga actccaatga gtccccagca agtgaaccaa
agaactccta 5880tgagtcctca gataagctcg ggtgcaatgc atcccatgag cacaagcaac
ctcgagggtt 5940gtccagcgag tccacagctt agctctcaga caatgggttc tgttggtagc
atcactaatt 6000ctccaatgga gcttcaaggt cccaaaaaca actctgctgg taataattct
tgatcaggaa 6060aactatgatt ttgggtagac attatttatc ttcaggaacc ctttgcttca
caacatgagt 6120tgttatctac attagggaca agcatagaaa gagtttttag tttaccgtct
taagttttgc 6180ttgtacatta agcttttgaa attaaattta gattcatgac caaagcctgt
agagaaaaag 6240taaagaatct gttgtgctct gctagtgaaa ttaagtgcca ctatcattag
gttgttgata 6300taaccactgt ctgcttcaag gctatttgga gatttatttt aagcttaata
attaatatat 6360ctgttttgtt caattgttgt gatttgccac tgctaccttg taaacatggg a
6411173906DNAGlycine max 17atgggggtct ctttcaaggt gtccaaaacc
ggcactaggt ttcgccccaa gtcgattccc 60caacttcaag atggctcatc cgacaattcc
aagtcccaga gtgatcttgt tgaggctggt 120gaaaacattg ctcagattcc ccagtcatct
gtttcatctg aaactctttc attagcagat 180agggaagctt ctttcacatt gaacctgttt
ccagatggtt attctattgg aaaaccctcc 240gagaatgaag cagctagtca gtcaaaatac
caagattttc ccaagtcgtt acatccatat 300gacaggtcgt ctgagagtct attcttggcc
attgagtcag gtcacttgcc tggggatatt 360cttgatgata tacctgccaa gtatgttgat
ggagcactta tatgtgtggt gcatgattat 420cgaagatgct cttctgataa agggagtagt
gtgtctgcag aaagttctac tgttagcaaa 480gtatgcctca agatgtcgtt ggaaaatatt
gtaaaggaca tcccatcgat tactgacaag 540tcttggacat atggtgattt gatggaagtt
gagtcgaaga tactgaaagc attacaacca 600aaacttcatc tagaccctac tccaaagtta
gatcggctgt gtgaaagtcc acttccaaca 660aagctcaatt tgccaagaaa gcgattaaaa
aatatgccag agtttgctgt tacttctacc 720aataaaattc atgggaagaa agtatgcata
gatagagtgc aagaaagctc aattagcaga 780gtaggtgatg taggaaacac tgcatccaat
gctattgtgc agcagaccca tgaaaatcca 840gccatgcaaa atcttagtcc aaatgttgcc
atggccttga gatctaagaa ttttatacct 900gattcttcca tccctaactt tcctatgatg
acccatcaat caagatatgc aatggctgtt 960ggaactcaga gaagtttgca ggagcaggga
cccgctcctt ccattaattc atcagtggct 1020tctcctgcta cacaatatgc tgataatgca
aactcaggtg cctctcttct tggaaaaagg 1080gataatcaag atggacaagc atcgcctttg
tccaatattg ctaaaagaat gaggcctggt 1140tccactgttg ttgatgcaat gcagcatcag
caaataggct cacacgttga agctcttcaa 1200ggatcagata tgaattggca gaattcattg
caacaacaac caatggccag aggtattcag 1260tatgcaagtg gtggcattca gaagtttcct
cagcaggttt ttgaaggggg ggcaaatcaa 1320gagacagggg caattccctt tgcttctagt
cagcagggca tgaggttggt tgccaaggaa 1380gaacagtttg aaatggaaaa attagatggt
gcagaaataa actgcaataa aagtgacatg 1440gaaatggaaa tgaacaattt agatccacaa
caattgcggc ttcagcaacg attgccacag 1500catgcattca tgaggcctaa tttccctcag
gcagcctgga acagtttggg tcagcatatg 1560ggcaaagaaa caaaaaaaga agaccagctt
cagaaaagga aatcagtaca gagtcctcgc 1620ttatcctccg cggcattacc tcactcccca
ttgtcttcga aatcaggtga attttccaat 1680ggtgcagttg gaccaagttt tggaccatct
gcaatggctg ctgcacctgg gacatcacaa 1740aaagacaagg cagcaatggc ctcagttcct
gctactgttg gaactccatc taatgattct 1800acacaaagac aacatgcaca actagctgca
aaacggagat ctaattctct tcccaagacc 1860ccagcaatga atggagttgg ttctcctgtt
agtgttggta caaccagtgt cccattgaat 1920gcaaatagtc cctcagttgt gacctcgggt
tttgttgatc aaaatcttca aaatatgctt 1980gaaaggttct caaaaattga aatggtgaca
atgaggcatc aacttaactt taagaagaac 2040aaggttgatg actatcccat taagaagcag
aatccatatg taccaaataa tctatcagca 2100cttcttgcta atgctaatgc aactaataat
gagggattgc cagaggagtc aatttctatt 2160tcaaagtcgc ttataggtgg gagtatgaat
gcgtgcaaaa tgagaatctt aaatttttgt 2220gtgcctgagc gtgtagttca aggaagtatt
gttactataa ttccgaggat gcgaactagg 2280atgattatgt ttgaaaaatc tgatggtact
gtggctatgc attgtggggt gattgaagaa 2340gttgattacg tagctgcaga ggatcatctc
ctcacattac ccaatactca ttctgcggat 2400ttgcttgcac aacagttctg ttcactgatg
gtacgcgaag gatatgtgaa ggaagatgat 2460cgaatccaac ttaaaccaaa ccgggtgaac
cttccgttgg gcaatcaatc tactacccct 2520aataatgctg tagttgaaat gcaacaatat
ggagaagtca ttcctggtca atcatccaat 2580gaagttgcaa aaccagctag tggcagtaat
gcacctataa acctctctca gaatcttcta 2640acaaacccaa ggatgttgcc acctggaagc
ccccaagcct tacagatgtc ccaaggactt 2700ctctctggtg tttcaatggc ttcaagacca
cagcaaatgg actcacaaca agctgtacag 2760caacaacagc agcagcagca gcagcaacaa
caacaacaac agcagcagca gcagcagctg 2820caacaaaatc aacacacact cattcaacag
cagaatcccc agttccagag gtctcctatg 2880atgcttggga caaatcagct ttcacactta
aatccagttg gacaaaactc caacatgcca 2940ttaggtaatc acatgctcaa caagccttca
gctctccaga tgcagatgtt ccaacaacag 3000caacagcagc ctcaaatgca aaggaaaatg
atgatgggac ttggacaagc cgtgggaatg 3060ggtaacttga gaaataacct agttgggctt
gcaccaatgg gcaaccctat gggaatggga 3120ggtgcgaggg gaataggagg aagtggaatc
tcagcaccaa tgacatctat tgctggcatg 3180ggaaatatgg gtcagagccc aatgaatctt
agccagactt caaatattac taattccata 3240agccaacagt ttaggtccgg atcattaaat
gcagcagcat ctgctgacct tatatcaagg 3300cttagattgg tacattcgaa tcgtcaaagc
atgctagggt cccctcagtc taacctagct 3360agcatctcag gggccagaca aatacaccct
ggtgctactc ctagtctttc aatgttgggc 3420agggctaata caatgcagcg accaattgga
cctatgggtc caccaaagat gatggcaggg 3480atgaatcttt atatgagtca gcagcagcaa
catcaacaac cccaacagca gcagcagcaa 3540caccaacagc aattgcaact ccaacagcat
atgcagcagc aattacagca gcaacagcaa 3600caacaagaaa caacttcaca attgcagtca
gttgtttcac ccccacaggt gggatcgcca 3660tcaatgggcg taccaccatt gaaccaacaa
acgcagcagc aagccagccc tcagcaaatg 3720agtcaacgaa ctccgatgag tccacaaatg
agctcaggtg caattcatgc catgagtgct 3780ggtaatcctg aagcttgtcc agccagtcca
cagttgagct ctcagaccct tggctctgtt 3840agtagcataa caaactcccc tatggacatg
caaggtgtta acaagagcaa ctctaatgca 3900caatga
3906181301PRTGlycine max 18Met Gly Val
Ser Phe Lys Val Ser Lys Thr Gly Thr Arg Phe Arg Pro 1 5
10 15 Lys Ser Ile Pro Gln Leu Gln Asp
Gly Ser Ser Asp Asn Ser Lys Ser 20 25
30 Gln Ser Asp Leu Val Glu Ala Gly Glu Asn Ile Ala Gln
Ile Pro Gln 35 40 45
Ser Ser Val Ser Ser Glu Thr Leu Ser Leu Ala Asp Arg Glu Ala Ser 50
55 60 Phe Thr Leu Asn
Leu Phe Pro Asp Gly Tyr Ser Ile Gly Lys Pro Ser 65 70
75 80 Glu Asn Glu Ala Ala Ser Gln Ser Lys
Tyr Gln Asp Phe Pro Lys Ser 85 90
95 Leu His Pro Tyr Asp Arg Ser Ser Glu Ser Leu Phe Leu Ala
Ile Glu 100 105 110
Ser Gly His Leu Pro Gly Asp Ile Leu Asp Asp Ile Pro Ala Lys Tyr
115 120 125 Val Asp Gly Ala
Leu Ile Cys Val Val His Asp Tyr Arg Arg Cys Ser 130
135 140 Ser Asp Lys Gly Ser Ser Val Ser
Ala Glu Ser Ser Thr Val Ser Lys 145 150
155 160 Val Cys Leu Lys Met Ser Leu Glu Asn Ile Val Lys
Asp Ile Pro Ser 165 170
175 Ile Thr Asp Lys Ser Trp Thr Tyr Gly Asp Leu Met Glu Val Glu Ser
180 185 190 Lys Ile Leu
Lys Ala Leu Gln Pro Lys Leu His Leu Asp Pro Thr Pro 195
200 205 Lys Leu Asp Arg Leu Cys Glu Ser
Pro Leu Pro Thr Lys Leu Asn Leu 210 215
220 Pro Arg Lys Arg Leu Lys Asn Met Pro Glu Phe Ala Val
Thr Ser Thr 225 230 235
240 Asn Lys Ile His Gly Lys Lys Val Cys Ile Asp Arg Val Gln Glu Ser
245 250 255 Ser Ile Ser Arg
Val Gly Asp Val Gly Asn Thr Ala Ser Asn Ala Ile 260
265 270 Val Gln Gln Thr His Glu Asn Pro Ala
Met Gln Asn Leu Ser Pro Asn 275 280
285 Val Ala Met Ala Leu Arg Ser Lys Asn Phe Ile Pro Asp Ser
Ser Ile 290 295 300
Pro Asn Phe Pro Met Met Thr His Gln Ser Arg Tyr Ala Met Ala Val 305
310 315 320 Gly Thr Gln Arg Ser
Leu Gln Glu Gln Gly Pro Ala Pro Ser Ile Asn 325
330 335 Ser Ser Val Ala Ser Pro Ala Thr Gln Tyr
Ala Asp Asn Ala Asn Ser 340 345
350 Gly Ala Ser Leu Leu Gly Lys Arg Asp Asn Gln Asp Gly Gln Ala
Ser 355 360 365 Pro
Leu Ser Asn Ile Ala Lys Arg Met Arg Pro Gly Ser Thr Val Val 370
375 380 Asp Ala Met Gln His Gln
Gln Ile Gly Ser His Val Glu Ala Leu Gln 385 390
395 400 Gly Ser Asp Met Asn Trp Gln Asn Ser Leu Gln
Gln Gln Pro Met Ala 405 410
415 Arg Gly Ile Gln Tyr Ala Ser Gly Gly Ile Gln Lys Phe Pro Gln Gln
420 425 430 Val Phe
Glu Gly Gly Ala Asn Gln Glu Thr Gly Ala Ile Pro Phe Ala 435
440 445 Ser Ser Gln Gln Gly Met Arg
Leu Val Ala Lys Glu Glu Gln Phe Glu 450 455
460 Met Glu Lys Leu Asp Gly Ala Glu Ile Asn Cys Asn
Lys Ser Asp Met 465 470 475
480 Glu Met Glu Met Asn Asn Leu Asp Pro Gln Gln Leu Arg Leu Gln Gln
485 490 495 Arg Leu Pro
Gln His Ala Phe Met Arg Pro Asn Phe Pro Gln Ala Ala 500
505 510 Trp Asn Ser Leu Gly Gln His Met
Gly Lys Glu Thr Lys Lys Glu Asp 515 520
525 Gln Leu Gln Lys Arg Lys Ser Val Gln Ser Pro Arg Leu
Ser Ser Ala 530 535 540
Ala Leu Pro His Ser Pro Leu Ser Ser Lys Ser Gly Glu Phe Ser Asn 545
550 555 560 Gly Ala Val Gly
Pro Ser Phe Gly Pro Ser Ala Met Ala Ala Ala Pro 565
570 575 Gly Thr Ser Gln Lys Asp Lys Ala Ala
Met Ala Ser Val Pro Ala Thr 580 585
590 Val Gly Thr Pro Ser Asn Asp Ser Thr Gln Arg Gln His Ala
Gln Leu 595 600 605
Ala Ala Lys Arg Arg Ser Asn Ser Leu Pro Lys Thr Pro Ala Met Asn 610
615 620 Gly Val Gly Ser Pro
Val Ser Val Gly Thr Thr Ser Val Pro Leu Asn 625 630
635 640 Ala Asn Ser Pro Ser Val Val Thr Ser Gly
Phe Val Asp Gln Asn Leu 645 650
655 Gln Asn Met Leu Glu Arg Phe Ser Lys Ile Glu Met Val Thr Met
Arg 660 665 670 His
Gln Leu Asn Phe Lys Lys Asn Lys Val Asp Asp Tyr Pro Ile Lys 675
680 685 Lys Gln Asn Pro Tyr Val
Pro Asn Asn Leu Ser Ala Leu Leu Ala Asn 690 695
700 Ala Asn Ala Thr Asn Asn Glu Gly Leu Pro Glu
Glu Ser Ile Ser Ile 705 710 715
720 Ser Lys Ser Leu Ile Gly Gly Ser Met Asn Ala Cys Lys Met Arg Ile
725 730 735 Leu Asn
Phe Cys Val Pro Glu Arg Val Val Gln Gly Ser Ile Val Thr 740
745 750 Ile Ile Pro Arg Met Arg Thr
Arg Met Ile Met Phe Glu Lys Ser Asp 755 760
765 Gly Thr Val Ala Met His Cys Gly Val Ile Glu Glu
Val Asp Tyr Val 770 775 780
Ala Ala Glu Asp His Leu Leu Thr Leu Pro Asn Thr His Ser Ala Asp 785
790 795 800 Leu Leu Ala
Gln Gln Phe Cys Ser Leu Met Val Arg Glu Gly Tyr Val 805
810 815 Lys Glu Asp Asp Arg Ile Gln Leu
Lys Pro Asn Arg Val Asn Leu Pro 820 825
830 Leu Gly Asn Gln Ser Thr Thr Pro Asn Asn Ala Val Val
Glu Met Gln 835 840 845
Gln Tyr Gly Glu Val Ile Pro Gly Gln Ser Ser Asn Glu Val Ala Lys 850
855 860 Pro Ala Ser Gly
Ser Asn Ala Pro Ile Asn Leu Ser Gln Asn Leu Leu 865 870
875 880 Thr Asn Pro Arg Met Leu Pro Pro Gly
Ser Pro Gln Ala Leu Gln Met 885 890
895 Ser Gln Gly Leu Leu Ser Gly Val Ser Met Ala Ser Arg Pro
Gln Gln 900 905 910
Met Asp Ser Gln Gln Ala Val Gln Gln Gln Gln Gln Gln Gln Gln Gln
915 920 925 Gln Gln Gln Gln
Gln Gln Gln Gln Gln Gln Gln Leu Gln Gln Asn Gln 930
935 940 His Thr Leu Ile Gln Gln Gln Asn
Pro Gln Phe Gln Arg Ser Pro Met 945 950
955 960 Met Leu Gly Thr Asn Gln Leu Ser His Leu Asn Pro
Val Gly Gln Asn 965 970
975 Ser Asn Met Pro Leu Gly Asn His Met Leu Asn Lys Pro Ser Ala Leu
980 985 990 Gln Met Gln
Met Phe Gln Gln Gln Gln Gln Gln Pro Gln Met Gln Arg 995
1000 1005 Lys Met Met Met Gly Leu
Gly Gln Ala Val Gly Met Gly Asn Leu 1010 1015
1020 Arg Asn Asn Leu Val Gly Leu Ala Pro Met Gly
Asn Pro Met Gly 1025 1030 1035
Met Gly Gly Ala Arg Gly Ile Gly Gly Ser Gly Ile Ser Ala Pro
1040 1045 1050 Met Thr Ser
Ile Ala Gly Met Gly Asn Met Gly Gln Ser Pro Met 1055
1060 1065 Asn Leu Ser Gln Thr Ser Asn Ile
Thr Asn Ser Ile Ser Gln Gln 1070 1075
1080 Phe Arg Ser Gly Ser Leu Asn Ala Ala Ala Ser Ala Asp
Leu Ile 1085 1090 1095
Ser Arg Leu Arg Leu Val His Ser Asn Arg Gln Ser Met Leu Gly 1100
1105 1110 Ser Pro Gln Ser Asn
Leu Ala Ser Ile Ser Gly Ala Arg Gln Ile 1115 1120
1125 His Pro Gly Ala Thr Pro Ser Leu Ser Met
Leu Gly Arg Ala Asn 1130 1135 1140
Thr Met Gln Arg Pro Ile Gly Pro Met Gly Pro Pro Lys Met Met
1145 1150 1155 Ala Gly
Met Asn Leu Tyr Met Ser Gln Gln Gln Gln His Gln Gln 1160
1165 1170 Pro Gln Gln Gln Gln Gln Gln
His Gln Gln Gln Leu Gln Leu Gln 1175 1180
1185 Gln His Met Gln Gln Gln Leu Gln Gln Gln Gln Gln
Gln Gln Glu 1190 1195 1200
Thr Thr Ser Gln Leu Gln Ser Val Val Ser Pro Pro Gln Val Gly 1205
1210 1215 Ser Pro Ser Met Gly
Val Pro Pro Leu Asn Gln Gln Thr Gln Gln 1220 1225
1230 Gln Ala Ser Pro Gln Gln Met Ser Gln Arg
Thr Pro Met Ser Pro 1235 1240 1245
Gln Met Ser Ser Gly Ala Ile His Ala Met Ser Ala Gly Asn Pro
1250 1255 1260 Glu Ala
Cys Pro Ala Ser Pro Gln Leu Ser Ser Gln Thr Leu Gly 1265
1270 1275 Ser Val Ser Ser Ile Thr Asn
Ser Pro Met Asp Met Gln Gly Val 1280 1285
1290 Asn Lys Ser Asn Ser Asn Ala Gln 1295
1300 193933DNAGlycine max 19atgggggtct ccttcaaggt gtccaaaacc
ggcactaggt ttcgccctaa gtgcattccc 60caacttcaag atggcgcatc cgacaattcc
aaaccccaga gtgatcttgt tgaggctggt 120gaaaacattg ctcagattcc caggtcatct
gtgtcatctg aaactctttc attagcagat 180agggaggctt ctttcacatt gaacctgttt
ccagatggtt attctattgg aaaaccctcc 240gagaatgaag cagctaatca gtcaaaatac
caagattttc ccaagttgtt acatccatat 300gataggtcat ctgagagtct tttcttggcc
attgagtcag gtcacttgcc tggggatatt 360cttgatgata tacctgccaa gtatgttgat
ggagcactta tatgtgaggt gcatgattat 420cgaagatgct cttctgaaaa agggggtagt
gtgtctgcag aaagttctcc tactgttagc 480aaagtatgcc tcaagatgtc gttggaaaat
attgtaaagg acatcccatc gattactgac 540aagtcttgga catatggtga tctaatggaa
gttgaatcga agatactgaa agcattacaa 600ccaaaacttc atctagaccc tactccaaag
ttagatcggc tgtgtgaaag tccgcttcca 660acgaagctca atttgccaag aaagcgatta
aaaaatatgc cagagtttgc tgttacttct 720actaataaaa ttcatgggaa gaaagtatgc
atagatagag tgcaggaaag ctcaattaac 780agattaggtg atgtaggaaa cactgcatca
aatgctattg tgcagcagac ccatgaaaat 840ccagccatgc agaatcttag tccgaatgtt
gccatggcct tgagatctaa gaattttata 900cctgattctt ccatccctaa ctttcctatg
atgtcccatc aatcaagata ttcaatggct 960gttggaactc agagaagttt gcaggagcag
ggaccaactc cttccattaa ttcgttaggg 1020gcttctcctg ctacacaaga tgtcatgatt
tcatatgctg aaaatgcaaa ctcgggtgcc 1080tctcttcttg gaaaaaggga taatcaagat
ggacaagcat cacctttgtc caatattgct 1140aaaagaatga ggcctgcttc cactgtgctt
gatgcaatgc agcatcagca aatagggtca 1200catgttgaag ctcttcaagg atcagatatg
aattggcaga atacattgca acaacaagca 1260atggccagaa ttcagtatgc aagtggtggc
attcaaaagt ttcctcagca ggcttttgaa 1320gggggggcaa atcaagagac aggggctatt
ccctttgctt ctagtcagca gcagggcatg 1380aggttggttg ccaaggaaga acagtttgaa
atggaaaaat tagatggtgc agagataaac 1440cgcaataaaa gtgagatgga aatggaaatg
aacaatttag atccacaaca attacggatt 1500cagcaacgat tgtcacagca tgcattcatg
aggtctaatt tcccccaggc agcctggaac 1560agtttgggtc agcctatgga gaaagaaaca
aaaaaagagg accagcttca gaaaaggaaa 1620tcagtacaga gtcctcgctt atccaccggg
gcattacctc actccccatt gtcttcgaaa 1680tcaggtgaat tttccaatgg tgcagtagga
ccaagttttg gacagtctgc aatggctgct 1740gtgcctggga catcacaaaa agacaagaca
gcaatggtct cagttcctgc tactgttgga 1800actccatcta atgactctac acaaagacaa
catgcacaac tagccgcaaa gcggagatct 1860aattctcttc ccaagacccc agcaatgaat
ggagttggtt ctcccgctag tgttggtaca 1920accagtgtcc cactgaatgc aaatagtccc
tcagttgtga cctcgggttt agttgaccaa 1980aatcttcaaa atatgcttga aaggttctca
aaaattgaaa tggtgacaat gaggcatcaa 2040cttaacttta agaagaataa ggttgatgac
tatcccatta agaagcagaa tccatatgca 2100caaaataatc tagctgcact tcttgccaat
gcaactaata atgagggatt gccagaggag 2160tcaatttctt tgtcaaagtc gcttattggt
gggagtatga atgcatgtaa aatgagaatc 2220ttaactttct gtgtgcctga gcgtgtagtt
caaggaagtg ttgttactat aattccgagg 2280atgcgaacta ggatgataat atttgagaaa
tctgatggta ctgtcgctat gcattgtggg 2340gagattgaag aagttgatta cgtagctgca
gaggatcatc ttctcacatt acccaatact 2400cattctgcag atttgcttgt acaacagttc
tgttcactga tggtacgcga aggatttgtg 2460aaagaagatg accgaatcca acttaaacca
aaccgggtga accttccatt gggcaatcaa 2520tctactaccc ctaataatgc tgtagttgaa
atgcaacaat atggagaagc cattcctggt 2580caatcatcca atgaagttgc aaaaccaact
agtggcagta atgcacctgt aaacctctct 2640cagaatcttg taacaaatcc aaggatgctg
ccacctggaa acccccaagc cttacagatg 2700tcccaaggac ttctctctgg tgtttcgatg
gcttcaagac cacaacaaat ggactcacaa 2760caagccatac agcagcagca gcagcagcag
cagcaacaac aacaacagca gcagctgcaa 2820caaaatcaac acacactcat tcaacagcag
aatccccagt tccagaggtc tcctatgatg 2880cttgggacaa atcagctttc acacttaaat
ccagttggac aaaactccaa catgccatta 2940ggtaatcaca tgctgaacag gccttcagct
ctccagcttc agatgttcca acaacaacaa 3000cagcaacagc aacagcagca gcagcagcct
caaatgcaaa ggaaaatgat gatgggactc 3060ggacaagctg tgggaatggg taacttgaga
aataacctag ttgggcttgc acccatgggt 3120aaccctatgg ggatgggagg tgtcagggga
ataggaggaa gtggaatctc agcaccaatg 3180acatctattg ctggcatggg aaatatgggt
cagaacccaa tgaatcttag ccagacttca 3240aatattacta attccataag ccaacagttc
aggtccggat cgataaatgc agcagcatct 3300gctgaccttt tatcaaagct tagattggta
catcagaatc gtcaaggcat gctagggtcc 3360tctcaatcta acatagctag catctcaggg
gctagacaaa tacaccctgg tggtactcca 3420agtctttcaa tgttgggcag ggctaataca
atgcagcgac caattggacc tatgggtcca 3480ccgaagatta tggctgggat gaatctttat
atgagtcagc agcagcagca gcaacatcaa 3540caaccccaac cccaacaaca gcagcagcaa
caccaacagc aattgcaact tcagcagcat 3600atgcagcagc aattacagca gcaacaacaa
caagaaacaa cttcacaatt gcaggcagtt 3660gtttctcccc cacaggtggg atcgccatca
atgggcattc caccaatgaa ccaacaagcg 3720cagcagcaag ccagccctca gcaaatgagt
caacgaaccc ctatgagtcc acagatgagc 3780tcaggtgcga ttcatgccat gaatgctggt
aatcctgaag cttgtccagc cagtccacag 3840ttgagctctc agacccttgg ctctgttagt
agcataacaa actcccctat ggacatgcaa 3900ggtgtcaaca agagcaactc taatgcacaa
tga 3933201310PRTGlycine max 20Met Gly Val
Ser Phe Lys Val Ser Lys Thr Gly Thr Arg Phe Arg Pro 1 5
10 15 Lys Cys Ile Pro Gln Leu Gln Asp
Gly Ala Ser Asp Asn Ser Lys Pro 20 25
30 Gln Ser Asp Leu Val Glu Ala Gly Glu Asn Ile Ala Gln
Ile Pro Arg 35 40 45
Ser Ser Val Ser Ser Glu Thr Leu Ser Leu Ala Asp Arg Glu Ala Ser 50
55 60 Phe Thr Leu Asn
Leu Phe Pro Asp Gly Tyr Ser Ile Gly Lys Pro Ser 65 70
75 80 Glu Asn Glu Ala Ala Asn Gln Ser Lys
Tyr Gln Asp Phe Pro Lys Leu 85 90
95 Leu His Pro Tyr Asp Arg Ser Ser Glu Ser Leu Phe Leu Ala
Ile Glu 100 105 110
Ser Gly His Leu Pro Gly Asp Ile Leu Asp Asp Ile Pro Ala Lys Tyr
115 120 125 Val Asp Gly Ala
Leu Ile Cys Glu Val His Asp Tyr Arg Arg Cys Ser 130
135 140 Ser Glu Lys Gly Gly Ser Val Ser
Ala Glu Ser Ser Pro Thr Val Ser 145 150
155 160 Lys Val Cys Leu Lys Met Ser Leu Glu Asn Ile Val
Lys Asp Ile Pro 165 170
175 Ser Ile Thr Asp Lys Ser Trp Thr Tyr Gly Asp Leu Met Glu Val Glu
180 185 190 Ser Lys Ile
Leu Lys Ala Leu Gln Pro Lys Leu His Leu Asp Pro Thr 195
200 205 Pro Lys Leu Asp Arg Leu Cys Glu
Ser Pro Leu Pro Thr Lys Leu Asn 210 215
220 Leu Pro Arg Lys Arg Leu Lys Asn Met Pro Glu Phe Ala
Val Thr Ser 225 230 235
240 Thr Asn Lys Ile His Gly Lys Lys Val Cys Ile Asp Arg Val Gln Glu
245 250 255 Ser Ser Ile Asn
Arg Leu Gly Asp Val Gly Asn Thr Ala Ser Asn Ala 260
265 270 Ile Val Gln Gln Thr His Glu Asn Pro
Ala Met Gln Asn Leu Ser Pro 275 280
285 Asn Val Ala Met Ala Leu Arg Ser Lys Asn Phe Ile Pro Asp
Ser Ser 290 295 300
Ile Pro Asn Phe Pro Met Met Ser His Gln Ser Arg Tyr Ser Met Ala 305
310 315 320 Val Gly Thr Gln Arg
Ser Leu Gln Glu Gln Gly Pro Thr Pro Ser Ile 325
330 335 Asn Ser Leu Gly Ala Ser Pro Ala Thr Gln
Asp Val Met Ile Ser Tyr 340 345
350 Ala Glu Asn Ala Asn Ser Gly Ala Ser Leu Leu Gly Lys Arg Asp
Asn 355 360 365 Gln
Asp Gly Gln Ala Ser Pro Leu Ser Asn Ile Ala Lys Arg Met Arg 370
375 380 Pro Ala Ser Thr Val Leu
Asp Ala Met Gln His Gln Gln Ile Gly Ser 385 390
395 400 His Val Glu Ala Leu Gln Gly Ser Asp Met Asn
Trp Gln Asn Thr Leu 405 410
415 Gln Gln Gln Ala Met Ala Arg Ile Gln Tyr Ala Ser Gly Gly Ile Gln
420 425 430 Lys Phe
Pro Gln Gln Ala Phe Glu Gly Gly Ala Asn Gln Glu Thr Gly 435
440 445 Ala Ile Pro Phe Ala Ser Ser
Gln Gln Gln Gly Met Arg Leu Val Ala 450 455
460 Lys Glu Glu Gln Phe Glu Met Glu Lys Leu Asp Gly
Ala Glu Ile Asn 465 470 475
480 Arg Asn Lys Ser Glu Met Glu Met Glu Met Asn Asn Leu Asp Pro Gln
485 490 495 Gln Leu Arg
Ile Gln Gln Arg Leu Ser Gln His Ala Phe Met Arg Ser 500
505 510 Asn Phe Pro Gln Ala Ala Trp Asn
Ser Leu Gly Gln Pro Met Glu Lys 515 520
525 Glu Thr Lys Lys Glu Asp Gln Leu Gln Lys Arg Lys Ser
Val Gln Ser 530 535 540
Pro Arg Leu Ser Thr Gly Ala Leu Pro His Ser Pro Leu Ser Ser Lys 545
550 555 560 Ser Gly Glu Phe
Ser Asn Gly Ala Val Gly Pro Ser Phe Gly Gln Ser 565
570 575 Ala Met Ala Ala Val Pro Gly Thr Ser
Gln Lys Asp Lys Thr Ala Met 580 585
590 Val Ser Val Pro Ala Thr Val Gly Thr Pro Ser Asn Asp Ser
Thr Gln 595 600 605
Arg Gln His Ala Gln Leu Ala Ala Lys Arg Arg Ser Asn Ser Leu Pro 610
615 620 Lys Thr Pro Ala Met
Asn Gly Val Gly Ser Pro Ala Ser Val Gly Thr 625 630
635 640 Thr Ser Val Pro Leu Asn Ala Asn Ser Pro
Ser Val Val Thr Ser Gly 645 650
655 Leu Val Asp Gln Asn Leu Gln Asn Met Leu Glu Arg Phe Ser Lys
Ile 660 665 670 Glu
Met Val Thr Met Arg His Gln Leu Asn Phe Lys Lys Asn Lys Val 675
680 685 Asp Asp Tyr Pro Ile Lys
Lys Gln Asn Pro Tyr Ala Gln Asn Asn Leu 690 695
700 Ala Ala Leu Leu Ala Asn Ala Thr Asn Asn Glu
Gly Leu Pro Glu Glu 705 710 715
720 Ser Ile Ser Leu Ser Lys Ser Leu Ile Gly Gly Ser Met Asn Ala Cys
725 730 735 Lys Met
Arg Ile Leu Thr Phe Cys Val Pro Glu Arg Val Val Gln Gly 740
745 750 Ser Val Val Thr Ile Ile Pro
Arg Met Arg Thr Arg Met Ile Ile Phe 755 760
765 Glu Lys Ser Asp Gly Thr Val Ala Met His Cys Gly
Glu Ile Glu Glu 770 775 780
Val Asp Tyr Val Ala Ala Glu Asp His Leu Leu Thr Leu Pro Asn Thr 785
790 795 800 His Ser Ala
Asp Leu Leu Val Gln Gln Phe Cys Ser Leu Met Val Arg 805
810 815 Glu Gly Phe Val Lys Glu Asp Asp
Arg Ile Gln Leu Lys Pro Asn Arg 820 825
830 Val Asn Leu Pro Leu Gly Asn Gln Ser Thr Thr Pro Asn
Asn Ala Val 835 840 845
Val Glu Met Gln Gln Tyr Gly Glu Ala Ile Pro Gly Gln Ser Ser Asn 850
855 860 Glu Val Ala Lys
Pro Thr Ser Gly Ser Asn Ala Pro Val Asn Leu Ser 865 870
875 880 Gln Asn Leu Val Thr Asn Pro Arg Met
Leu Pro Pro Gly Asn Pro Gln 885 890
895 Ala Leu Gln Met Ser Gln Gly Leu Leu Ser Gly Val Ser Met
Ala Ser 900 905 910
Arg Pro Gln Gln Met Asp Ser Gln Gln Ala Ile Gln Gln Gln Gln Gln
915 920 925 Gln Gln Gln Gln
Gln Gln Gln Gln Gln Gln Leu Gln Gln Asn Gln His 930
935 940 Thr Leu Ile Gln Gln Gln Asn Pro
Gln Phe Gln Arg Ser Pro Met Met 945 950
955 960 Leu Gly Thr Asn Gln Leu Ser His Leu Asn Pro Val
Gly Gln Asn Ser 965 970
975 Asn Met Pro Leu Gly Asn His Met Leu Asn Arg Pro Ser Ala Leu Gln
980 985 990 Leu Gln Met
Phe Gln Gln Gln Gln Gln Gln Gln Gln Gln Gln Gln Gln 995
1000 1005 Gln Pro Gln Met Gln Arg
Lys Met Met Met Gly Leu Gly Gln Ala 1010 1015
1020 Val Gly Met Gly Asn Leu Arg Asn Asn Leu Val
Gly Leu Ala Pro 1025 1030 1035
Met Gly Asn Pro Met Gly Met Gly Gly Val Arg Gly Ile Gly Gly
1040 1045 1050 Ser Gly Ile
Ser Ala Pro Met Thr Ser Ile Ala Gly Met Gly Asn 1055
1060 1065 Met Gly Gln Asn Pro Met Asn Leu
Ser Gln Thr Ser Asn Ile Thr 1070 1075
1080 Asn Ser Ile Ser Gln Gln Phe Arg Ser Gly Ser Ile Asn
Ala Ala 1085 1090 1095
Ala Ser Ala Asp Leu Leu Ser Lys Leu Arg Leu Val His Gln Asn 1100
1105 1110 Arg Gln Gly Met Leu
Gly Ser Ser Gln Ser Asn Ile Ala Ser Ile 1115 1120
1125 Ser Gly Ala Arg Gln Ile His Pro Gly Gly
Thr Pro Ser Leu Ser 1130 1135 1140
Met Leu Gly Arg Ala Asn Thr Met Gln Arg Pro Ile Gly Pro Met
1145 1150 1155 Gly Pro
Pro Lys Ile Met Ala Gly Met Asn Leu Tyr Met Ser Gln 1160
1165 1170 Gln Gln Gln Gln Gln His Gln
Gln Pro Gln Pro Gln Gln Gln Gln 1175 1180
1185 Gln Gln His Gln Gln Gln Leu Gln Leu Gln Gln His
Met Gln Gln 1190 1195 1200
Gln Leu Gln Gln Gln Gln Gln Gln Glu Thr Thr Ser Gln Leu Gln 1205
1210 1215 Ala Val Val Ser Pro
Pro Gln Val Gly Ser Pro Ser Met Gly Ile 1220 1225
1230 Pro Pro Met Asn Gln Gln Ala Gln Gln Gln
Ala Ser Pro Gln Gln 1235 1240 1245
Met Ser Gln Arg Thr Pro Met Ser Pro Gln Met Ser Ser Gly Ala
1250 1255 1260 Ile His
Ala Met Asn Ala Gly Asn Pro Glu Ala Cys Pro Ala Ser 1265
1270 1275 Pro Gln Leu Ser Ser Gln Thr
Leu Gly Ser Val Ser Ser Ile Thr 1280 1285
1290 Asn Ser Pro Met Asp Met Gln Gly Val Asn Lys Ser
Asn Ser Asn 1295 1300 1305
Ala Gln 1310 214125DNARicinus communis 21atgggggttt cttttaaggt
atcaaaaact ggtactaggt ttcgtccaaa gcctattact 60ttaccagagc ctgcgcttga
tgaggcctca gagaacacta aggaaagctc tttaattggc 120tcaaagaatg aatcctcaaa
gagaaagctc gaggttgaca ttggtgagga tctctctggt 180gcttcaagtt catccatcac
tgagcacgaa gtttccttca cattgaacct ctactcagat 240ggatattcta ttgggaagcc
ttctgagaat gaggctgcaa atcaggctct actccaagat 300gtttcaaagt tgttgcatcc
atatgataag acatctgaaa ctctcttttt ggcaattgag 360tctggccggt tgcctggaga
tattctggat gatataccat gcaagtatgt caacggcaca 420ctcatgtgtg aggtgcggga
ttatcgaaaa tgtgttcctg agcaaggttc tagtattcca 480tctatgaatg gactccctat
tgtaaataga gtacgtctca ggatgtcttt ggagaatgta 540gtgaaggata ttccattact
ctcagataat tcttggactt atggtgattt gatggaagtg 600gaatcccgga tattgaaagc
cttgcagcca caactttgtc tagatcctac tccgaaattg 660gataggctct gtaatgaccc
agctcctaca aagctgagtt taggtatgag cagtttgcgg 720agaaaaagat taaggcagat
gcctgaagtt actgtcacat ctaatagcag aatccatggc 780aagaaagttt gcatagatcg
agtgccagaa agctcaaatg gcaggttagg agattcagca 840atcatttccg ggaatatgtt
gccacaaagt ggtcaggaga atctgactac tcaaaacctt 900ggtccaagca acctgttagc
tctaggagca agaagcttta tatcagatgg caatgttcca 960gcaatgcctt tggtagcaca
gcaatcaagg tatcaaatgg gggtgagtac cccaagaagt 1020atgcaggatc aagggtcagg
gtctcttgtt aatatttcag gagcttcccc tgccacgcag 1080gatatgatga ttgcatatgg
tgacactatg aatcctgggg cttcacttca tagtaaaaag 1140gagaatcaag atgggcaaat
gtctccctta tccagtttga ataagagagc taggcttacc 1200tcagtggctc ctgatgggat
tcatcagcag cagatagggc caaacatgga tagtgttaat 1260gcatcagatt tgaactggaa
aaattcttta ctacatcaac aggcaatggc aagaggaatt 1320cactatgcta atgcaggtat
tcagaagtat ccccagcaga tgtttgaagg ggttatgaat 1380caaaatgctg tgccagcatc
attttctgct gcacagccag gtttaagatt tggtccgaag 1440gaagaacagt ttgaaacaga
aaagctggat ggctcagaga tcagtcaggg taaaaatgat 1500atccagatct tggagacaga
aacaggccat cttgaccctc aagtgtcacg gctacaacaa 1560agattaccac cacatcacat
gagatctaat ttccctcagg cagcatggaa caatcttagc 1620caagattcaa ggaaggatga
tcaattccag aagaggaaaa ctgtgcaaag tcctcggtta 1680tcagctgggg ctttgcctca
atcaccattg tcatctaaat ctggagaatt ttctagtggc 1740tctgctgggg cccactttgg
agctgttgca gcaactactg ctcttggatc atctcaaaag 1800gagaagtctg ctgtcacttc
ggttcctgct gttggcggca ccccatcctt gacttccagt 1860gctaatgact ccttgcaacg
gcaacaccag gcccaagttg ctgcaaaacg gagatccaac 1920tcccttccaa aaactccagt
aatgagtggg gttggctccc ctgcaagtgt tagtaatatg 1980agtgttccat taaatgcaaa
tagtccttct gttggaaccc cgactatggt tgatcaaacc 2040atgcttgaaa ggttctcaaa
gattgagatg gtgactgtga ggcatcaact caactgcaag 2100aaaaataaag ctgatgacta
ccctgtgagg aaatccaaca catattcacc tcaaaatctt 2160atggtttgtc tctcaaattt
acccaacact gaggattcaa aagatgatgc tagtgcaggg 2220caattatcga agtcaattgt
aggtggcagc atgaatgtct gcaagatgag aattataaac 2280tttatgctgg cagatcgagt
tgttcaaggg aatgttgttt cttttgttcc tcggagacgg 2340actagaatga tcatgtcaga
gaagccaaat gatggtacag tagcaatgca atatggagaa 2400gcagaggatg gtgattttct
atctgtagag gagtatcttc ctacattgcc caatactcat 2460tttgcggatt tgcttgcggc
acaattttgt tcactgatga ttcgtgaagg atatcttgtg 2520gaagataata ttcaaccaaa
gcctacccgc atgaatgttt cctcaagtag ccaaccaaat 2580gctgccggaa tcgcacctaa
taattcagca gctgaggtgc agcagcaata caatgaggca 2640gtctcaggtc aggcatccaa
tgaagtaaag ccaaatttta gtggtaatgc acccatgaat 2700ccatcccaga atctattagc
aagtgccagg atgctgcctc ctggaaaccc tcaagcctta 2760ccgatgtctc aaggtctctt
gtctgcagtt tcaatgccag ctagaccaca actagaccca 2820caaccacaac tgcagcagca
gcctcaacaa ccaccacaaa tgcagcagca gcaaccacca 2880caacagcaac aaaatcaaca
ttccttaatt caacagcaat cacagttcca gaggccacca 2940atggtgcttc catctctctc
tcacttgaat acacttgggc agaattcaaa catgcagctg 3000gggagtcaca tggtcaacaa
gccttcgcat ctccagcttc agctgttaca gcagcaacag 3060cagcagcagc agcttcaacc
acagcagcaa caacagcagc agcagcaaca gcagcagcag 3120cagcaacagc agcagccaca
gatgcaacaa aggaaaatga tgatgggact tgggacagca 3180atgggcatgg gaaatatggg
caacaatatg gttggcctag gaggcctgag taatgccatg 3240ggcattggag gtgcaagggc
aatgggaggg cctggaatct cgggatcaat ggcacctata 3300tccggcatga acaatgtggg
tcagaaccaa atcaatttga gccaaactac aaatcttcca 3360aacgttataa gtcagcattt
ccgcgcagga caagtaactc cacaacaggc tgcttaccta 3420tcaaaactta ggatggcgca
aaacagaaca agtatgctag gggcccctca gtcaggcata 3480gctgggatgt caggagccag
acagatgcac ccaggttctg caggtctttc aatgctgggc 3540cagtctctga accgtgctaa
catgaaccca atgcaacgga gtgcaatggg gcctatgggt 3600ccaccgaaat tgatggcagg
gatgaatctc tatatgaacc aacagcaaca gcagcagcag 3660caactgcaat tacaacagca
gcaacaattc cagcagcaac agcaacagca acagcagcag 3720cagcagcagc aacagcaatt
acagcagcta cagcagcagc aacagcaatt acagcagcag 3780cagcaacaac agatgcagca
acagcagcag caagatccat cctcatccct acaggctgtt 3840gtttcgtctt cacaagtagg
ctcaccatca accatgggaa ttccgcaact gaaccaacag 3900caacaacccc aacaacagcc
tagtccacaa caaatgagcc aacggacgcc aatgagccca 3960caaattagtt caggagcaat
ccatgcaatg agtgctggta atccagaggc ttgtcctgcc 4020agtccacagt tgagctcaca
gactcttggc tcagtaggaa gcatcacaaa ctctccgatg 4080gagctccaag gtgtaaacaa
aagcaactct gttaataatg catag 4125221374PRTRicinus
communis 22Met Gly Val Ser Phe Lys Val Ser Lys Thr Gly Thr Arg Phe Arg
Pro 1 5 10 15 Lys
Pro Ile Thr Leu Pro Glu Pro Ala Leu Asp Glu Ala Ser Glu Asn
20 25 30 Thr Lys Glu Ser Ser
Leu Ile Gly Ser Lys Asn Glu Ser Ser Lys Arg 35
40 45 Lys Leu Glu Val Asp Ile Gly Glu Asp
Leu Ser Gly Ala Ser Ser Ser 50 55
60 Ser Ile Thr Glu His Glu Val Ser Phe Thr Leu Asn Leu
Tyr Ser Asp 65 70 75
80 Gly Tyr Ser Ile Gly Lys Pro Ser Glu Asn Glu Ala Ala Asn Gln Ala
85 90 95 Leu Leu Gln Asp
Val Ser Lys Leu Leu His Pro Tyr Asp Lys Thr Ser 100
105 110 Glu Thr Leu Phe Leu Ala Ile Glu Ser
Gly Arg Leu Pro Gly Asp Ile 115 120
125 Leu Asp Asp Ile Pro Cys Lys Tyr Val Asn Gly Thr Leu Met
Cys Glu 130 135 140
Val Arg Asp Tyr Arg Lys Cys Val Pro Glu Gln Gly Ser Ser Ile Pro 145
150 155 160 Ser Met Asn Gly Leu
Pro Ile Val Asn Arg Val Arg Leu Arg Met Ser 165
170 175 Leu Glu Asn Val Val Lys Asp Ile Pro Leu
Leu Ser Asp Asn Ser Trp 180 185
190 Thr Tyr Gly Asp Leu Met Glu Val Glu Ser Arg Ile Leu Lys Ala
Leu 195 200 205 Gln
Pro Gln Leu Cys Leu Asp Pro Thr Pro Lys Leu Asp Arg Leu Cys 210
215 220 Asn Asp Pro Ala Pro Thr
Lys Leu Ser Leu Gly Met Ser Ser Leu Arg 225 230
235 240 Arg Lys Arg Leu Arg Gln Met Pro Glu Val Thr
Val Thr Ser Asn Ser 245 250
255 Arg Ile His Gly Lys Lys Val Cys Ile Asp Arg Val Pro Glu Ser Ser
260 265 270 Asn Gly
Arg Leu Gly Asp Ser Ala Ile Ile Ser Gly Asn Met Leu Pro 275
280 285 Gln Ser Gly Gln Glu Asn Leu
Thr Thr Gln Asn Leu Gly Pro Ser Asn 290 295
300 Leu Leu Ala Leu Gly Ala Arg Ser Phe Ile Ser Asp
Gly Asn Val Pro 305 310 315
320 Ala Met Pro Leu Val Ala Gln Gln Ser Arg Tyr Gln Met Gly Val Ser
325 330 335 Thr Pro Arg
Ser Met Gln Asp Gln Gly Ser Gly Ser Leu Val Asn Ile 340
345 350 Ser Gly Ala Ser Pro Ala Thr Gln
Asp Met Met Ile Ala Tyr Gly Asp 355 360
365 Thr Met Asn Pro Gly Ala Ser Leu His Ser Lys Lys Glu
Asn Gln Asp 370 375 380
Gly Gln Met Ser Pro Leu Ser Ser Leu Asn Lys Arg Ala Arg Leu Thr 385
390 395 400 Ser Val Ala Pro
Asp Gly Ile His Gln Gln Gln Ile Gly Pro Asn Met 405
410 415 Asp Ser Val Asn Ala Ser Asp Leu Asn
Trp Lys Asn Ser Leu Leu His 420 425
430 Gln Gln Ala Met Ala Arg Gly Ile His Tyr Ala Asn Ala Gly
Ile Gln 435 440 445
Lys Tyr Pro Gln Gln Met Phe Glu Gly Val Met Asn Gln Asn Ala Val 450
455 460 Pro Ala Ser Phe Ser
Ala Ala Gln Pro Gly Leu Arg Phe Gly Pro Lys 465 470
475 480 Glu Glu Gln Phe Glu Thr Glu Lys Leu Asp
Gly Ser Glu Ile Ser Gln 485 490
495 Gly Lys Asn Asp Ile Gln Ile Leu Glu Thr Glu Thr Gly His Leu
Asp 500 505 510 Pro
Gln Val Ser Arg Leu Gln Gln Arg Leu Pro Pro His His Met Arg 515
520 525 Ser Asn Phe Pro Gln Ala
Ala Trp Asn Asn Leu Ser Gln Asp Ser Arg 530 535
540 Lys Asp Asp Gln Phe Gln Lys Arg Lys Thr Val
Gln Ser Pro Arg Leu 545 550 555
560 Ser Ala Gly Ala Leu Pro Gln Ser Pro Leu Ser Ser Lys Ser Gly Glu
565 570 575 Phe Ser
Ser Gly Ser Ala Gly Ala His Phe Gly Ala Val Ala Ala Thr 580
585 590 Thr Ala Leu Gly Ser Ser Gln
Lys Glu Lys Ser Ala Val Thr Ser Val 595 600
605 Pro Ala Val Gly Gly Thr Pro Ser Leu Thr Ser Ser
Ala Asn Asp Ser 610 615 620
Leu Gln Arg Gln His Gln Ala Gln Val Ala Ala Lys Arg Arg Ser Asn 625
630 635 640 Ser Leu Pro
Lys Thr Pro Val Met Ser Gly Val Gly Ser Pro Ala Ser 645
650 655 Val Ser Asn Met Ser Val Pro Leu
Asn Ala Asn Ser Pro Ser Val Gly 660 665
670 Thr Pro Thr Met Val Asp Gln Thr Met Leu Glu Arg Phe
Ser Lys Ile 675 680 685
Glu Met Val Thr Val Arg His Gln Leu Asn Cys Lys Lys Asn Lys Ala 690
695 700 Asp Asp Tyr Pro
Val Arg Lys Ser Asn Thr Tyr Ser Pro Gln Asn Leu 705 710
715 720 Met Val Cys Leu Ser Asn Leu Pro Asn
Thr Glu Asp Ser Lys Asp Asp 725 730
735 Ala Ser Ala Gly Gln Leu Ser Lys Ser Ile Val Gly Gly Ser
Met Asn 740 745 750
Val Cys Lys Met Arg Ile Ile Asn Phe Met Leu Ala Asp Arg Val Val
755 760 765 Gln Gly Asn Val
Val Ser Phe Val Pro Arg Arg Arg Thr Arg Met Ile 770
775 780 Met Ser Glu Lys Pro Asn Asp Gly
Thr Val Ala Met Gln Tyr Gly Glu 785 790
795 800 Ala Glu Asp Gly Asp Phe Leu Ser Val Glu Glu Tyr
Leu Pro Thr Leu 805 810
815 Pro Asn Thr His Phe Ala Asp Leu Leu Ala Ala Gln Phe Cys Ser Leu
820 825 830 Met Ile Arg
Glu Gly Tyr Leu Val Glu Asp Asn Ile Gln Pro Lys Pro 835
840 845 Thr Arg Met Asn Val Ser Ser Ser
Ser Gln Pro Asn Ala Ala Gly Ile 850 855
860 Ala Pro Asn Asn Ser Ala Ala Glu Val Gln Gln Gln Tyr
Asn Glu Ala 865 870 875
880 Val Ser Gly Gln Ala Ser Asn Glu Val Lys Pro Asn Phe Ser Gly Asn
885 890 895 Ala Pro Met Asn
Pro Ser Gln Asn Leu Leu Ala Ser Ala Arg Met Leu 900
905 910 Pro Pro Gly Asn Pro Gln Ala Leu Pro
Met Ser Gln Gly Leu Leu Ser 915 920
925 Ala Val Ser Met Pro Ala Arg Pro Gln Leu Asp Pro Gln Pro
Gln Leu 930 935 940
Gln Gln Gln Pro Gln Gln Pro Pro Gln Met Gln Gln Gln Gln Pro Pro 945
950 955 960 Gln Gln Gln Gln Asn
Gln His Ser Leu Ile Gln Gln Gln Ser Gln Phe 965
970 975 Gln Arg Pro Pro Met Val Leu Pro Ser Leu
Ser His Leu Asn Thr Leu 980 985
990 Gly Gln Asn Ser Asn Met Gln Leu Gly Ser His Met Val Asn
Lys Pro 995 1000 1005
Ser His Leu Gln Leu Gln Leu Leu Gln Gln Gln Gln Gln Gln Gln 1010
1015 1020 Gln Leu Gln Pro Gln
Gln Gln Gln Gln Gln Gln Gln Gln Gln Gln 1025 1030
1035 Gln Gln Gln Gln Gln Gln Gln Pro Gln Met
Gln Gln Arg Lys Met 1040 1045 1050
Met Met Gly Leu Gly Thr Ala Met Gly Met Gly Asn Met Gly Asn
1055 1060 1065 Asn Met
Val Gly Leu Gly Gly Leu Ser Asn Ala Met Gly Ile Gly 1070
1075 1080 Gly Ala Arg Ala Met Gly Gly
Pro Gly Ile Ser Gly Ser Met Ala 1085 1090
1095 Pro Ile Ser Gly Met Asn Asn Val Gly Gln Asn Gln
Ile Asn Leu 1100 1105 1110
Ser Gln Thr Thr Asn Leu Pro Asn Val Ile Ser Gln His Phe Arg 1115
1120 1125 Ala Gly Gln Val Thr
Pro Gln Gln Ala Ala Tyr Leu Ser Lys Leu 1130 1135
1140 Arg Met Ala Gln Asn Arg Thr Ser Met Leu
Gly Ala Pro Gln Ser 1145 1150 1155
Gly Ile Ala Gly Met Ser Gly Ala Arg Gln Met His Pro Gly Ser
1160 1165 1170 Ala Gly
Leu Ser Met Leu Gly Gln Ser Leu Asn Arg Ala Asn Met 1175
1180 1185 Asn Pro Met Gln Arg Ser Ala
Met Gly Pro Met Gly Pro Pro Lys 1190 1195
1200 Leu Met Ala Gly Met Asn Leu Tyr Met Asn Gln Gln
Gln Gln Gln 1205 1210 1215
Gln Gln Gln Leu Gln Leu Gln Gln Gln Gln Gln Phe Gln Gln Gln 1220
1225 1230 Gln Gln Gln Gln Gln
Gln Gln Gln Gln Gln Gln Gln Gln Leu Gln 1235 1240
1245 Gln Leu Gln Gln Gln Gln Gln Gln Leu Gln
Gln Gln Gln Gln Gln 1250 1255 1260
Gln Met Gln Gln Gln Gln Gln Gln Asp Pro Ser Ser Ser Leu Gln
1265 1270 1275 Ala Val
Val Ser Ser Ser Gln Val Gly Ser Pro Ser Thr Met Gly 1280
1285 1290 Ile Pro Gln Leu Asn Gln Gln
Gln Gln Pro Gln Gln Gln Pro Ser 1295 1300
1305 Pro Gln Gln Met Ser Gln Arg Thr Pro Met Ser Pro
Gln Ile Ser 1310 1315 1320
Ser Gly Ala Ile His Ala Met Ser Ala Gly Asn Pro Glu Ala Cys 1325
1330 1335 Pro Ala Ser Pro Gln
Leu Ser Ser Gln Thr Leu Gly Ser Val Gly 1340 1345
1350 Ser Ile Thr Asn Ser Pro Met Glu Leu Gln
Gly Val Asn Lys Ser 1355 1360 1365
Asn Ser Val Asn Asn Ala 1370
23784DNABrassica oleracea 23gcagtatgaa ccccggtcca tcttttcata gaaagagaga
aagccaagaa gtacaactgt 60cttctatgcc tggtttgaat aagcgaacaa gggtttctca
catgggtcct gatatggttc 120cacagcaaca gttagggcaa cgcatggatg gtcctcatgg
aaccgataca aattggaaaa 180atgcgcttct acaacaagac atgctccgta gaagtattca
atatccaaat gcaaatatgc 240agaggttttc accccagcaa attggaggag ctatgaatca
ggaagctggt cccatgcagt 300ttccagcttc acaacagggg ccaatgcgtt acacttcgaa
agaggagcca tttgagacgg 360gtaaaattga tggtaatatc agaaacaata tgccaggagt
gggaagcgat gcaaatgatt 420tggatccgcg tattcagcct aggatgcccc ataatgtatt
taacagatca aatttccctc 480agacatcctg gaatgctaat ccaggccagc agattgaaaa
agacctcaaa aaagaagaac 540aattcagtag aagggtatcg tctcaaagcc ctcgtttatc
agcaggtgct cctccacagt 600ccccgctttc atcgaagtct ggagagtttt ctggtggttc
aatggggacc cattatggag 660cagttgcggc agctcaaaag gacaaagctg ttacttcaat
tcctatcggt gctgctcagt 720ccgtgggttc tagtggtaat gatgctatgc agcaaaaggc
acaccaaatg gctccaaaac 780gtag
784241072DNABrassica rapa 24gatcgccttg ctgaaagttc
atagcgagga agtatgcagg gacatttgtt gatgcatcaa 60acccatcaca accaggcttt
tcaaaatgtt ggtacgaaca tgccggtggg attaataaat 120caggccttgc aagatgcgcc
aacttcccca ctgcctttgg tacaacctca gcaacaaatg 180tacctgggaa ctggaaatat
tagaaacatg caggatcaat gatctgaatg ctgtcagtgt 240ctctggagct tcgcctggag
gactagatgc aatgttgcct tatgcctctg acagtatgaa 300ccccggtcca tcttttcata
gaaagagaga cagccaagaa gtacaactgt cttctatgcc 360tggtttgaat aagcgaacaa
gggtttctca catgggtcct gatatggttc cacagcaaca 420gttagggcaa cgcatggatg
gtcctcatgg aaccgataca aattggaaaa atgcgcttct 480acaacaagac atgctccgta
gaagtattca atatccaaat gcaaatatgc agaggttttc 540accccagcaa attggaggag
ctatgaatca ggaagctggt cccatgcagt ttccagcttc 600acaacagggg ccaatgcgtt
acacttcgaa agaggagcca tttgagacgg gtaaaattga 660tggtaatatc agaaacaata
tgccaggagt gggaagcgat gcaaatgatt tggatccgcg 720tattcagcct aggatgcccc
ataatgtatt taacagatca aatttccctc agacatcctg 780gaatgctaat ccaggccagc
agattgaaaa agacctcaaa aaagaagaac aattcagtag 840aagggtatcg tctcaaagcc
ctcgtttatc agcaggtgct cctccacagt ccccgctttc 900atcgaagtct ggagagtttt
ctggtggttc aatggggacc cattatggag cagttgcggc 960agctcaaaag gacaaagctg
ttacttcaat tcctatcggt gctgctcagt ccgtgggttc 1020tagtggtaat gatgctatgc
agcaaaaggc acaccaaatg gctccaaaac gt 1072251336DNABrassica napus
25agagctctgg catggcgctg ggtggtcaga tgaccaacaa ccattcgcct catcaactgc
60agatgttgca gcaccacgcg gcgattcaga ggaagatgat gatggggcaa caggggtcag
120gtgtagccat gaatatggga atgggaagca tgggcaacag tattgctgcg cttggggctt
180ttggcaacca aatgaatatg gcgggaagag ggcttggagg aaccggaatc acatcgtcaa
240tgtctcttcc tggcatcaat aacatggggc agaacccaat gaatcatcca gcgtcaaatt
300tgaatgttat aagccagcaa ctccgatctg gtgctttaac accacaacag agtgccgctg
360tgtttacaaa tcttaggttg gcgaaccgag gaggtggaat gggtgctccc caagccggga
420tgagtggcgt gtcaggtgcc aggcagatgc accccagctc tgctggtcta tctatgatgg
480atccgaatac attaaaccga gctaacctgc agcgagctat gggtaaacat gggtccacct
540aagctgatgc ctggaatgaa tccttacatg aatcaacagc aactccagca gcagcaaccc
600caacagcaac agttgcagca tcagcaacag ctacagcaac ctatgtctca gcagcaagct
660cagtctcagc agctacaaca acttgagctg cctcagcaac aacagcaaca gcagcaacag
720gcaacagcct cgcctcttca gtctgtgcta tcaccacccc aagtaagttc gccatcagct
780ggaattacac agcagcagct gcaacagtcc agtccccagc aaatgagcca gagaactccg
840atgagtcccc agcaaatgaa ccaaagaact ccaatgagtc cgcaacaaat gagtcaaaga
900acccctatga gtcctcagat aagctcgggt acgatgcacc ccatgagcac aagcaacctg
960gaggcttgtc cagcaagtcc acagctaagt tctcagacac atggatctgt tggtagcatc
1020gccaattccc caatggagct tcaaggtccc aagaacaact ctgctagtac taataatccc
1080taatcaagaa acataatgat tagtttaaga aaagcccttt tatcttcaaa acatgggttg
1140taattgaacc tggcaaagca tttgaagttt tttgtgtcac agttttaagt tttgcgtgta
1200cataaattaa ttaagcttgt gcttgtagag aaagtaaaca atcctttgtg ctttgcaagt
1260gaaaatgcta gccgctatta ttaggttgtt gatatgtaat gctatctaga gattttgtga
1320tgctagattg taaact
1336262802DNAGlycine maxmisc_feature(359)..(359)where n is A, G, C or T
26acgagggaag aacagtttga aatggaaaaa ttagatggtg cagaaataaa ctgcaataaa
60agtgacatgg aaatggaaat gaacaattta gatccacaac aattgcggct tcagcaacga
120ttgccacagc atgcattcat gaggcctaat ttccctcagg cagcctggaa cagtttgggt
180cagcatatgg gcaaagaaac aaaaaaagaa gaccagcttc agaaaaggaa atcagtacag
240agtcctcgct tatcctccgc ggcattacct cactccccat tgtcttcgaa atcaggtgaa
300ttttccaatg gtgcagttgg accaagtttt ggaccatctg caatggctgc tgcacctgng
360acatcacaaa aagacaaggc agcaatggcc tcagttcctg ctactgttgg aactccatct
420aatgattcta cacaaagaca acatgcacaa ctagctgcaa aacggagatc taattctctt
480cccaagaccc cagcaatgaa tggagttggt tctcctgtta gtgttggtac aaccagtgtc
540ccattgaatg caaatagtcc ctcagttgtg acctcgggtt ttgttgatca aaatcttcaa
600aatatgcttg aaaggttctc aaaaattgaa atggtgacaa tgaggcatca acttaacttt
660aagaagaaca aggttgatga ctatcccatt aagaagcaga atccatatgt accaaataat
720ctatcagcac ttcttgctaa tgctaatgca actaataatg agggattgcc agaggagtca
780atttctattt caaagtcgct tataggtggg agtatgaatg cgtgcaaaat gagaatctta
840aatttttgtg tgcctgagcg tgtagttcaa ggaagtattg ttactataat tccgaggatg
900cgaactagga tgattatgtt tgaaaaatct gatggtactg tggctatgca ttgtggggag
960attgaagaag ttgattacgt agctgcagag gatcatctcc tcacattacc caatactcat
1020tctgcagatt tgcttgtaca acagttctgt tcactgatgg tacgcgaagg atttgtgaaa
1080gaagatgacc gaatccaact taaaccaaac cgggtgaacc ttccattggg caatcaatct
1140actaccccta ataatgctgt agttgaaatg caacaatatg gagaagccat tcctggtcaa
1200tcatccaatg aagttgcaaa accaactagt ggcagtaatg cacctgtaaa cctctctcag
1260aatcttgtaa caaatccaag gatgctgcca cctggaaacc cccaagcctt acagatgtcc
1320caaggacttc tctctggtgt ttcgatggct tcaagaccac aacaaatgga ctcacaacaa
1380gccatanaaa tcaacacaca ctcattcaac agcagaatcc ccagttccag aggtctccta
1440tgatgcttgg gacaaatcag ctttcacact taaatccagt tggacaaaac tccaacatgc
1500cattaggtaa tcacatgctc aacaagcctt cagctctcca gatgcagatg ttccaacaac
1560agcaacagca gcctcaaatg caaaggaaaa tgatgatggg acttggacaa gccgtgggaa
1620tgggtaactt gagaaataac ctagttgggc ttgcaccaat gggcaaccct atgggaatgg
1680gaggtgcgag gggaatagga ggaagtggaa tctcatcacc aatgacatct attgctggca
1740tgggaaatat gggtcagagc ccaatgaatc ttagccagac ttcaaatatt actaattcca
1800taagccaaca gtttaggtcc ggatcattaa atgcagcagc atctgctgac cttatatcaa
1860ggcttagatt ggtacattcg aatcgtcaaa gcatgctagg gtcccctcag tctaacctag
1920ctagcatctc aggggccaga caaatacacc ctggtgctac tcctagtctt tcaatgttgg
1980gcagggctaa tacaatgcag cgaccaattg gacctatggg tccaccaaag atgatggcag
2040ggatgaatct ttatatgagt cagcagcagc aacatcaaca accccaacag cagcagcagc
2100aacaccaaca gcaattgcaa ctccaacagc atatgcagca gcaattacag cagcaacagc
2160aacaacaaga aacaacttca caattgcagt cagttgtttc acccccacag gtgggatcgc
2220catcaatggg cgtaccacca ttgaaccaac aaacgcagca gcaagccagc cctcagcaaa
2280tgagtcaacg aactccgatg agtccacaaa tgagctcagg tgcaattcat gccatgagtg
2340ctggtaatcc tgaagcttgt ccagccagtc cacagttgag ctctcagacc cttggctctg
2400ttagtagcat aacaaactcc cctatggaca tgcaaggtgt taacaagagc aactctaatg
2460cacaatgaag ctacaaagcc taaattgtcc aaatcagtgc ccctgtcacc taagttgttg
2520gaaactgttg aagcaaataa tgttgaatat tggtgcattg aatcatacca gaaaatgata
2580attatttact tatgaataaa caaagcatat tgaataaata tgctgctctt ttgtaactct
2640agggggaatc acatgcatta ttatgtcagt tgtgaatagt ttcttgtttt cttttgctct
2700cattaaacac atcagtgtaa cttttaggat atttaggcca agattaacat gtattagtct
2760aggtacttta tggagtgcag tagcaaactt atttttttgt aa
28022713PRTArtificial SequenceConserved sequence motifs 27Lys Xaa Leu His
Pro Tyr Asp Xaa Xaa Xaa Glu Xaa Leu 1 5
10 2816PRTArtificial SequenceConserved Domains 28Leu Gln Pro
Xaa Leu Xaa Leu Asp Pro Xaa Pro Xaa Leu Asp Arg Leu 1 5
10 15 2911PRTArtificial
SequenceConserved Domains 29Ser Pro Xaa Ser Ser Lys Ser Gly Glu Xaa Ser 1
5 10 3020PRTArtificial
SequenceConserved Domains 30Val Gly Ser Pro Xaa Ser Val Xaa Xaa Xaa Xaa
Xaa Xaa Xaa Asn Ala 1 5 10
15 Xaa Ser Pro Ser 20 3122PRTArtificial
SequenceConserved Domains 31Leu Pro Xaa Xaa Xaa Xaa Ala Asp Leu Xaa Xaa
Xaa Gln Xaa Xaa Xaa 1 5 10
15 Xaa Met Xaa Xaa Xaa Gly 20
3249PRTArtificial SequenceConserved Regions 32Met Ser Leu Glu Asn Ile Val
Lys Asp Ile Pro Ser Ile Ser Asp Asn 1 5
10 15 Ser Trp Thr Tyr Gly Asp Leu Met Glu Val Glu
Ser Lys Ile Leu Lys 20 25
30 Ala Leu Gln Pro Lys Leu His Leu Asp Pro Thr Pro Lys Leu Asp
Arg 35 40 45 Leu
3312PRTArtificial SequenceConserved Regions 33Ser Trp Thr Tyr Gly Asp Leu
Met Glu Val Glu Ser 1 5 10
3420PRTArtificial SequenceConserved Regions 34Ser Trp Thr Tyr Gly Asp Leu
Met Glu Val Glu Ser Lys Ile Leu Lys 1 5
10 15 Ala Leu Gln Pro 20
3513PRTArtificial SequenceConserved Regions 35Gly Lys Lys Val Cys Ile Asp
Arg Val Gln Glu Ser Ser 1 5 10
3623PRTArtificial SequenceConserved Regions 36Gln Ser Pro Arg Leu Ser
Ala Gly Ala Leu Pro Gln Ser Pro Leu Ser 1 5
10 15 Ser Lys Ser Gly Glu Phe Ser 20
3711PRTArtificial SequenceConserved Regions 37Ser Pro Leu Ser
Ser Lys Ser Gly Glu Phe Ser 1 5 10
3815PRTArtificial SequenceConserved Regions 38Ala Gln Leu Ala Ala Lys Arg
Arg Ser Asn Ser Leu Pro Lys Thr 1 5 10
15 3919PRTArtificial SequenceConserved Regions 39Val Gly
Ser Pro Val Ser Val Gly Thr Thr Ser Val Pro Leu Asn Ala 1 5
10 15 Asn Ser Pro
4018PRTArtificial SequenceConserved Regions 40Arg Phe Ser Lys Ile Glu Met
Val Thr Met Arg His Gln Leu Asn Phe 1 5
10 15 Lys Lys 4122PRTArtificial SequenceConserved
Regions 41Leu Pro Asn Thr His Ser Ala Asp Leu Leu Ala Gln Gln Phe Cys Ser
1 5 10 15 Leu Met
Val Arg Glu Gly 20 4215PRTArtificial
SequenceConserved Regions 42Gln Ala Leu Gln Met Ser Gln Gly Leu Leu Ser
Gly Val Ser Met 1 5 10
15 4353PRTArtificial SequenceConserved Regions 43Ser Pro Gln Gln Met Ser
Gln Arg Thr Pro Met Ser Pro Gln Ile Ser 1 5
10 15 Ser Gly Ala Ile His Ala Met Ser Ala Gly Asn
Pro Glu Ala Cys Pro 20 25
30 Ala Ser Pro Gln Leu Ser Ser Gln Thr Leu Gly Ser Val Ser Ser
Ile 35 40 45 Thr
Asn Ser Pro Met 50 4423PRTArtificial SequenceConserved
Regions 44Cys Pro Ala Ser Pro Gln Leu Ser Ser Gln Thr Leu Gly Ser Val Ser
1 5 10 15 Ser Ile
Thr Asn Ser Pro Met 20 45195PRTArtificial
SequenceConserved Regions 45His Glu Val Ser Phe Thr Phe Ser Leu Tyr Asp
Arg Gly Tyr Leu Ile 1 5 10
15 Ser Lys Ser Ala Ala Met Asp Pro Ser Gln Thr Ser Ile Gln Asp Gly
20 25 30 Lys Thr
Leu His Pro Tyr Asp Arg Ala Ser Glu Lys Leu Phe Ser Ala 35
40 45 Ile Glu Ala Gly Arg Leu Pro
Gly Asp Ile Leu Asp Glu Ile Pro Ser 50 55
60 Lys Tyr Tyr Asn Gly Ser Val Val Cys Glu Ile Arg
Asp Tyr Arg Lys 65 70 75
80 His Val Ser Asn Gln Ala Pro Ala Ser Ser Ala Glu Leu Gly Leu Pro
85 90 95 Ile Val Asn
Lys Val Arg Leu Arg Met Thr Phe Glu Asn Val Val Lys 100
105 110 Asp Ile Thr Leu Leu Ser Asp Asp
Ser Trp Ser Tyr Arg Asp Phe Val 115 120
125 Glu Ala Glu Ala Arg Ile Val Arg Ala Leu Gln Pro Glu
Leu Cys Leu 130 135 140
Asp Pro Thr Pro Lys Leu Asp Arg Leu Cys Gln Asp Pro Val Pro His 145
150 155 160 Lys Leu Ser Leu
Gly Ile Gly Lys Lys Arg Arg Leu Arg Gln Asn Pro 165
170 175 Glu Val Val Val Thr Ser Ser Asn Met
Ser His Gly Lys Lys Val Cys 180 185
190 Ile Asp Arg 195 4635PRTArtificial
SequenceConserved Regions 46Leu Cys Leu Asp Pro Thr Pro Lys Leu Asp Arg
Leu Cys Gln Asp Pro 1 5 10
15 Val Pro His Lys Leu Ser Leu Gly Ile Gly Lys Lys Arg Arg Leu Arg
20 25 30 Gln Asn
Pro 35 4712PRTArtificial SequenceConserved Regions 47Leu Cys Leu
Asp Pro Thr Pro Lys Leu Asp Arg Leu 1 5
10 4822PRTArtificial SequenceConserved Regions 48Gln Asp Pro Val
Pro His Lys Leu Ser Leu Gly Ile Gly Lys Lys Arg 1 5
10 15 Arg Leu Arg Gln Asn Pro
20 49450DNAArtificial SequenceRNAi target sequence 49ctgaatcaca
ggcccagtag gggcacgaga gctaggtgct aactttcttc tctgaattat 60gtcttctttt
ttgaagtcct tctcagctgc gaaccgagta ttttgccact gtcccatgtt 120tggaacatta
tttcttgcca ctgattgttg tggtaaatgt tgagattggg attgctgctg 180atccagcatg
gaagtttcag gtgccataga ctgcaaggcg tcttttgact tatcagaacc 240atccatctgc
tcctgcttag catcgtatct caaattttgc tgatgactaa aatataagga 300agatcctgga
tcttgcatgt tgttcatcat cgaagaagga tatctctgac cactcagtga 360agatgcatac
tgcatcccct tgacatctaa ttgtggatgc agttgatggt tcttccattg 420catctcctgc
ccaccaaggg gttgaggcct
45050450DNAArtificial SequenceRNAi target sequence repeat 50aggcctcaac
cccttggtgg gcaggagatg caatggaaga accatcaact gcatccacaa 60ttagatgtca
aggggatgca gtatgcatct tcactgagtg gtcagagata tccttcttcg 120atgatgaaca
acatgcaaga tccaggatct tccttatatt ttagtcatca gcaaaatttg 180agatacgatg
ctaagcagga gcagatggat ggttctgata agtcaaaaga cgccttgcag 240tctatggcac
ctgaaacttc catgctggat cagcagcaat cccaatctca acatttacca 300caacaatcag
tggcaagaaa taatgttcca aacatgggac agtggcaaaa tactcggttc 360gcagctgaga
aggacttcaa aaaagaagac ataattcaga gaagaaagtt agcacctagc 420tctcgtgccc
ctactgggcc tgtgattcag
45051147DNAArtificial SequenceGmPre2 RNAi target sequence 51gcagcagctg
caacaaaatc aacacacact cattcaacag cagaatcccc agttccagag 60gtctcctatg
atgcttggga caaatcagct ttcacactta aatccagttg gacaaaactc 120caacatgcca
ttaggtaatc acatgct 147
User Contributions:
Comment about this patent or add new information about this topic: