Patent application title: Methods of Stimulating Protective Immunity Employing Dengue Viral Antigens
Inventors:
Thomas J. Powell (Cranbury, NJ, US)
Thomas J. Powell (Cranbury, NJ, US)
Valerian Nakaar (Cranbury, NJ, US)
Valerian Nakaar (Cranbury, NJ, US)
Langzhou Song (Cranbury, NJ, US)
Langzhou Song (Cranbury, NJ, US)
James W. Huleatt (Cranbury, NJ, US)
James W. Huleatt (Cranbury, NJ, US)
William F. Mcdonald (Cranbury, NJ, US)
Duane D. Hewitt (Hamilton, CA)
Assignees:
VAXINNATE CORPORATION
IPC8 Class: AA61K3912FI
USPC Class:
4242181
Class name: Antigen, epitope, or other immunospecific immunoeffector (e.g., immunospecific vaccine, immunospecific stimulator of cell-mediated immunity, immunospecific tolerogen, immunospecific immunosuppressor, etc.) virus or component thereof togaviridae or flaviviridae, except hepatitis c virus (e.g., yellow fever virus, bovine viral diarrhea virus, dengue virus, equine viral arteritis virus, equine encephalitis virus, japanese b encephalitis virus, sindbis virus, flavivirus, etc.)
Publication date: 2014-02-06
Patent application number: 20140037683
Abstract:
Compositions that include at least a portion of at least one
pathogen-associated molecular pattern and at least a portion of at least
one member selected from the group consisting of a Den1 viral envelope
protein, a Den2 viral envelope protein, a Den3 viral envelope protein and
a Den4 viral envelope protein are employed in methods to stimulate a
protective immune response in a subject.Claims:
1. A method of stimulating protective immunity in a subject, comprising
the step of administering to the subject a composition that includes at
least a portion of at least one pathogen-associated molecular pattern and
at least a portion of at least one member selected from the group
consisting of a Den1 viral envelope protein, a Den2 viral envelope
protein, a Den3 viral envelope protein and a Den4 viral envelope protein.Description:
RELATED APPLICATIONS
[0001] This application is a divisional of U.S. application Ser. No. 11/879,695, filed Jul. 18, 2007, which is a continuation-in-part application of International Application No. PCT/US2006/001623, which designated the United States and was filed on Jan. 19, 2006, published in English, which claims the benefit of U.S. Provisional Application Nos. 60/645,170, filed Jan. 19, 2005; 60/653,405, filed Feb. 15, 2005; 60/704,160, filed Jul. 29, 2005; 60/723,409, filed Oct. 4, 2005; and 60/725,919, filed Oct. 11, 2005. The teachings of the above applications are incorporated herein by reference in their entirety.
BACKGROUND OF THE INVENTION
[0002] Infections with viruses, including flaviviruses, such as West Nile flavivirus, Dengue flavivirus, Japanese encephalitis flavivirus, Langat flavivirus, Kunjin flavivirus, Murray Valley encephalitis flavivirus, Tick-borne flavivirus and Yellow fever flavivirus, can result in serious disease and, possibly death. Mosquitos and ticks transmit many of the flaviviruses. For example, severe symptoms of West Nile virus infection include high fever, headache, neck stiffness, stupor, disorientation, coma, tremors, convulsions, muscle weakness, vision loss, numbness, meningoencephalitis and paralysis. These symptoms may last several weeks, and neurological effects may be permanent. In cases with milder symptoms (e.g., fever, headache, and body aches, nausea, vomiting, and sometimes swollen lymph glands or a skin rash on the chest, stomach and back), certain symptoms, such as fever and aches, can pass on their own. In more severe cases, people usually require hospitalization for treatment, such as administration of intravenous fluids and assistance with breathing.
[0003] Methods to prevent flavivirus infection include compositions of live attenuated and inactivated virus. However, such compositions may be less than optimally immunogenic, may result in unknown hazards if improperly prepared and may have adverse side effects. There is a need to develop new compositions and methods to prevent flavivirus infection.
SUMMARY OF THE INVENTION
[0004] The present invention relates to compositions, fusion proteins and polypeptides of at least a portion of an antigen and a flagellin that lacks a hinge region; and at least a portion of at least one pathogen-associated molecular pattern (PAMP) and at least a portion of at least one flavivirus. The compositions, fusion protein and polypeptides of the invention can be employed in methods to stimulate an immune response and protective immunity in a subject.
[0005] In one embodiment, the invention is a composition comprising at least a portion of at least one antigen and at least a portion of at least one flagellin, wherein at least one of the flagellin lacks at least a portion of a hinge region.
[0006] In another embodiment, the invention is a fusion protein comprising at least a portion of at least one antigen and at least a portion of at least one flagellin, wherein at least one of the flagellin lacks at least a portion of a hinge region.
[0007] In an additional embodiment, the invention is a composition comprising at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one viral protein selected from the group consisting of a West Nile viral protein, a Langat viral protein, a Kunjin viral protein, a Murray Valley encephalitis viral protein, a Japanese encephalitis viral protein, a tickborne encephalitis viral protein, and a Yellow fever viral protein.
[0008] In yet another embodiment, the invention is a composition comprising at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one Den2 viral envelope protein, wherein the Den2 viral envelope protein is at least one member selected from the group consisting of SEQ ID NO: 22 and SEQ ID NO: 40.
[0009] In another embodiment, the invention is a composition comprising at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein.
[0010] In still another embodiment, the invention is a fusion protein comprising at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one viral protein selected from the group consisting of a West Nile viral protein, a Langat viral protein, a Kunjin viral protein, a Murray Valley encephalitis viral protein, a Japanese encephalitis viral protein, a tickborne encephalitis viral protein, and a Yellow fever viral protein.
[0011] An additional embodiment of the invention is a fusion protein comprising at least a portion of at least one member selected from the group consisting of a Salmonella typhimurium flagellin type 2 (fljB/STF2), an E. coli fliC, and a S. muenchen fliC and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein.
[0012] In another embodiment, the invention is a fusion protein comprising at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein.
[0013] Another embodiment of the invention is a polypeptide encoded by SEQ ID NO: 29.
[0014] In yet another embodiment, the invention is a polypeptide that includes SEQ ID NO: 30.
[0015] In a further embodiment, the invention is a polypeptide having at least about 85% identity to SEQ ID NO: 30.
[0016] In still another embodiment, the invention is a polypeptide encoded by SEQ ID NO: 31.
[0017] In another embodiment, the invention is a polypeptide that includes SEQ ID NO: 32.
[0018] In an additional embodiment, the invention is a polypeptide having at least about 70% identity to SEQ ID NO: 32.
[0019] In yet another embodiment, the invention is a polypeptide encoded by SEQ ID NO: 33.
[0020] In another embodiment, the invention is a polypeptide that includes SEQ ID NO: 34.
[0021] In still another embodiment, the invention is a polypeptide having at least about 70% identity to SEQ ID NO: 34.
[0022] In an additional embodiment, the invention is a polypeptide encoded by SEQ ID NO: 35.
[0023] In a further embodiment, the invention is a polypeptide that includes SEQ ID NO: 36.
[0024] In yet another embodiment, the invention is a polypeptide having at least 80% identity to SEQ ID NO: 36.
[0025] In another embodiment, the invention is a polypeptide encoded by SEQ ID NO: 37.
[0026] In still another embodiment, the invention is a polypeptide that includes SEQ ID NO: 38.
[0027] In another embodiment, the invention is a polypeptide having at least 70% identity to SEQ ID NO: 38.
[0028] In an additional embodiment, the invention is a polypeptide encoded by SEQ ID NO: 54.
[0029] In another embodiment, the invention is a polypeptide that includes SEQ ID NO: 55.
[0030] Another embodiment of the invention is a polypeptide having at least about 70% identity to SEQ ID NO: 55.
[0031] In still another embodiment, the invention is a polypeptide that includes at least one member selected from the group consisting of SEQ ID NO: 71 and SEQ ID NO: 72.
[0032] In another embodiment, the invention is a polypeptide encoded by at least one member selected from the group consisting of SEQ ID NO: 70 and SEQ ID NO: 73.
[0033] In yet another embodiment, the invention is a polypeptide having at least about 70% identity to at least one member selected from the group consisting of SEQ ID NO: 71 and SEQ ID NO: 72.
[0034] In still another embodiment, the invention is a polypeptide that includes at least one member selected from the group consisting of SEQ ID NO: 76 and SEQ ID NO: 6.
[0035] In a further embodiment, the invention is a polypeptide encoded by at least one member selected from the group consisting of SEQ ID NO: 77 and SEQ ID NO: 5.
[0036] In another embodiment, the invention is a polypeptide having at least about 70% identity to at least one member selected from the group consisting of SEQ ID NO: 76 and SEQ ID NO: 6.
[0037] In an additional embodiment, the invention is a polypeptide that includes at least one member selected from the group consisting of SEQ ID NO: 80, SEQ ID NO: 82, SEQ ID NO: 84 and SEQ ID NO: 86.
[0038] In still another embodiment, the invention is a polypeptide encoded by at least one member selected from the group consisting of SEQ ID NO: 81, SEQ ID NO: 83, SEQ ID NO: 85 and SEQ ID NO: 87.
[0039] In a further embodiment, the invention is a polypeptide having at least about 70% identity to at least one member selected from the group consisting of SEQ ID NO: 80, SEQ ID NO: 82, SEQ ID NO: 84 and SEQ ID NO: 86.
[0040] In an additional embodiment, the invention is a polypeptide that includes SEQ ID NO: 159.
[0041] In yet another embodiment, the invention is a polypeptide encoded by SEQ ID NO: 158.
[0042] In another embodiment, the invention is a polypeptide having at least about 70% identity to SEQ ID NO: 159.
[0043] In yet another embodiment, the invention is a composition comprising at least one Pam3Cys and at least a portion of at least one flavivirus protein.
[0044] In an additional embodiment, the invention is a composition comprising at least one Pam2Cys and at least a portion of at least one flavivirus protein.
[0045] In still another embodiment, the invention is a method of stimulating an immune response in a subject, comprising the step of administering to the subject a composition that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one viral protein selected from the group consisting of a West Nile viral protein, a Langat viral protein, a Kunjin viral protein, a Murray Valley encephalitis viral protein, a Japanese encephalitis viral protein, a tickborne encephalitis viral protein, and a Yellow fever virus protein.
[0046] In a further embodiment, the invention is a method of stimulating an immune response in a subject, comprising the step of administering to the subject a composition that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one Den2 envelope protein, wherein the Den2 envelope protein is selected from the group consisting of SEQ ID NO: 20 and SEQ ID NO: 40.
[0047] In yet another embodiment, the invention is a method of stimulating an immune response in a subject, comprising the step of administering to the subject a fusion protein that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one viral protein selected from the group consisting of a West Nile viral protein, a Langat viral protein, a Kunjin viral protein, a Murray Valley encephalitis viral protein, a Japanese encephalitis viral protein, a tickborne encephalitis viral protein and a Yellow fever viral protein.
[0048] In another embodiment, the invention is a method of stimulating an immune response in a subject, comprising the step of administering to the subject a composition that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein.
[0049] In still another embodiment, the invention is a method of stimulating an immune response in a subject, comprising the step of administering to the subject a fusion protein that includes at least a portion of at least one member selected from the group consisting of a Salmonella typhimurium flagellin type 2 (fljB/STF2), an E. coli fliC, and a S. muenchen fliC and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein.
[0050] In an additional embodiment, the invention is a method of stimulating an immune response in a subject, comprising the step of administering to the subject a fusion protein that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein.
[0051] In a further embodiment, the invention is a method of stimulating an immune response in a subject, comprising the step of administering to the subject a composition comprising at least a portion of at least one antigen and at least a portion of at least one flagellin, wherein at least one of the flagellins lack at least a portion of a hinge region.
[0052] In another embodiment, the invention is a method of stimulating an immune response in a subject, comprising the step of administering to the subject a fusion protein comprising at least a portion of at least one antigen and at least a portion of at least one flagellin, wherein at least one of the flagellins lack at least a portion of a hinge region.
[0053] In another embodiment, the invention is a method of stimulating protective immunity in a subject, comprising the step of administering to the subject a composition that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one viral protein selected from the group consisting of a West Nile viral protein, a Langat viral protein, a Kunjin viral protein, a Murray Valley encephalitis viral protein, a Japanese encephalitis viral protein, a Tick-borne encephalitis viral protein, and a Yellow fever virus protein.
[0054] In a further embodiment, the invention is a method of stimulating protective immunity in a subject, comprising the step of administering to the subject a composition that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one Den2 envelope protein, wherein the Den2 envelope protein is at least one member selected from the group consisting of SEQ ID NO: 22, SEQ ID NO: 40 and SEQ ID NO: 97.
[0055] In still another embodiment, the invention is a method of stimulating protective immunity in a subject, comprising the step of administering to the subject a fusion protein that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one viral protein selected from the group consisting of a West Nile viral protein, a Langat viral protein, a Kunjin viral protein, a Murray Valley encephalitis viral protein, a Japanese encephalitis viral protein, a Tick-borne encephalitis viral protein and a Yellow fever viral protein.
[0056] In an additional embodiment, the invention is a method of stimulating protective immunity in a subject, comprising the step of administering to the subject a composition that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein.
[0057] In another embodiment, the invention is a method of stimulating protective immunity in a subject, comprising the step of administering to the subject a fusion protein that includes at least a portion of at least one member selected from the group consisting of a Salmonella typhimurium flagellin type 2 (fljB/STF2), an E. coli fliC, and a S. muenchen fliC and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein.
[0058] In a further embodiment, the invention is a method of stimulating protective immunity in a subject, comprising the step of administering to the subject a fusion protein that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein.
[0059] In yet another embodiment, the invention is a method of stimulating protective immunity in a subject, comprising the step of administering to the subject a composition comprising at least a portion of at least one antigen and at least a portion of at least one flagellin, wherein at least one of the flagellins lacks at least a portion of a hinge region.
[0060] In yet another embodiment, the invention is a method of stimulating protective immunity in a subject, comprising the step of administering to the subject a fusion protein comprising at least a portion of at least one antigen and at least a portion of at least one flagellin, wherein at least one of the flagellins lacks at least a portion of a hinge region.
[0061] The compositions, fusions proteins and polypeptides of the invention can be employed to stimulate an immune response or protective immunity in a subject. Advantages of the claimed invention can include, for example, prevention of flavivirus infection in a subject in a manner specific for a particular antigen or virus, such as a flavivirus protein, that has effective immunogenicity and reduced side effects. The claimed compositions, fusion proteins, polypeptides and methods can be employed to prevent or treat infection and, therefore, avoid serious diseases consequent to antigen or viral infection.
BRIEF DESCRIPTION OF THE FIGURES
[0062] FIG. 1 depicts the amino acid sequence (SEQ ID NO: 1) of Salmonella typhimurium flagellin type 2 (fljB/STF2, also referred to herein as "STF2"). The hinge region (also referred to herein as "the hypervariable" or the "hypervariable hinge region") is underlined.
[0063] FIG. 2 depicts the nucleic acid sequence (SEQ ID NO: 2) encoding SEQ ID NO: 1. The nucleic acid sequence encoding the hinge region is underlined.
[0064] FIG. 3 depicts the amino acid sequence (SEQ ID NO: 3) of a fljB/STF2Δ (also referred to herein as "fljB/STF2Δ" or "STF2Δ"). STF2Δ is a STF2 lacking at least a portion of the hinge region. The artificial hinge region is underlined.
[0065] FIG. 4 depicts the nucleic acid sequence (SEQ ID NO: 4) encoding SEQ ID NO: 3. The nucleic acid sequence encoding the artificial hinge region is underlined.
[0066] FIG. 5 depicts the nucleic acid sequence (SEQ ID NO: 5) encoding a pET/STF2Δ.JEIII+ fusion protein. The nucleic acid sequence encoding the artificial hinge region is double underlined. The nucleic acid sequence encoding the linker between STF2Δ and JEIII+ is underlined. The nucleic acid sequence encoding JEIII+ is bolded.
[0067] FIG. 6 depicts the amino acid sequence (SEQ ID NO: 6) encoded by SEQ ID NO: 5. The artificial hinge is double underlined. The linker between STF2Δ and JEIII+ is underlined. The amino acid sequence of JEIII+ is bolded.
[0068] FIG. 7 depicts the nucleic acid sequence (SEQ ID NO: 29) encoding a STF2.EIII+ fusion protein. The nucleic acid sequence encoding the hinge region of STF2 is underlined.
[0069] FIG. 8 depicts the amino acid sequence (SEQ ID NO: 30) encoded by SEQ ID NO: 29. The hinge region of STF2 is underlined.
[0070] FIG. 9 depicts the nucleic acid sequence (SEQ ID NO: 31) encoding a STF2Δ.EIII+ fusion protein. The naturally occurring hinge region of STF2 has been removed and replaced with an artificial hinge region. The nucleic acid sequence encoding the artificial hinge region is underlined. The nucleic acid sequence encoding EIII+ is bolded.
[0071] FIG. 10 depicts the amino acid sequence (SEQ ID NO: 32) encoded by SEQ ID NO: 31. The artificial hinge region is underlined. The EIII+ amino acid sequence is bolded.
[0072] FIG. 11 depicts the nucleic acid sequence (SEQ ID NO: 33) of a STF2Δ.EIII+ fusion protein. The nucleic acid sequence encoding the artificial hinge region is double underlined. The nucleic acid sequence encoding a linker between STF2Δ and EIII+ is underlined. The nucleic acid sequence encoding EIII+ is bolded. Vector sequence is unbolded at the 3' end of the nucleic acid sequence.
[0073] FIG. 12 depicts the amino acid sequence (SEQ ID NO: 34) encoded by SEQ ID NO: 33. The artificial hinge region is double underlined. The linker between STF2Δ and EIII+ is underlined. The amino acid sequence of the EIII+ is bolded. Domain I of the West Nile virus protein is bolded and italicized (MEKLQ, SEQ ID NO: 172). The remainder of the bolded sequence (LKGTTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDL TPVGRLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKSGSS IGK, SEQ ID NO: 176) is domain III of the envelope protein of the West Nile virus. Vector sequence at the carboxy-terminus is not bolded at the carboxy-terminus.
[0074] FIG. 13 depicts the nucleic acid sequence (SEQ ID NO: 35) of a STF2.EIII+ fusion protein. The nucleic acid sequence encoding the hinge region of STF2 is underlined. The nucleic acid sequence encoding a linker between STF2 and EIII+ is bolded and underlined. The nucleic acid sequence encoding EIII+ is bolded.
[0075] FIG. 14 depicts the amino acid sequence (SEQ ID NO: 36) encoded by SEQ ID NO: 35. The hinge region is underlined. The linker between STF2 and EIII+ is bolded and underlined. The amino acid sequence of EIII+ is bolded.
[0076] FIG. 15 depicts the nucleic acid sequence (SEQ ID NO: 37) encoding a fljB/STF2Δ.EIII+ fusion protein. There is no linker between STFΔ and EIII+.
[0077] FIG. 16 depicts the amino acid sequence (SEQ ID NO: 38) encoded by SEQ ID NO: 37. The amino acid sequence of EIII+ is bolded.
[0078] FIG. 17 depicts the nucleic acid sequence (SEQ ID NO: 54) of a fljB/STF2.EIII+ fusion protein. The nucleic acid sequence encoding the hinge region of STF2 is underlined. The nucleic acid sequence encoding a linker between STF2 and EIII+ is bolded and underlined. The nucleic acid sequence encoding EIII+ is bolded.
[0079] FIG. 18 depicts the amino acid sequence (SEQ ID NO: 55) encoded by SEQ ID NO: 54. The amino acid sequence of the hinge region of STF2 is underlined. The amino acid sequence of the linker between STF2 and EIII+ is bolded and underlined. The amino acid sequence of EIII+ is bolded.
[0080] FIG. 19 depicts the amino acid sequence (SEQ ID NO: 58) of Salmonella muenchen flagellin fliC. The amino acid sequence of the hinge region is underlined.
[0081] FIG. 20 depicts the nucleic acid sequence (SEQ ID NO: 59) encoding SEQ ID NO: 58. The nucleic acid sequence encoding the hinge region is underlined.
[0082] FIG. 21 depicts the nucleic acid sequence (SEQ ID NO: 63) of a linker.
[0083] FIG. 22 depicts the amino acid sequence (SEQ ID NO: 64) of Hepatitis C E1.
[0084] FIG. 23 depicts the amino acid sequence (SEQ ID NO: 65) of Hepatitis C E2.
[0085] FIG. 24 depicts the nucleic acid sequence (SEQ ID NO: 66) encoding SEQ ID NO: 64.
[0086] FIG. 25 depicts the nucleic acid sequence (SEQ ID NO: 67) encoding SEQ ID NO: 65.
[0087] FIG. 26 depicts the amino acid sequence (SEQ ID NO: 68) of E. Coli fliC. The amino acid sequence of the hinge region is underlined.
[0088] FIG. 27 depicts the nucleic acid sequence (SEQ ID NO: 69) encoding SEQ ID NO: 68. The nucleic acid sequence encoding the hinge region is underlined.
[0089] FIG. 28 depicts the nucleic acid sequence (SEQ ID NO: 70) encoding a fljB/STF2Δ.EIII+ fusion protein. The nucleic acid sequence encoding the artificial hinge region is double underlined. The nucleic acid sequence encoding a linker between STF2Δ and EIII+ is underlined. The nucleic acid sequence encoding the EIII+ is bolded. Vector sequence is not bolded at the 3' end of the sequence.
[0090] FIG. 29 depicts the amino acid sequence (SEQ ID NO: 71) encoded by SEQ ID NO: 70. The artificial hinge region is double underlined. The amino acid sequence of the linker between STF2Δ and EIII+ is underlined. The amino acid sequence of the EIII+ is bolded. Vector sequence at the carboxy-terminus is not bolded.
[0091] FIG. 30 depicts the amino acid sequence (SEQ ID NO: 72) of a fljB/STF2Δ.EIIIs+ fusion protein. The artificial hinge region is double underlined. The amino acid sequence encoding the linker between STF2Δ and EIII+ is underlined. Domain I of the West Nile virus protein is bolded and italicized (SEQ ID NO: 172). The remainder of the bolded sequence is domain III of the envelope protein (SEQ ID NO: 176) of the West Nile virus. Portions of domains I and III are referred to as EIII+. Vector sequence at the carboxy-terminus of the protein is unbolded. The serine residue of the linker region is bolded and is a substitution of the cysteine residue in the same region of the linker of SEQ ID NO: 71 of FIG. 29.
[0092] FIG. 31 depicts the nucleic acid sequence (SEQ ID NO: 73) encoding SEQ ID NO: 72. The nucleic acid sequence encoding the artificial hinge region is double underlined. The nucleic acid sequence encoding the linker between STF2Δ and EIII+ is underlined with the codon encoding the serine residue bolded. The nucleic acid sequence encoding EIII+ is indicated by bolded text. Linker sequence is unbolded text at the 3' end.
[0093] FIG. 32 depicts the amino acid sequence (SEQ ID NO: 76) of a pET/STF2Δ.JEIII+ fusion protein. The artificial hinge region is double underlined. The amino acid sequence of the linker between STF2Δ and JEIII+ is underlined. The amino acid sequence of a portion of domain I of the Japanese encephalitis virus is bolded and italicized (MDKLAL, SEQ ID NO: 173). The amino acid sequence of a portion of the domain III of the Japanese encephalitis virus is bolded (KGTTYGMCTEKFSFAKNPVDTGHGTVVIELSYSGSDGPCKIPIVSVASLNDMTP VGRLVTVNPFVATSSANSKVLVEMEPPFGDSYIVVGRGDKQINHHWHKAGSTL GKA, SEQ ID NO: 177). Portions of domains I and III are referred to as "JEIII+."
[0094] FIG. 33 depicts the nucleic acid sequence (SEQ ID NO: 77) encoding SEQ ID NO: 76. The nucleic acid sequence encoding the artificial hinge region is double underlined. The nucleic acid sequence encoding a linker between STF2Δ and JEIII+ is underlined. The nucleic acid sequence encoding a portion of domain I of the Japanese encephalitis virus is bolded and italicized. The nucleic acid sequence encoding a portion of domain III of the Japanese encephalitis virus is bolded. Portions of domains I and III are referred to as "JEIII+."
[0095] FIG. 34 depicts the nucleic acid sequence (SEQ ID NO: 78) encoding JEIII+. The nucleic acid sequence encoding at least a portion of domain I of the envelope protein is underlined. The remaining nucleic acid sequence encodes at least a portion of domain III of the envelope protein.
[0096] FIG. 35 depicts the amino acid sequence (SEQ ID NO: 79) encoded by SEQ ID NO: 78. At least a portion of domain I of the envelope protein is bolded and italicized. The remaining sequence is at least a portion of domain III of the envelope protein.
[0097] FIG. 36 depicts the amino acid sequence (SEQ ID NO: 80) of a pET/STF2Δ.Den1 EIII fusion protein. The artificial hinge region is double underlined. A linker between STF2Δ and Den1 EIII is underlined.
[0098] FIG. 37 depicts the nucleic acid sequence (SEQ ID NO: 81) encoding SEQ ID NO: 80. The nucleic acid sequence encoding the artificial hinge region is double underlined. The nucleic acid sequence encoding the linker between STF2Δ and Den1 EIII is underlined.
[0099] FIG. 38 depicts the amino acid sequence (SEQ ID NO: 82) of a pET/STF2Δ.Den2 EIII fusion protein. The artificial hinge region is double underlined. The amino acid sequence of the linker between STF2Δ and Den2 EIII is underlined.
[0100] FIG. 39 depicts the nucleic acid sequence (SEQ ID NO: 83) encoded by SEQ ID NO: 82. The nucleic acid sequence encoding the artificial hinge region is double underlined. The nucleic acid sequence encoding the linker between STF2Δ and Den2 EIII is underlined.
[0101] FIG. 40 depicts the amino acid sequence (SEQ ID NO: 84) of a pET/STF2Δ.Den3 EIII fusion protein. The artificial hinge region is double underlined. The amino acid sequence of the linker between STF2Δ and Den3 EIII is underlined.
[0102] FIG. 41 depicts the nucleic acid sequence (SEQ ID NO: 85) encoding SEQ ID NO: 84. The nucleic acid sequence encoding the artificial hinge region is double underlined. The nucleic acid sequence encoding the linker between STF2Δ and Den3 EIII is underlined.
[0103] FIG. 42 depicts the amino acid sequence (SEQ ID NO: 86) of a pET/STF2Δ.Den4 EIII fusion protein. The artificial hinge region is double underlined. The amino acid sequence of the linker between STF2Δ and Den4 EIII is underlined.
[0104] FIG. 43 depicts the nucleic acid sequence (SEQ ID NO: 87) encoding SEQ ID NO: 86. The nucleic acid sequence encoding the artificial hinge region is double underlined. The nucleic acid sequence encoding the linker between STF2Δ and Den4 EIII is underlined.
[0105] FIG. 44 depicts the amino acid sequence (SEQ ID NO: 174) of the envelope protein of the Tick-borne encephalitis envelope protein.
[0106] FIG. 45 depicts the amino acid sequence (SEQ ID NO: 39) of a West Nile virus envelope protein (WNE) (amino acids 1-406). The amino acid sequence incorporated into EIII+ constructs is underlined (amino acids 292-406). Amino acids 292-297 correspond to a portion of domain I; amino acids 298-406 correspond to domain III. SEQ ID NO: 39 is encoded by SEQ ID NO: 57 (FIG. 67).
[0107] FIG. 46 depicts fusion constructs in a pET24 vector. T7:T7 promoter; lacO: lac operator; STF2: Salmonella typhimurium flagellin; STF2Δ=STF2 with the hinge region deleted; EIII.sup.+ is domain III of a West Nile envelope protein with 6 amino acids of domain I amino acid.
[0108] FIGS. 47A and 47B depict TLR-5 bioactivity of STF2.EIII+ (SEQ ID NOS: 54, 55) and STF2ΔEIII+ (SEQ ID NOS: 70, 71) fusion proteins. Serial dilutions of purified proteins were added to HEK293 (TLR5+) cells overnight and IL-8 content of the supernatants measured by ELISA. Purified STF2.OVA was used as a positive control (FIG. 47A). The TLR-2 agonist Pam3CSK4 was used as a negative control (FIG. 47B).
[0109] FIG. 48 depicts STF2Δ.EIII+ antigenic epitopes assessed by ELISA. Plates were coated with full-length WNE (open bars) (SEQ ID NO: 39) or STF2Δ.EIII+ (SEQ ID NOS: 70, 71) and probed with the indicated antibodies (mAb). Poly=polyclonal antiserum to WNE; 3D9 through 7H2=neutralizing monoclonal antibodies to WNE epitopes; anti-flagellin=monoclonal antibody to flagellin.
[0110] FIGS. 49A, 49B, 49C and 49D depict reactivity of STF2.E (SEQ ID NOS: 158, 159); STF2.EIII+ (SEQ ID NOS: 54, 55) and STF2Δ.EIII+ (SEQ ID NOS: 70, 71) fusion proteins with antibodies to WNE and flagellin. Plates were coated with fusion proteins, blocked and incubated with antibodies to WNE or flagellin. Antibody reactivity was detected following incubation with HRP-labeled species specific IgG. Plates were developed in the presence of TMB substrate and O.D.450/650 using a TECAN plate reader and Magellian software.
[0111] FIG. 50 depicts IgG serum following injection with fusion proteins. Mice were immunized with either PBS, Drosophila conditioned medium containing STF2.E (CM, positive control), 25 μg of STF2Δ.EIII+ (SEQ ID NOS: 70, 71) i.p., 25 μg STF2Δ.EIII+ s.c., 25 μg STF2.EIII+ (SEQ ID NO: 54, 55) i.p., 25 μg STF2.EIII+ (SEQ ID NOS: 54, 55) or 25 μg STF2.E (SEQ ID NOS: 158, 159). On day 35, immunized animals were challenged with WNV. Sera from individual mice (day 35) were characterized by direct ELISA to determine IgG levels. Purified WNV-E protein (SEQ ID NO: 39) was used as the antigen in this assay. This antigen (60) was produced in Drosophila as a his-tagged protein.
[0112] FIG. 51 depicts STF2Δ.EIII+ (SEQ ID NOS: 70, 71) and STF2.EIII+ (SEQ ID NOS: 54, 55) protective immunity to WNV viral challenge. Mice were immunized and challenged with a lethal dose of WNV strain 2741 on day 35. Survival was monitored for 21 days.
[0113] FIG. 52 depicts IgG sera titers following immunization with fusion proteins. STF2Δ.EIII+ proteins induce WNV-specific IgG antibodies. Mice were immunized s.c. on days 0, 14 and 28 with PBS alone or about 25 μg of STF2Δ.EIII+ (SEQ ID NOS: 70, 71) (045 [positive control]), STF2Δ.EIII+ (067, trimer), STF2Δ.EIII+ (070, monomer) or STF2Δ.EIIIs+ (SEQ ID NOS: 72, 73) (069). On day 35 sera from individual mice were characterized by direct ELISA to determine IgG levels. Purified WNV-E protein (060, produced in Drosophila as a his-tagged protein) was used as the antigen in this assay.
[0114] FIG. 53 depicts STF2Δ.EIII+ (SEQ ID NOS: 70, 71) and STF2Δ.EIIIs+(SEQ ID NOS: 72, 73) protective immunity in mice from WNV lethal challenge. On day 38 following immunization with fusion proteins, all groups were challenged with a lethal dose of WNV strain 2741 and survival was monitored for 21 days. Survival for each group (10 mice/group) is indicated as a percentage.
[0115] FIG. 54 depicts competition assays. Serial dilutions (five fold starting at 1:25) of antisera from immunized animals were incubated with biotinylated WNE protein (SEQ ID NO: 39) and then added to the wells of ELISA plates coated with mAb 7H2 at about 2 mg/ml. Wells were developed using avidin-HRP to determine inhibition of West Nile protein binding as a results of competition with mAb 7H2.
[0116] FIG. 55 depicts epitope mapping of the antibody response induced by STF2Δ.EIII+ (SEQ ID NOS: 72, 73) fusion proteins. Immune sera from animals immunized with indicated STF2Δ-fusion proteins (E2-21, E27-E52, FIG. 60) were examined for the ability to recognize overlapping peptides corresponding to the junction of domains I and III of the WNV envelope protein.
[0117] FIG. 56 depicts epitope mapping of the antibody response induced by STFΔ.EIIIs+ (SEQ ID NOS: 72, 73) E-21 (envelope protein) epitope fusion proteins. Immune sera from animals immunized with the indicated STF2Δ-fusion proteins (E2-21, E2-21-1 (S,C), E2-21-2(C,S), E2-21-2(C,S) and E2-21-4 through E2-21-24, see FIG. 57) were evaluated to identify the residues defining the E-21 epitope of West Nile envelope protein. Data reflects the response of sera to E-21 following the substitution of cysteine with serine (indicated by C,S); and the sequential replacement of amino acids with alanine. The peptides tested are listed in FIG. 57.
[0118] FIG. 57 depicts EIII+ peptide arrays. The sequences include domains I and III of the West Nile virus envelope protein. Amino acids that correspond to domain III are underlined. Amino acids that are not underlined correspond to domain I.
[0119] FIG. 58 depicts Pam3Cys.WNV001 (SEQ ID NO: 168) inducing EIII specific IgG antibodies. Mice were immunized s.c. on days 0, 14 and 28 with PBS alone, 22 mg of unmodified WNV001 (SEQ ID NO: 168) or 30 μg of Pam3Cys.WNV001. On day 35 sera from individual mice were characterized by direct ELISA to determine IgG levels to synthetic WNV001 peptide.
[0120] FIG. 59 depicts the amino acid sequences (SEQ ID NOS: 88-95) of the EI/EIII junction for West Nile, Japanese encephalitis and Dengue (serotypes 1 through 4) viruses. The West Nile epitope identified using antisera from STF2Δ.EIIIs+ immunized animals is underlined. This sequence corresponds to peptide E2-21 (SEQ ID NO: 125).
[0121] FIG. 60 depicts E2-21 peptide (SEQ ID NOS: 125-151) alanine scan array. Amino acids that correspond to domain III of the West Nile virus envelope protein are underlined. Amino acids that are not underlined correspond to domain I of the West Nile virus.
[0122] FIG. 61 depicts a STF2.OVA nucleic acid sequence (SEQ ID NO: 152). The nucleic acid sequence encoding the linker between STF2 and ovalbumin (OVA) is underlined. Vector sequence at the 3' end is bolded and underlined.
[0123] FIG. 62 depicts an amino acid sequence (SEQ ID NO: 153) encoded by SEQ ID NO: 152. The linker sequence between STF2 and OVA is underlined. Vector sequence is underlined and bolded.
[0124] FIG. 63 depicts the amino acid sequence (SEQ ID NO: 154) of ovalbumin.
[0125] FIG. 64 depicts the nucleic acid sequence (SEQ ID NO: 155) of ovalbumin.
[0126] FIG. 65 depicts the nucleic acid sequence (SEQ ID NO: 158) encoding a STF2.E fusion protein. The nucleic acid sequence encoding the full-length West Nile virus envelope protein (E) is underlined.
[0127] FIG. 66 depicts the amino acid sequence (SEQ ID NO: 159) encoded by SEQ ID NO: 158. The amino acid sequence of the West Nile virus envelope protein is underlined.
[0128] FIG. 67 depicts the nucleic acid sequence (SEQ ID NO: 57) encoding SEQ ID NO: 39 (FIG. 45). The full length sequence of the West Nile virus envelope protein is depicted.
[0129] FIG. 68 depicts the amino acid sequence (SEQ ID NO: 160) of the Dengue 1 virus (also referred to herein as "Den-1," "Den 1" or "Den1").
[0130] FIG. 69 depicts the nucleic acid sequence (SEQ ID NO: 161) encoding SEQ ID NO: 160.
[0131] FIG. 70 depicts the amino acid sequence (SEQ ID NO: 162) of the Dengue 2 virus (also referred to herein as "Den-2," "Den 2" or "Den2").
[0132] FIG. 71 depicts the nucleic acid sequence (SEQ ID NO: 163) encoding SEQ ID NO: 162.
[0133] FIG. 72 depicts the amino acid sequence (SEQ ID NO: 164) of the Dengue 3 virus (also referred to herein as "Den-3," "Den 3" or "Den3").
[0134] FIG. 73 depicts the nucleic acid sequence (SEQ ID NO: 165) encoding SEQ ID NO: 164).
[0135] FIG. 74 depicts the amino acid sequence (SEQ ID NO: 166) of the Dengue 4 virus (also referred to here in as "Den-4," "Den 4" or "Den4").
[0136] FIG. 75 depicts the nucleic acid sequence (SEQ ID NO: 167) encoding SEQ ID NO: 166.
[0137] FIG. 76 depicts the nucleic acid sequence (SEQ ID NO: 170) encoding a Japanese encephalitis virus.
[0138] FIG. 77 depicts the amino acid sequence (SEQ ID NO: 171) encoded by SEQ ID NO: 170.
[0139] FIG. 78 depicts the nucleic acid sequence (SEQ ID NO: 175) encoding SEQ ID NO: 174, depicted in FIG. 44.
[0140] FIG. 79 depicts the nucleic acid sequence (SEQ ID NO: 178) encoding EIII+ (amino acids of 292-406 of SEQ ID NO: 39, depicted in FIG. 45 and SEQ ID NO: 7).
[0141] FIG. 80 depicts a tripalmitoylated peptide.
[0142] FIGS. 81A and 81B depict anti-flagellin and anti-WNV-E specific IgG responses in mice. Five groups of C3H/HeN mice (10 mice per group) were immunized on days 0, 14 and 28 days s.c. with STF2Δ.EIII (SEQ ID NO: 72; 25 μg), STF2Δ (18 μg), WNV-EIIIs+ (7 μg), and a mixture of STF2Δ (18 μg) and WNV-EIIIs+ (7 μg). Doses were chosen to ensure that molar equivalents of each antigen were administered in PBS. On day 35, sera were harvested and tested by ELISA for flagellin (81A) and WNV-E (81B)-specific IgG responses. Purified flagellin (STF2) and 80% WNE-E protein were used as antigens for antibody detection. Results reflect the mean±standard error OD450 values obtained from 10 individual animals per group.
[0143] FIG. 82 depicts percent survival of immunized mice depicted in FIGS. 81A and 81B challenged with a lethal dose (LD90) of WNV-strain 2741 and monitored for survival for 21 days.
[0144] FIGS. 83A and 83B depict IgG responses following immunization of wild type or TLR5 knockout (ko) C57BL/6 mice with the STF2Δ.EIII+ fusion protein (SEQ ID NO: 72). Wild type and TLR5ko mice (5 mice per group) were immunized with PBS, or 25 μg of the STF2Δ.EIII+ fusion protein s.c. on days 0 and 21, and sera were collected on day 28. Anti-flagellin and anti-E IgG responses were examined by ELISA. The data depict the mean±standard deviation of 5 individual sera per group.
[0145] FIGS. 84A, 84B and 84C depict immunogenicity of STF2Δ.JEIII+ (SEQ ID NO: 76) in C57BL/6 mice. Mice (20 mice per group) were immunized with PBS, 2.5 μg of STF2Δ.JEIIIs+ (SEQ ID NO: 76) on days 0, 14, or 28 and bled on day 7 (primary), day 21 (boost 1), and day 35 (boost 2). Anti-JE-his IgG responses were examined by ELISA. The data depict the mean±SD of 20 individual sera per group.
[0146] FIG. 85 depicts the percent survival of mice depicted in FIGS. 84A, 84B and 84C. Following the third immunization, 10 mice from each group were challenged with of the Nakayama JE virus by i.p. administration with a viral dose of 10×LD50. Survival was monitored for 21 days.
DETAILED DESCRIPTION OF THE INVENTION
[0147] The features and other details of the invention, either as steps of the invention or as a combination of parts of the invention, will now be more particularly described and pointed out in the claims. It will be understood that the particular embodiments of the invention are shown by way of illustration and not as limitations of the invention. The principle features of this invention can be employed in various embodiments without departing from the scope of the invention.
[0148] The present invention relates to compositions, fusion proteins and polypeptides of at least a portion of at least one antigen and at least a portion of a flagellin that lacks a hinge region; and at least a portion of at least one pathogen-associated molecular pattern (PAMP) and at least a portion of at least one flavivirus. The compositions, fusion proteins and polypeptides of the invention can be employed in methods to stimulate an immune response and protective immunity in a subject.
[0149] In one embodiment, the invention is a composition comprising at least a portion of at least one antigen and at least a portion of at least one flagellin, wherein at least one of the flagellins lacks at least a portion of a hinge region.
[0150] Pathogen-associated molecular pattern (PAMP), such as a flagellin or a bacterial lipoprotein, refers to a class of molecules (e.g., protein, peptide, carbohydrate, lipid, lipopeptide, nucleic acid) found in microorganisms that, when bound to a pattern recognition receptor (PRR), can trigger an innate immune response. The PRR can be a Toll-like receptor (TLR). Toll-like receptors refer to a family of receptor proteins that are homologous to the Drosophila melangogaster Toll protein. Toll-like receptors are type I transmembrane signaling receptor proteins characterized by an extracellular leucine-rich repeat domain and an intracellular domain homologous to an interleukin 1 receptor. Toll-like receptors include TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR 8, TLR9, TLR10, TLR11 and TLR12.
[0151] The pathogen-associated molecular pattern can be an agonist of a toll-like receptor, for example, a TLR2 agonist (i.e., Pam2Cys, Pam3Cys, a bacterial lipoprotein) or a TLR5 agonist, such as a flagellin. "Agonist," as used herein in referring to a TLR, means a molecule that activates a TLR signaling pathway. A TLR signaling pathway is an intracellular signal transduction pathway employed by a particular TLR that can be activated by a TLR ligand or a TLR agonist. Common intracellular pathways are employed by TLRs and include, for example, NF-κB, Jun N-terminal kinase and mitogen-activated protein kinase. The pathogen-associated molecular pattern can include at least one member selected from the group consisting of a TLR1 agonist, a TLR2 agonist (e.g., Pam3Cys, Pam2Cys, bacterial lipoprotein), a TLR3 agonist (e.g., dsRNA), a TLR4 agonist (e.g., bacterial lipopolysaccharide), a TLR5 agonist (e.g., a flagellin), a TLR6 agonist, a TLR7 agonist, a TLR8 agonist, a TLR9 agonist (e.g., unmethylated DNA motifs), TLR10 agonist, a TLR11 agonist and a TLR12 agonist.
[0152] TLR4 ligands (e.g., TLR4 agonists) for use in the compositions and methods of the invention can include at least one member selected from the group consisting of SEQ ID NOS: 184-231 (see, PCT/US 2006/002906/WO 2006/083706; PCT/US 2006/003285/WO 2006/083792; PCT/US 2006/041865; PCT/US 2006/042051; U.S. application Ser. No. 11/714,873).
TABLE-US-00001 (SEQ ID NO: 184) GGKSGRTG (SEQ ID NO: 185) KGYDWLVVG (SEQ ID NO: 186) EDMVYRIGVP (SEQ ID NO: 187) VKLSGS (SEQ ID NO: 188) GMLSLALF (SEQ ID NO: 189 CVVGSVR (SEQ ID NO: 190) IVRGCLGW (SEQ ID NO: 191) AAEERTLG (SEQ ID NO: 192) WARVVGWLR (SEQ ID NO: 193) SEGYRLFGG (SEQ ID NO: 194) LVGGVVRRGS (SEQ ID NO: 195) GRVNDLWLAA (SEQ ID NO: 196) SGWMLWREGS (SEQ ID NO: 197) ERMEDRGGDL (SEQ ID NO: 198) KLCCFTECM (SEQ ID NO: 199) AVGSMERGRG (SEQ ID NO: 200) RDWVGGDLV (SEQ ID NO: 201) FFEVAKISQQ (SEQ ID NO: 202) WWYWC (SEQ ID NO: 203) MHLCSHA (SEQ ID NO: 204) WLFRRIG (SEQ ID NO: 205) YWFWRIG (SEQ ID NO: 206) MHLYCIA (SEQ ID NO: 207) WPLFPWIV (SEQ ID NO: 208) DMRSHAR (SEQ ID NO: 209) MHLCTHA (SEQ ID NO: 210) NLFPFY (SEQ ID NO: 211) MHLCTRA (SEQ ID NO: 212) RHLWYHA (SEQ ID NO: 213) WPFSAYW (SEQ ID NO: 214) WYLRGS (SEQ ID NO: 215) GKGTDLG (SEQ ID NO: 216) IFVRMR (SEQ ID NO: 217) WLFRPVF (SEQ ID NO: 218) FLGWLMG (SEQ ID NO: 219) MHLWHHA (SEQ ID NO: 220) WWFPWKA (SEQ ID NO: 221) WYLPWLG (SEQ ID NO: 222) WPFPRTF (SEQ ID NO: 223) WPFPAYW (SEQ ID NO: 224) FLGLRWL (SEQ ID NO: 225) SRTDVGVLEV (SEQ ID NO: 226) REKVSRGDKG (SEQ ID NO: 227) DWDAVESEYM (SEQ ID NO: 228) VSSAQEVRVP (SEQ ID NO: 229) LTYGGLEALG (SEQ ID NO: 230) VEEYSSSGVS (SEQ ID NO: 231) VCEVSDSVMA
[0153] TLR2 ligands (e.g., TLR2 agonists) for use in the compositions and methods of the invention can also include at least one member selected from the group consisting of SEQ ID NOS: 232-271 (see, PCT/US 2006/002906/WO 2006/083706; PCT/US 2006/003285/WO 2006/083792; PCT/US 2006/041865; PCT/US 2006/042051; U.S. application Ser. No. 11/714,873).
TABLE-US-00002 (SEQ ID NO: 232) NPPTT (SEQ ID NO: 233) MRRIL (SEQ ID NO: 234) MISS (SEQ ID NO: 235) RGGSK (SEQ ID NO: 236) RGGF (SEQ ID NO: 237) NRTVF (SEQ ID NO: 238) NRFGL (SEQ ID NO: 239) SRHGR (SEQ ID NO: 240) IMRHP (SEQ ID NO: 241) EVCAP (SEQ ID NO: 242) ACGVY (SEQ ID NO: 243) CGPKL (SEQ ID NO: 244) AGCFS (SEQ ID NO: 245) SGGLF (SEQ ID NO: 246) AVRLS (SEQ ID NO: 247) GGKLS (SEQ ID NO: 248) VSEGV (SEQ ID NO: 249) KCQSF (SEQ ID NO: 250) FCGLG (SEQ ID NO: 251) PESGV (SEQ ID NO: 252) DPDSG (SEQ ID NO: 253) IGRFR (SEQ ID NO: 254) MGTLP (SEQ ID NO: 255) ADTHQ (SEQ ID NO: 256) HLLPG (SEQ ID NO: 257) GPLLH (SEQ ID NO: 258) NYRRW (SEQ ID NO: 259) LRQGR (SEQ ID NO: 260) IMWFP (SEQ ID NO: 261) RVVAP (SEQ ID NO: 262) IHVVP (SEQ ID NO: 263) MFGVP (SEQ ID NO: 264) CVWLQ (SEQ ID NO: 265) IYKLA (SEQ ID NO: 266) KGWF (SEQ ID NO: 267) KYMPH (SEQ ID NO: 268) VGKND (SEQ ID NO: 269) THKPK (SEQ ID NO: 270) SHIAL (SEQ ID NO: 271) AWAGT
[0154] The TLR2 ligand (e.g., TLR2 agonist) can also include at least a portion of at least one member selected from the group consisting of flagellin modification protein FlmB of Caulobacter crescentus; Bacterial Type III secretion system protein; invasin protein of Salmonella; Type 4 fimbrial biogenesis protein (PilX) of Pseudomonas; Salmonella SciJ protein; putative integral membrane protein of Streptomyces; membrane protein of Pseudomonas; adhesin of Bordetella pertusis; peptidase B of Vibrio cholerae; virulence sensor protein of Bordetella; putative integral membrane protein of Neisseria meningitidis; fusion of flagellar biosynthesis proteins FliR and FlhB of Clostridium; outer membrane protein (porin) of Acinetobacter; flagellar biosynthesis protein FlhF of Helicobacter; ompA related protein of Xanthomonas; omp2a porin of Brucella; putative porin/fimbrial assembly protein (LHrE) of Salmonella; wbdk of Salmonella; Glycosyltransferase involved in LPS biosynthesis; Salmonella putative permease.
[0155] The TLR2 ligand (e.g., TLR agonist) can include at least a portion of at least one member selected from the group consisting of lipoprotein/lipopeptides (a variety of pathogens); peptidoglycan (Gram-positive bacteria); lipoteichoic acid (Gram-positive bacteria); lipoarabinomannan (mycobacteria); a phenol-soluble modulin (Staphylococcus epidermidis); glycoinositolphospholipids (Trypanosoma Cruzi); glycolipids (Treponema maltophilum); porins (Neisseria); zymosan (fungi) and atypical LPS (Leptospira interrogans and Porphyromonas gingivalis).
[0156] The TLR2 ligand (e.g., TLR2 agonist) can also include at least one member selected from the group consisting of SEQ ID NOS: 272-274 (see, PCT/US 2006/002906/WO 2006/083706; PCT/US 2006/003285/WO 2006/083792; PCT/US 2006/041865; PCT/US 2006/042051; U.S. application Ser. No. 11/714,873).
TABLE-US-00003 (SEQ ID NO: 272) KGGVGPVRRSSRLRRTTQPG (SEQ ID NO: 273) GRRGLCRGCRTRGRIKQLQSAHK (SEQ ID NO: 274) RWGYHLRDRKYKGVRSHKGVPR
[0157] In a particular embodiment, the TLR2 agonist is a bacterial lipoprotein, such as Pam2Cys, Pam3Cys or Pseudomonas aeruginosa OprI lipoprotein (OprI). Exemplary OprI lipoproteins include MNNVLKFSALALAAVLATGCSSH (SEQ ID NO: 179), encoded by ATGAAAGCTACTAAACTGGTACTGGGCGCGGTAATCCTGGGTTCTACTCTGC TGGCAGGTTGCTCCAGCAAC (SEQ ID NO: 180). An exemplary E. coli bacterial lipoprotein for use in the invention described herein is MKATKLVLGAVILGSTLLAGCSSN (SEQ ID NO: 181) encoded by ATGAAAGCTACTAAACTGGTACTGGGCGCGGTAATCCTGGGTTCTACTCTGC TGGCAGGTTGCTCCAGCAAC (SEQ ID NO: 182). A bacterial lipoprotein that activates a TLR2 signaling pathway (a TLR2 agonist) is a bacterial protein that includes a palmitoleic acid (Omueti, K. O., et al., J. Biol. Chem. 280: 36616-36625 (2005)). For example, expression of SEQ ID NOS: 180 and 182 in bacterial expression systems (e.g., E. coli) results in the addition of a palmitoleic acid moiety to a cysteine residue of the resulting protein (e.g., SEQ ID NOS: 179, 181) thereby generating a TLR2 agonist for use in the compositions, fusion proteins and polypeptides of the invention. Production of tripalmitoylated-lipoproteins (also referred to as triacyl-lipoproteins) in bacteria occurs through the addition of a diacylglycerol group to the sulfhydryl group of a cysteine (Cysteine 21 of SEQ ID NO: 181) followed by cleavage of the signal sequence and addition of a third acyl chain to the free N-terminal group of the same cysteine (Cysteine 21 of SEQ ID NO: 181) (Sankaran, K., et al., J. Biol. Chem. 269:19706 (1994)), to generate a tripalmitylated peptide (a TLR2 agonist) as shown, for example, in FIG. 80.
[0158] An antigen is any molecule (e.g., protein, peptide, glycoprotein, glycopeptide, carbohydrate, lipid, lipopeptide, polysaccharide) that generates an immune response in a subject either when employed in combination with a PAMP (e.g., a flagellin, Pam2Cys, Pam3Cys) or in the absence of a PAMP. The antigen can be a fragment or portion of a naturally occurring antigen or a synthetic molecule that mimics the naturally occurring antigen or a portion of the naturally occurring antigen.
[0159] The antigen can be a viral antigen. A "viral antigen," as used herein, refers to any portion of a virus (e.g., flavivirus) that generates an immune response in a subject either when employed in combination with a PAMP (e.g., a flagellin, Pam2Cys, Pam3Cys) or in the absence of a PAMP. The viral antigen can be a portion or a fragment of a naturally occurring virus or a synthetic molecule that mimics a naturally occurring virus, such as a recombinant or synthetic protein (e.g., a flavivirus), peptide, lipid, carbohydrate, that generates an immune response in the subject. "At least a portion," as used herein in reference to at least a portion of an antigen (e.g., a viral antigen), means any part of the antigen or the entirety of the antigen. For example, at least a portion of a flaviviral antigen can be an envelope protein, or a domain (e.g., domain I, II, III) of an envelope protein of a flavivirus antigen.
[0160] The flagellin employed in the compositions, fusion proteins and polypeptides of the invention can lack at least a portion of a hinge region. Hinge regions are the hypervariable regions of a flagellin that link the amino-terminus and carboxy-terminus of the flagellin. Hinge regions of a flagellin are also referred to herein as "hypervariable regions" or "hypervariable hinge regions." "Lack," as used herein in reference to a hinge region of a flagellin, means that at least one amino acid or at least one nucleic acid codon encoding at least one amino acid that comprises the hinge region of a flagellin is absent in the flagellin. Example of hinge regions include amino acids 176-415 of SEQ ID NO: 1, which are encoded by nucleic acids 528-1245 of SEQ ID NO: 2; amino acids 174-422 of SEQ ID NO: 68, which are encoded by nucleic acids 522-1266 of SEQ ID NO: 69; or amino acids 173-464 of SEQ ID NO: 58, which are encoded by nucleic acids 519-1392 of SEQ ID NO: 59. Thus, if amino acids 176-415 were absent from the flagellin of SEQ ID NO: 1, the flagellin would lack a hinge region. A flagellin lacking at least a portion of a hinge region is also referred to herein as a "truncated version" of a flagellin.
[0161] "At least a portion of a hinge region," as used herein, refers to any part of the hinge region of the PAMP (e.g., flagellin), or the entirety of the hinge region. "At least a portion of a hinge region" is also referred to herein as a "fragment of a hinge region." For example, the hinge region of S. typhimurium flagellin B (fljB, also referred to herein as "fljB/STF2" or "STF2") is amino acids 176-416 of SEQ ID NO: 1, which is encoded by nucleic acids at position 528-1245 of SEQ ID NO: 2. At least a portion of the hinge region of fljB/STF2 can be, for example, amino acids 200-300 of SEQ ID NO: 1. Thus, if amino acids 200-300 were absent from SEQ ID NO: 1, the resulting amino acid sequence of STF2 would lack at least a portion of a hinge region.
[0162] At least a portion of a naturally occurring a flagellin can be replaced with at least a portion of an artificial hinge region. "Naturally occurring," as used herein in reference to a hinge region of a flagellin, means the hinge region that is present in the native flagellin. For example, amino acids 176-415 of SEQ ID NO: 1, amino acids 174-422 of SEQ ID NO: 68 and amino acids 173-464 of SEQ ID NO: 58, are the amino acids corresponding to the natural hinge region of STF2, E. coli fliC and S. muenchen flagellins, fliC, respectively. "Artificial," as used herein in reference to a hinge region of a flagellin, means a hinge region that is inserted in the native flagellin in any region of the flagellin that contains or contained the native hinge region. For example, SEQ ID NO: 32 lacks the naturally occurring hinge region, which has been replaced by amino acids 176-186, the artificial hinge region.
[0163] An artificial hinge region may be employed in a flagellin that lacks at least a portion of a hinge region to facilitate interaction of the carboxy- and amino-terminus of the flagellin for binding to TLR5 and, thus, activation of the TLR5 innate signal transduction pathway. A flagellin lacking at least a portion of a hinge region is designated by the name of the flagellin followed by a "Δ." For example, an STF2 (e.g., SEQ ID NO: 1) that lacks at least a portion of a hinge region is referenced to as "STF2Δ" or "fljB/STF2Δ" (e.g., SEQ ID NO: 3).
[0164] The flagellin employed in the compositions, fusion proteins and polypeptides of the invention can be at least one member selected from the group consisting of fljB/STF2 (S. typhimurium flagellin B, Genbank Accession Number AF045151), a fragment of fljB/STF2, E. coli flagellin fliC (also referred to herein as E. coli fliC) (Genbank Accession Number AB028476), a fragment of E. coli flagellin fliC, S. muenchen flagellin fliC (also referred to herein as S. muenchen fliC), and a fragment of S. muenchen flagellin fliC.
[0165] The flagellin employed in the compositions, fusion proteins and polypeptides of the invention include the polypeptides of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 58 and SEQ ID NO: 68; at least a portion of SEQ ID NO: 1, at least a portion of SEQ ID NO: 3, at least a portion of SEQ ID NO: 58 and at least a portion of SEQ ID NO: 68; and a polypeptide encoded by SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 59 and SEQ ID NO: 69; or at least a portion of a polypeptide encoded by SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 59 and SEQ ID NO: 69.
[0166] In another embodiment, the invention is a fusion protein comprising at least a portion of at least one antigen and at least a portion of at least one flagellin, wherein at least one of the flagellins lack at least a portion of a hinge region.
[0167] "Fusion protein," as used herein, refers to a protein generated from at least two similar or distinct components (e.g., Pam2Cys, Pam3Cys, PAMP, at least a portion of an antigen, at least a portion of a viral protein) that are linked covalently or noncovalently. The components of the fusion protein can be made, for example, synthetically (e.g., Pam3Cys, Pam2Cys) or by recombinant nucleic acid techniques (e.g., transfection of a host cell with a nucleic acid sequence encoding a component of the fusion protein, such as at least a portion of a PAMP, or at least a portion of an antigen or a viral protein). One component of the fusion protein (e.g., Pam2Cys, Pam3Cys, PAMP, at least a portion of an antigen or at least a portion of a viral protein) can be linked to another component of the fusion protein (e.g., Pam2Cys, Pam3Cys, PAMP, at least a portion of an antigen or at least a portion of a viral protein) using chemical conjugation techniques, including peptide conjugation, or using molecular biological techniques, including recombinant technology, such as the generation of a fusion protein construct. Chemical conjugation (also referred to herein as "chemical coupling") can include conjugation by a reactive group, such as a thiol group (e.g., a cysteine residue) or by derivatization of a primary (e.g., a amino-terminal) or secondary (e.g., lysine) group. Exemplary fusion proteins of the invention include SEQ ID NOS: 6, 71, 72, 76, 80, 82, 84, 86 and 159 (FIGS. 6, 29, 30, 32, 36, 38, 40 and 42), encoded by SEQ ID NOS: 5, 70, 73, 77, 81, 83, 85, 87 and 158 (FIGS. 5, 28, 31, 33, 37, 39, 41 and 43)
[0168] Fusion proteins of the invention can be designated by components of the fusion proteins separated by a "." or "-." For example, "STF2.EIII" refers to a fusion protein comprising one fljB/STF2 protein and at least a portion of domain III (see, infra) of at least one West Nile virus envelope protein; and "STF2Δ.EIII" refers to a fusion protein comprising one fljB/STF2 protein lacking at least a portion of its hinge region and having at least a portion of domain III of at least one West Nile virus envelope protein.
[0169] In yet another embodiment, the invention is a composition comprising at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one viral protein selected from the group consisting of a West Nile viral protein, a Langat viral protein, a Kunjin viral protein, a Murray Valley encephalitis viral protein, a Japanese encephalitis viral protein, a Tick-borne encephalitis viral protein, and a Yellow fever viral protein, which are flaviviral proteins. The pathogen-associated molecular pattern and viral protein can be components of a fusion protein.
[0170] The genus flavivirus is in the virus family Flaviviridae and consists of about 70 viruses. Mosquito or ticks transmit most of these viruses. Several flaviviruses are significant human pathogens, including the four dengue viruses (Den1, Den2, Den3 and Den4), yellow fever (YF), Japanese encephalitis (JE), West Nile (WN, also referred to herein as "WNV") and Tick-borne encephalitis (TBE) (Weaver S. C., et al., Nat Rev Microbiol 10: 789-801 (2004)). The flavivirus genus is divided into a number of serogroups based on cross-neutralization tests, including the dengue serogroup that contains four serologically and genetically distinct viruses termed DEN-1, DEN-2, DEN-3 and DEN-4.
[0171] Flaviviruses are small, enveloped viruses with icosahedral capsids. The flavivirus genome is a single-stranded positive-sense RNA (about 11 kb) that is directly translated by the host cell machinery following infection. The viral genome is translated as a single polypeptide that undergoes co- and post-translational cleavage by viral and cellular enzymes to generate three structural proteins of the flavivirus (the capsid (C), the membrane (M) and the envelope (E) proteins); and seven nonstructural proteins (NS1, NS2A, NS2B, NS3, NS4A, NS4B, and NS5) (Weaver, et al., Annu Rev Microbiol 1990:44-649 (2004)). The flavivirus genome organization is depicted in FIG. 44. The viral capsid is composed of the C-protein, while both the M- and envelope proteins are located on the envelope surface of the virion (Weaver, S. C., et al., Nat. Rev. Microbiol. 10:789-801 (2004); Chambers et al., Annu Rev. Microbiol. 44: 649-688 (1990)). A major immunogen for flaviviruses is the membrane envelope protein.
[0172] The flavivirus envelope protein plays a role in virus assembly. These proteins form a protective shell around the virus, which serves as a cage for the genetic material inside, sheltering the virus until it is released inside a host cell. While simple viruses consist of only a protein shell and genetic information, more complex viruses, such as flaviviruses, also contain a lipid bilayer between the protein shell and viral genome. A flavivirus can enter a host cell when the viral envelope protein binds to a receptor and responds by conformational rearrangement to the reduced pH of an endosome. The conformational change induces fusion of viral and host-cell membranes.
[0173] The envelope of a flavivirus may function as a receptor binding protein and to facilitate fusion of the virus and host cell membrane. As a receptor binding protein, the envelope protein is a determinant of host range, cell tropism, virulence and elicits neutralizing antibodies during the immune response (Roehrig, Adv Virus Res 59:141-175 (2003)). The envelope protein is responsible for fusing the virus and host membranes (Chu, et al., J. Virol 78:10543-10555 (2004); Heinz, et al., Adv Virus Res 59:63-97 (2003); Chu, et al., J. Gen Virol 86:405-412 (2005)). Crystallographic structures of the Tick-borne encephalitis virus envelope protein and the Dengue-2 (Den 2) virus envelope protein have been determined (Rey, et al., Nature 375:291-298 (1995); Modis, et al., Proc Natl Acad Sci USA 100:6986-6991 (2003)). Envelope proteins of flaviviruses have common structural (domains I, II and III) and functional features (receptor binding of virus and host cell and fusion functions) and are class II fusion glycoproteins (Lescar et al., Cell 105:137-148 (2001)).
[0174] In the pre-fusion conformation, envelope proteins form homodimers on the outer surface of the virus particles (Rey, et al., Nature 375:291-298); Kuhn, et al., Cell 108:717-725 (2002); Mukhopadhyay, et al., Science 302:248 (2003)). Each envelope protein monomer folds into three structural domains (domains I, II and III) predominantly composed of β-strands. Domain I (also referred to herein as "I" or "DI") is centrally located in the structure and has an N-glycosylation site in glycosylated envelope proteins. Domain II (also referred to herein as "II" or "DII") of the envelope protein promotes dimerization and has a fusion loop that inserts into the target host membrane during the pH-dependent fusion of the virus (Modis, et al., Nature 427:313-319 (2004); Bressanelli, et al., EMBO J 23:728-738 (2004)). Domain III (also referred to herein as "III" or "DIII") is at the carboxy-terminus of the envelope protein. Domain III is also referred to as "domain B" in earlier antigenic mapping studies. Domain III has several epitopes that can elicit virus-neutralizing antibodies (Roehrig, Adv Virus Res 59:141-175 (2003)). In addition, studies with several flaviviruses, including Tick-borne encephalitis (Mandle, et al., J. Virol 75:5627-5637 (2001)), indicate that domain III, which has a fold typical of an immunoglobulin constant domain, may mediate flavivirus attachment to host cells (Anderson, Adv Virus Res 59:229-274 (2003)) and, thus, be a receptor-binding domain.
[0175] The crystal structure of domains I, II and III of the envelope protein from the Tick-borne encephalitis flavivirus and the Dengue 2 flavivirus has been determined (Rey, F. A., et al., Nature 375:291-298 (1995); Modis, Y., et al., Nature 427:313-319 (2004), respectively). Domain I of the Tick-borne encephalitis envelope protein corresponds to amino acids 1-51, 137-189 and 285-302 of SEQ ID NO: 174; domain II of the Tick-borne encephalitis envelope protein of SEQ ID NO: 174 corresponds to amino acids 52-136 and 190-284; and domain III corresponds to amino acids 303-395 of SEQ ID NO: 174. (Rey, F. A., et al., Nature 375:291-298 (1995)). SEQ ID NO: 174 (FIG. 44) is encoded by SEQ ID NO: 175 (FIG. 78). Domain I of the Dengue 2 flavivirus envelope protein corresponds to amino acids 1-52, 132-193 and 280-296 of SEQ ID NO: 160 (FIG. 70); domain II corresponds to amino acids 53-131 and 194-279 of SEQ ID NO: 160; and domain III corresponds to amino acids 297-495 of SEQ ID NO: 160 (Modis, Y., et al., Nature 427:313-319 (2004)). The location of domains I, II and III of other flavivirus (e.g., West Nile virus, Japanese encephalitis, Dengue 1 virus, Dengue 3 virus and Dengue 4 virus) is based on homology of the Tick-borne encephalitis envelope protein domains and the Dengue 2 envelope protein domains. Thus, reference herein to domains of flavivirus proteins, in particular, flaviviruses other than Tick-borne encephalitis flavivirus envelope proteins and Dengue 2 flavivirus envelope proteins, are based on homology to domains in the Tick-borne encephalitis flavivirus envelope protein and the Dengue 2 flavivirus envelope protein.
[0176] The domain III of the envelope protein of the DEN flavivirus encodes the majority of the flavivirus type-specific contiguous critical/dominant neutralizing epitopes (Roehring, J. T., Adv. Virus Res. 59:141 (2003)), including the four DEN (DEN1, DEN2, DEN3, DEN4) viruses. Flavivirus envelope proteins are highly homologous. Exemplary envelope protein sequences are shown in FIGS. 45, 68, 70, 72, 74 and 77 (SEQ ID NOs: 39, 160, 162, 164, 166 and 171, respectively).
[0177] The seven nonstructural proteins of flavivirus envelope proteins are involved in the replication of the virus. NS3 is a multifunctional enzyme that encodes a serine protease at the aminus-terminal region; and helicase, RNA triphosphatase and NTPase activities in the carboxy-terminal region. NS5 encodes a methyltransferase and the RNA-dependent-RNA polymerase. NS2A, NS2B, NS4A and NS4B are four poorly characterized proteins. The central domain of NS2B is a co-factor for the NS3 serine protease while NS2A and NS4A are known to be components of the replication complex. NS 1 is located at both the plasma membrane and in the lumen of intracellular vesicles of virus-infected cells. NS1 is a multifunctional protein that is associated with an early step in the replication cycle either prior to or early in negative-strand RNA synthesis and is also thought to be involved in virus maturation and/or release (Brinton, M. A., Annu Rev Microbiol 56:371 (2002)).
[0178] West Nile virus (WNV) is a single-stranded positive sense RNA envelope virus. It was first isolated and identified in the West Nile region of Uganda in 1937 from a febrile female adult (Smithburn, et al., Am J Trop Med Hyg 3:9-18 (1954)). West Nile Virus has been classified as a member of the family Flaviviridae using cross-neutralization tests with polyclonal antisera (Boctor, et al., J. Virol Methods 26:305-311 (1989)). West Nile virus is neuroinvasive (George, et al., Bull WHO 62:879-882 (1984)); and severe human meningoencephalitis might occur consequent to infection with West Nile virus, as seen in the outbreaks in North America (CDC, Update: West Nile Virus Encephalitis--New York 1999, MMWR Morbid Mortal Wkly Rep 48:994-946; CDC, Update: West Nile Virus Encephalitis--New York 1999. MMWR Morbid Mortal Wkly Rep 51:1135-1136). During 1999-2002, WNV extended its range throughout much of the eastern part of the United States, and its range within the western hemisphere is expected to continue to expand. Birds are the natural reservoir hosts, and WNV is maintained in nature in a mosquito-bird-mosquito transmission cycle primarily involving Culex species mosquitoes.
[0179] Recently, West Nile virus has emerged in temperate regions of Europe and North America, presenting a threat to public and animal health. The most serious manifestation of WNV infection is fatal encephalitis (inflammation of the brain) in humans and horses, as well as mortality in certain domestic and wild birds. West Nile virus infection has also been a significant cause of human illness in the United States. The envelope glycoprotein of the West Nile virus (WNV-E) and other flaviviruses may be important in formulating compositions to stimulate an immune response to generate neutralizing and protective antibodies. Currently, there are no compositions that prevent West Nile virus infection, for example, by stimulating an immune response in a subject.
[0180] Japanese encephalitis (JE) virus is localized in Asia and northern Australia (about 50,000 cases with about 10,000 deaths annually). A composition comprising an inactivated virus was recently associated with a case of acute disseminated encephalomyelitis, prompting the Japanese Ministry of Health, Labor and Welfare to recommend the nationwide suspension of compositions comprising inactivated virus.
[0181] The Dengue (DEN) disease is caused by four mosquito-borne, serologically related flaviviruses known as DEN-1 (also referred to herein as "Den1" or Den 1"), DEN-2 (also referred to herein as "Den2" or "Den 2"), DEN-3 (also referred to herein as "Den3" or "Den 3"), and DEN-4 (also referred to herein as "Den4" or Den 4"), and is an important arboviral disease of humans. DEN is a major public health problem in all tropical areas of the world. About three billion people are at risk for DEN and about 50 to about 100 million cases of dengue fever (DF) and hundreds of thousands of cases of dengue hemorrhagic fever (DHF) occur in the tropics each year, including Mexico, the Caribbean and parts of Asia and the South Pacific (Gubler, D. J., Ann Acad Med Singapore 27: 227-34 (1998)). Dengue viruses are transmitted by peridomestic Aedes spp. mosquitoes, which inhabit the tropics, allowing endemicity of DF in these areas. Infection by one virus causes Dengue Fever (DF), a febrile illness, which is not normally life-threatening, and leads to life-long protective immunity against the infecting DEN serotype/virus. However, individuals that are infected by one serotype/virus remain susceptible to infection by the other three DEN serotypes/viruses. Subsequent infection by one of the other DEN serotypes/viruses can lead to Dengue hemorrhagic fever (DHF) or dengue shock syndrome (DSS), which are life-threatening diseases.
[0182] DHF may be the result of an antibody dependent enhancement (ADE) where non-neutralizing antibodies induced by the primary DEN infection form virus-antibody complexes in secondary infections that are taken up into macrophages by Fc receptors and, thus, enhance virus infection. About 500,000 cases of DHF occur each year, mostly in children, with a fatality rate of about 5%. About 600 million children are at risk for DEN infections, about 60 million may get DEN infections each year, and about 60,000 may be hospitalized. In addition, to the public health problem, military personnel are often sent overseas to tropical areas of the world where DEN viruses are found. Significant numbers of soldiers succumb to DEN while performing overseas, such as in Somalia, Grenada, Viet Nam and the Gulf conflicts. Attempts to develop a DEN vaccine have proved difficult due to the need to develop a tetravalent vaccine that protects against all four DEN serotypes/viruses.
[0183] Methods to prevent flavivirus disease include vaccines to the flaviviruses (Barrett, A. D., Ann. N.Y. Acad. Sci. 951:262 (2001). These compositions can be divided into two categories: live attenuated and inactivated. Compositions comprising live flavivirus have been developed for YF and JE based on strains 17D and SA14-14-2, respectively, and were derived by empirical passage in chicken and hamster tissue, respectively. SA14-14-2 is produced in the People's Republic of China, grown in primary hamster kidney cell culture and very recently has been approved for use outside China. Both compositions are efficacious and require one or two doses, respectively, to develop protective immunity. There are inactivated virus compositions for JE and TBE. The inactivated JE compositions are based on strains Nakayama, Beijing-1 or P3, while inactivated TBE compositions are based on Central European TBE strains Neudorfl and K23, and Russian Spring Summer encephalitis strains Sofjin and 205. These killed flavivirus compositions require about two doses (given about 1 week to about 2 months apart), a booster dose at about one year and periodic boosters about every 3 to about 4 years. The antibody-mediated immunity, in particular neutralizing antibodies, may be important in preventing flavivirus disease. Long-lived neutralizing antibody responses following administration of compositions to treat flavivirus disease or to prevent flavivirus disease may also be important.
[0184] Many different approaches have been taken to develop compositions to prevent flavivirus infection, but many have not been successful. With respect to the disease DEN, which is the result of four related viruses (DEN1, DEN2, DEN3, DEN4), a composition may need to be developed to one or more the DEN flaviviruses. For example, a tetravalent (DEN1, DEN2, DEN3 and DEN4) composition may stimulate an immune response simultaneously against all four DEN viruses and thereby eliminate the potential of antibody dependent enhancement.
[0185] Currently, there is no effective compositions to prevent infection by many flaviviruses, including West Nile virus, Dengue virus, Tick-borne virus, Kunjun virus, Murray Valley encephalitis virus and Yellow fever virus (Chang, G. J., et al., Expert Rev. Vaccine 3:199 (2004)). Attenuation and immunogenicity may occur in compositions with live attenuated flavivirus. Furthermore, compositions with tetravalent live Dengue flaviviruses may have problems with interference and imbalanced immune response resulting in many compositions being tested with variation in the quantity of each of the four DEN viruses. Compositions comprising inactivated flavivirus may have problems with immunogenicity and the need for multiple doses. In addition, the production of inactivated flavivirus compositions in infected mouse brains or cell culture can be complex, tedious, may result in unknown hazards if not properly inactivated and may result in adverse effects when administered to subjects. Thus, there is a need to develop new compositions for use in the prevention of flavivirus infection in subjects.
[0186] The compositions, fusion proteins and polypeptides of the invention employ pathogen-associated molecular patterns that trigger cellular events resulting in the expression of costimulatory molecules, secretion of critical cytokines and chemokines; and efficient processing and presentation of antigens to T-cells. As discussed above, TLRs recognize PAMPs including bacterial cell wall components (e.g., bacterial lipoproteins and lipopolysaccharides), bacterial DNA sequences that contain unmethylated CpG residues and bacterial flagellin. TLRs act as initiators of the innate immune response and gatekeepers of the adaptive immune response (Medzhitov, R., et al., Cold Springs Harb. Symp. Quant. Biol. 64:429 (1999); Pasare, C., et al., Semin, Immunol 16:23 (2004); Medzhitov, R., et al., Nature 388:394 (1997); Barton, G. M., et al., Curr. Opin. Immunol 14:380 (2002); Bendelac, A., et al., J. Exp. Med. 195:F19 (2002)).
[0187] As discussed above, the binding of PAMPs to TLRs activates immune pathways for use in the compositions, fusion proteins and polypeptides of the invention, which can be employed in stimulating the immune system in a subject. The compositions, fusion proteins and polypeptides of the invention can trigger an immune response to an antigen (e.g., a viral protein, such as a flaviviral protein) and trigger signal transduction pathways of the innate and adaptive immune system of the subject to thereby stimulate the immune system of a subject. Stimulation of the immune system of the subject may prevent infection by an antigen or a virus (e.g., a flavivirus) and thereby treat the subject or prevent the subject from disease, illness and, possibly, death.
[0188] The compositions, fusion proteins and polypeptides of the invention, can include, for example, one, two, three, four, five, six or more pathogen-associated molecular patterns (e.g., Pam2Cys, Pam3Cys, flagellin) and one, two, three, four, five, six or more antigens. When two or more PAMPs and/or two or more antigens and/or viral proteins comprise the compositions, fusion proteins and polypeptides of the invention, they are also referred to as "multimers."
[0189] The pathogen-associated molecular pattern can be a TLR5 agonist (e.g., at least a portion of at least one flagellin). The flagellin can be at least one member selected from the group consisting of a fljB/STF2, an E. coli fliC, and a S. muenchen fliC. The flagellin can include fljB/STF2 (e.g., SEQ ID NO: 1) or a flagellin lacking a hinge region (e.g., SEQ ID NO: 3).
[0190] The pathogen-associated molecular pattern can be a TLR2 agonist. The TLR2 agonist includes at least one member selected from the group consisting of a Pam2Cys and a Pam3Cys. Pam3Cys is ([Palmitoyl]-Cys((RS)-2,3-di(palmitoyloxy)-propyl cysteine). Pam3Cys is also referred to herein as "P2." Pam2Cys is (S-[2,3-bis(palmitoyloxy)propyl]cysteine).
[0191] The viral protein for use in the compositions, fusion proteins and polypeptides of the invention can be an envelope protein of at least one member selected from the group consisting of a West Nile viral envelope protein, a Langat viral envelope protein, a Kunjin viral envelope protein, a Murray Valley encephalitis viral envelope protein, a Japanese encephalitis viral envelope protein, a Tick-borne encephalitis viral envelope protein, a Yellow fever viral envelope protein and a Dengue viral envelope protein.
[0192] The compositions, fusion proteins and polypeptides of the invention can employ any portion of the envelope protein of a flavivirus. The compositions, fusion proteins and polypeptides of the invention can include at least a portion of at least one member selected from the group consisting of domain I, domain II and domain III of an envelope protein of a flavivirus. "At least a portion," as used herein, in reference to a domain of an envelope protein, means any part of the envelope protein domain or the entirety of the envelope protein. For example, SEQ ID NOS: 88 and 100-151, include at least a portion of domain III of the West Nile virus envelope protein.
[0193] "EI," "EII," and "EIII," as used herein, refer to domains I, II and III, respectively, of the West Nile flavivirus envelope protein. "JEI," "JEII," and "JEIII," as used herein, refer to domains I, II and III, respectively, of the Japanese encephalitis flavivirus envelope protein. "Den1 I," "Den1 II," and "Den1 III," as used herein refer to domains I, II and III, respectively, of the Dengue 1 flavivirus envelope protein. Likewise, designations for the domains of envelope proteins of other flaviviruses are referenced by the flavivirus name followed by the domain number (e.g., (Tick-borne) TBI (Tick-borne), TBII, TBIII, Den2 I, Den2 II, Den2 III).
[0194] The portion of an envelope protein of a flavivirus employed in the compositions, fusion proteins and polypeptides of the invention can include at least one member selected from the group consisting of at least a portion of domain I, at least a portion of domain II and at least a portion of domain III. When a domain is designated with a "+," for example "EIII+" or "JEIII+," the portion of the envelope protein referenced as "III" is one component of the total of that domain plus at least one of at least a portion of either or both of domains I and II. For example, "EIII+," as used herein, means the compositions, fusion proteins and polypeptides of the invention include domain III and at least a portion of domain I. "EIII+" is also referred to as "EI/III." "JEIII+" is also referred to as "JEI/III." Similarly, when compositions, fusion proteins and polypeptides of the invention include domains of envelope proteins of flavivirus, the domains can be any combination of domains I, II, and III and can be designated based on the domain. For example, EI/II includes domain I and II of the West Nile flavivirus. The absence of a "+" in reference to a domain (e.g., EIII, JEIII, Den1 III) of an envelope protein employed in the compositions, fusion proteins and polypeptides of the invention means that the composition, fusion protein and polypeptide includes the referenced domain. For example, "Den1 III" means the compositions, fusion proteins and compositions include domain III, not domains I and II, of the Dengue 1 virus.
[0195] The West Nile viral envelope protein for use in the compositions, fusion proteins and polypeptides of the invention can include at least a portion of at least one member selected from the group consisting of MEKLQLKGTTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVA SLNDLTPVGRLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWH KSGSSIGK (SEQ ID NO: 7, which is an EIII+ amino acid sequence, the italicized amino acids are domain I of the envelope protein and the remaining sequence is domain III of the envelope protein); GTTYGVCSKAFKFARTPADTGHGTVVLELQYTGKDGPCKVPISSVASLNDLTP VGRLVTVNPFVSVATANSKVLIELEPPFGDSYIVVGRGEQQINHHWHKSG (SEQ ID NO: 8, West Nile virus, Stanford, Conn., also referred to as "West Nile S"); GTTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPV GRLVTVNPFVSVATANAKVLIELEPPFGDSYVVGRGEQQINHHWHKSG (SEQ ID NO: 9, West Nile virus, New York, N.Y., also referred to as "West Nile NY"); and ELEPPFGDSYIVVGRGEQQINHHWHKS (SEQ ID NO: 10). SEQ ID NO: 7 is encoded by ATGGAAAAATTGCAGTTGAAGGGAACAACCTATGGCGTCTGTTCAAAGGCT TTCAAGTTTCTTGGGACTCCCGCAGACACAGGTCACGGCACTGTGGTGTTGG AATTGCAGTACACTGGCACGGATGGACCTTGCAAAGTTCCTATCTCGTCAGT GGCTTCATTGAACGACCTAACGCCAGTGGGCAGATTGGTCACTGTCAACCCT TTTGTTTCAGTGGCCACGGCCAACGCTAAGGTCCTGATTGAATTGGAACCAC CCTTTGGAGACTCATACATAGTGGTGGGCAGAGGAGAACAACAGATCAATC ACCATTGGCACAAGTCTGGAAGCAGCATTGGCAAA (SEQ ID NO: 11). The West Nile viral envelope protein can include a protein that has at least about 70% identity, at least about 75% identity, at least about 80% identity, at least about 85% identity, at least about 90% identity, at least about 95% identity and at least about 99% identity to a polypeptide that includes SEQ ID NO: 7, which include portions of domains I and III (referred to herein as "EIII+") of the West Nile virus.
[0196] The Langat virus envelope protein for use in the compositions, fusion proteins and polypeptides of the invention can include at least a portion of GLTYTVCDKTKFTWKRAPTDSGHDTVVMEVGFSGTRPCRIPVRAVAHGVPEV NVAMLITPNPTMENNGGGFIEMQLPPGDNIIYVGDLNHQWFQKG (SEQ ID NO: 12). The Kunjin virus envelope protein can include at least a portion of GTTYGVCSKAFRFLGTPADTGHGTVVLELQYTGTDGPCKIPISSVASLNDLTPV GRLVTVNPFVSVSTANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKSG (SEQ ID NO: 13). The Murray Valley encephalitis envelope protein can include at least a portion of GTTYGMCTEKFTFSKNPADTGHGTVVLELQYTGSDGPCKIPISSVASLNDMTPV GRMVTANPYVASSTANAKVLVEIEPPFGDSYIVVGRGDKQINHHWHKEG (SEQ ID NO: 14). The Japanese encephalitis envelope protein can include at least one member selected from the group consisting of at least a portion of GTTYGMCTEKFSFAKNPADTGHGTVVIELSYSGSDGPCKIPIVSVASLNDMTPV GRLVTVNPFVATSSANSKVLVEMEPPFGSDYIVVGMGDKQINHHWHKAG (SEQ ID NO: 15) and EMEPPFGDSYIVVMGDKQINHHWHKA (SEQ ID NO: 16). The Tick-borne encephalitis envelope protein can include at least a portion of GLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDV NVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQK (SEQ ID NO: 17). The Yellow fever virus envelope protein can include at least a portion of GLTYTMCDKTFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVN VAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQK (SEQ ID NO: 18). The envelope protein of a flavivirus can include at least a portion of at least one member selected from the group consisting of GTTYGMCSKKFTFRPADTGHGTVVLELQYSGDGPCKIPISVASKNDLTPVGRLV TVNPFVSSTANAKVLIEMEPPFGDSYIVVGGEQINHHWHKG (SEQ ID NO: 19) and GMSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLG RLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKK (SEQ ID NO: 40). SEQ ID NOS: 12, 13, 14, 15, 16, 17, 18, 19 and 40 are portions of domain III of the viral envelope protein.
[0197] In another embodiment, the invention is a composition comprising at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one Den2 viral envelope protein, wherein the Den2 viral envelope protein is at least one member selected from the group consisting of EAEPPFGDSYIIIGVEPQQLKLNWFKK (SEQ ID NO: 22), SEQ ID NO: 40 and SEQ ID NO: 97.
[0198] The compositions, fusion proteins and polypeptides of the invention can include Den 1 (EAEPPFGESYIVVGAGEKALKLSWFKK (SEQ ID NO.: 20); Den 1 PR 94 (Puerto Rico, 1994) (ETEPPFGESYIVVGAGEKALKLSWFKK (SEQ ID NO: 21)); Den 3 (EAEPPFGESNIVIGIGDKALKINWYKK (SEQ ID NO: 23)); and Den 4 (ELEPPFGESYIVIGVGNSALTLHWFRK (SEQ ID NO: 24)). SEQ ID NOS: 20, 21, 22, 23 and 24 are portions of domain III of Den1, Den2, Den3 and Den4 flaviviruses. At least a portion of domain III of the four Dengue viruses can be employed together or separately in the compositions, fusion proteins or polypeptides of the invention. For example, domain III of Den1 (strain 16007), Den2 (strain 516803), Den3 (strain H53489) and Den4 (strain 703) can be employed separately or in combination. The pathogen-associated molecular pattern and Den2 envelope viral protein can be components of a fusion protein.
[0199] In still another embodiment, the invention is a composition comprising at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein.
[0200] In an additional embodiment, the invention is a fusion protein comprising at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one viral protein selected from the group consisting of a West Nile viral protein, a Langat viral protein, a Kunjin viral protein, a Murray Valley encephalitis viral protein, a Japanese encephalitis viral protein, a Tick-borne encephalitis viral protein, a Yellow fever viral protein and a hepatitis C viral protein. The hepatitis C viral protein for use in the compositions, fusion proteins and polypeptides of the invention can include a polypeptide of at least one member selected from the group consisting of SEQ ID NO: 64 (FIG. 22) and SEQ ID NO: 65 (FIG. 23), which are encoded by SEQ ID NOS: 66 (FIG. 24) and 67 (FIG. 25), respectively.
[0201] In another embodiment, the invention is a fusion protein comprising at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein.
[0202] Fusion proteins of the invention can further include a linker between the pathogen-associated molecular pattern and the viral protein. The linker can be an amino acid linker. The amino acid linker can include synthetic or naturally occurring amino acid residues. The amino acid linker employed in the fusion proteins of the invention can include at least one member selected from the group consisting of a lysine residue, a glutamic acid residue, a serine residue, a cysteine residue and an arginine residue. "Amino acid linker," as used herein, is also referred to as a "peptide linker." The amino acid linker can include at least one member selected from the group consisting of a peptide of KGNSKLEGQLEFPRTS (SEQ ID NO: 26); EFCRYPAQWRPL (SEQ ID NO: 28); EFSRYPAQWRPL (SEQ ID NO: 60); KGNSKLEGQLEFPRTSPVWWNSADIQHSGGRQCDGYLQNSPLRPL (SEQ ID NO: 62); EFSRYPAQWRPL (SEQ ID NO: 75); which are encoded by AAGGGCAATTCGAAGCTTGAAGGTCAATTGGAATTCCCTAGGACTAGT (SEQ ID NO: 25); GAATTCTGCAGATATCCAGCACAGTGGCGGCCGCTC (SEQ ID NO: 27); GAATTCTCTAGATATCCAGCACAGTGGCGGCCGCTC (SEQ ID NO: 61); AAGGGCAATTCGAAGCTTGAAGGTCAATTGGAATTCCCTAGGACTAGTCCA GTGTGGTGGAATTCTGCAGATATCCAGCACAGTGGCGGCCGCCAGTGTGAT GGATATCTGCAGAATTCGCCCTTGCGGCCGCTC (SEQ ID NO: 63); and GAATTCTCTAGATATCCAGCACAGTGGCGGCCGCT ((SEQ ID NO: 74).
[0203] The fusion proteins of the invention can further include a linker between at least one component of the fusion protein (e.g., Pam3Cys, Pam2Cys, flagellin, PAMP) and at least one other component of the fusion protein (e.g., at least a portion of an antigen, at least a portion of a viral protein) of the composition, a linker between at least two of similar components of the fusion protein (e.g., Pam3Cys, Pam2Cys, flagellin, PAMP, at least a portion of an antigen, at least a portion of a viral protein) or any combination thereof.
[0204] "Linker," as used herein in reference to a fusion protein of the invention, refers to a connector between components of the fusion protein in a manner that the components of the fusion protein are not directly joined. For example, one component of the fusion protein (e.g., Pam3Cys, Pam2Cys, PAMP) can be linked to a distinct component (e.g., at least a portion of an antigen, at least a portion of a viral protein) of the fusion protein. Likewise, at least two or more similar or like components of the fusion protein can be linked (e.g., two PAMPs can further include a linker between each PAMP, or two antigens can further include a linker between each antigen, or two viral proteins can further include a linker between each viral protein).
[0205] Additionally or alternatively, the fusion proteins of the invention can include a combination of a linker between distinct components of the fusion protein and similar or like components of the fusion protein. For example, a fusion protein can comprise at least two PAMPs, Pam3Cys and/or Pam2Cys components that further includes a linker between, for example, two or more PAMPs; at least two antigens or at least two viral proteins that further include a linker between them; a linker between one component of the fusion protein (e.g., PAMP) and another distinct component of the fusion protein (e.g., at least a portion of an antigen, at least a portion of a viral protein), or any combination thereof. Thus, the fusion proteins of the invention can further include a linker between at least two pathogen-associated molecular patterns, a linker between at least two antigens, a linker between at least two viral proteins, or any combination thereof.
[0206] The pathogen-associated molecular pattern of the fusion proteins of the invention can be fused to a carboxy-terminus, an amino-terminus or both a carboxy- and an amino-terminus of an antigen or at least a portion of a viral protein (e.g., a flavivirus viral protein, such as at least a portion of domain III of the West Nile envelope protein, referred to as "EIII," at least a portion of domain III of Dengue1 envelope protein) referred to as "Den1 III." "Fused to," as used herein, means covalently or noncovalently linked or recombinantly produced together.
[0207] The fusion proteins of the invention can include at least one pathogen-associated molecular pattern between at least two antigens or at least two viral proteins, which can, optionally, include a linker between the pathogen-associate molecular pattern and the antigen or the viral protein. The fusion proteins of the invention can include a pathogen-associated molecular pattern fused between at least two viral proteins (e.g., designated as "viral protein.PAMP.viral protein"). The fusion proteins of the invention can include an antigen or a viral protein fused between at least two pathogen-associated molecular patterns (e.g., designated as "PAMP.viral protein.PAMP").
[0208] The pathogen-associated molecular pattern of the fusion proteins of the invention can be a TLR5 agonist, such as a flagellin. The antigen or viral protein of the fusion proteins of the invention can be fused to the flagellin in a region of the flagellin that lacks at least a portion of a hinge region of the flagellin. For example, at least a portion of the hinge region of the fljB/STF2 flagellin of SEQ ID NO: 1 (FIG. 1) can be deleted and an antigen or a viral protein can be fused to the flagellin in the region of the deletion.
[0209] The antigen or viral protein of the fusion proteins of the invention can be fused to the flagellin in a region of the flagellin that contains a hinge region of the flagellin. For example, an antigen or viral protein can be fused to the fljB/STF2 flagellin of SEQ ID NO: 1 (FIG. 1) at any place in the hinge region, for example, at any place with amino acids 176-415 of SEQ ID NO: 1.
[0210] The antigen or viral protein of the fusion proteins of the invention can be fused to the flagellin in a region of the flagellin that lacks a hinge region of the flagellin, wherein the hinge region has been replaced with an artificial hinge region, such as an amino acid linker. For example, an antigen or viral protein can be fused to the fljB/STF2Δ flagellin of SEQ ID NO: 3 (FIG. 3) by placing an amino acid linker (also referred to herein as an "artificial hinge" or "an artificial hinge region" or "an artificial hypervariable region"), as depicted, for example, with the placement of an amino acid linker (HGAPVDPASPW, SEQ ID NO: 183) between amino acids 175 to 186 of SEQ ID NO: 3.
[0211] In another embodiment, the invention is a fusion protein comprising at least a portion of at least one member selected from the group consisting of fljB/STF2, an E. coli fliC, and a S. muenchen fliC and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein. The portion of the envelope protein can be at least a portion of at least one member selected from the group consisting of domain I, domain II and domain III of the envelope protein.
[0212] In still another embodiment, the invention includes a polypeptide that includes SEQ ID NOS: 71, 72, 30, 32, 34, 36, 38, 55, 76, 6, 80, 82, 84, 86 and 159 and a polypeptide encoded by SEQ ID NOS: 70, 73, 29, 31, 33, 35, 37, 54, 77, 5, 81, 83, 85, 87 and 158.
[0213] In an additional embodiment, the invention includes a polypeptide having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98% and at least about 99% sequence identity to the polypeptides of SEQ ID NOS: 71, 72, 30, 32, 34, 36, 38, 55, 75, 6, 80, 82, 84, 86 and 159 and the nucleic acids of SEQ ID NOS: 70, 73, 29, 31, 33, 35, 37, 54, 77, 5, 81, 83, 85, 87 and 158.
[0214] In a further embodiment, the invention includes compositions, fusion proteins and polypeptides that include a polypeptide having a flagellin that includes polypeptides having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98% and at least about 99% sequence identity to the polypeptides of SEQ ID NOS: 1, 3, 58 and 68 and the nucleic acids of 2, 4, 59 and 69.
[0215] The percent identity of two amino acid sequences (or two nucleic acid sequences) can be determined by aligning the sequences for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first sequence). The amino acid sequence or nucleic acid sequences at corresponding positions are then compared, and the percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., % identity=# of identical positions/total # of positions×100). The length of the protein or nucleic acid encoding a PAMP, at least a portion of a fusion protein, a viral protein, or a polypeptide of the invention aligned for comparison purposes is at least 30%, preferably, at least 40%, more preferably, at least 60%, and even more preferably, at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 100%, of the length of the reference sequence, for example, the nucleic acid sequence of a PAMP, at least a portion of a viral protein, or a polypeptide or fusion protein, for example, as depicted in SEQ ID NOS: 71, 72, 30, 32, 34, 36, 38, 55, 75, 6, 80, 82, 84, 86 and 159.
[0216] The actual comparison of the two sequences can be accomplished by well-known methods, for example, using a mathematical algorithm. A preferred, non-limiting example of such a mathematical algorithm is described in Karlin et al. (Proc. Natl. Acad. Sci. USA, 90:5873-5877 (1993), the teachings of which are hereby incorporated by reference in its entirety). Such an algorithm is incorporated into the BLASTN and BLASTX programs (version 2.2) as described in Schaffer et al. (Nucleic Acids Res., 29:2994-3005 (2001), the teachings of which are hereby incorporated by reference in its entirety). When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., BLASTN; available at the Internet site for the National Center for Biotechnology Information) can be used. In one embodiment, the database searched is a non-redundant (NR) database, and parameters for sequence comparison can be set at: no filters; Expect value of 10; Word Size of 3; the Matrix is BLOSUM62; and Gap Costs have an Existence of 11 and an Extension of 1.
[0217] Another mathematical algorithm employed for the comparison of sequences is the algorithm of Myers and Miller, CABIOS (1989), the teachings of which are hereby incorporated by reference in its entirety. Such an algorithm is incorporated into the ALIGN program (version 2.0), which is part of the GCG (Accelrys, San Diego, Calif.) sequence alignment software package. When utilizing the ALIGN program for comparing amino acid sequences, a PAM120 weight residue table, a gap length penalty of 12, and a gap penalty of 4 is used. Additional algorithms for sequence analysis are known in the art and include ADVANCE and ADAM as described in Torellis and Robotti (Comput. Appl. Biosci., 10: 3-5 (1994), the teachings of which are hereby incorporated by reference in its entirety); and FASTA described in Pearson and Lipman (Proc. Natl. Acad. Sci. USA, 85: 2444-2448 (1988), the teachings of which are hereby incorporated by reference in its entirety).
[0218] The percent identity between two amino acid sequences can also be accomplished using the GAP program in the GCG software package (Accelrys, San Diego, Calif.) using either a Blossom 63 matrix or a PAM250 matrix, and a gap weight of 12, 10, 8, 6, or 4 and a length weight of 2, 3, or 4. In yet another embodiment, the percent identity between two nucleic acid sequences can be accomplished using the GAP program in the GCG software package (Accelrys, San Diego, Calif.), using a gap weight of 50 and a length weight of 3.
[0219] The nucleic acid sequence encoding a PAMP, at least a portion of a viral protein, fusion proteins of the invention and polypeptides of the invention can include nucleic acid sequences that hybridize to, for example, a fljB/STF2 (e.g., SEQ ID NOS: 2, 4), a fliC (e.g., SEQ ID NOs: 59, 69), at least a portion of a viral protein (e.g., SEQ ID NOS: 39, 160, 162, 164, 166 and 177 and fusion proteins of the invention (e.g., SEQ ID NOS: 71, 72, 30, 32, 34, 36, 38, 55, 75, 6, 80, 82, 84 and 86) under selective hybridization conditions (e.g., highly stringent hybridization conditions). As used herein, the terms "hybridizes under low stringency," "hybridizes under medium stringency," "hybridizes under high stringency," or "hybridizes under very high stringency conditions," describe conditions for hybridization and washing of the nucleic acid sequences. Guidance for performing hybridization reactions, which can include aqueous and nonaqueous methods, can be found in Aubusel, F. M., et al., Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (2001), the teachings of which are hereby incorporated herein in its entirety.
[0220] For applications that require high selectivity, relatively high stringency conditions to form hybrids can be employed. In solutions used for some membrane based hybridizations, addition of an organic solvent, such as formamide, allows the reaction to occur at a lower temperature. High stringency conditions are, for example, relatively low salt and/or high temperature conditions. High stringency are provided by about 0.02 M to about 0.10 M NaCl at temperatures of about 50° C. to about 70° C. High stringency conditions allow for limited numbers of mismatches between the two sequences. In order to achieve less stringent conditions, the salt concentration may be increased and/or the temperature may be decreased. Medium stringency conditions are achieved at a salt concentration of about 0.1 to 0.25 M NaCl and a temperature of about 37° C. to about 55° C., while low stringency conditions are achieved at a salt concentration of about 0.15 M to about 0.9 M NaCl, and a temperature ranging from about 20° C. to about 55° C. Selection of components and conditions for hybridization are well known to those skilled in the art and are reviewed in Ausubel et al. (1997, Short Protocols in Molecular Biology, John Wiley & Sons, New York N.Y., Units 2.8-2.11, 3.18-3.19 and 4-64.9).
[0221] In yet another embodiment, the invention is a composition comprising at least one Pam3Cys and at least a portion of at least one flavivirus protein (e.g., at least one member selected from the group consisting of a West Nile viral protein, a Dengue viral protein, a Langat viral protein, a Kunjin viral protein, a Murray Valley encephalitis viral protein, a Japanese encephalitis viral protein, a Tick-borne encephalitis viral protein, a Yellow fever viral protein and a hepatitis C viral protein). The Dengue viral protein can be at least one member selected from the group consisting of a Den1 viral protein, a Den2 viral protein, a Den3 viral protein and a Den4 viral protein. The Pam3Cys and the flavivirus protein can be components of a fusion protein.
[0222] An additional embodiment of the invention is a composition comprising at least one Pam2Cys and at least a portion of at least one flavivirus protein (e.g., at least one member selected from the group consisting of a West Nile viral protein, a Dengue viral protein, a Langat viral protein, a Kunjin viral protein, a Murray Valley encephalitis viral protein, a Japanese encephalitis viral protein, a Tick-borne encephalitis viral protein, a Yellow fever viral protein and a hepatitis C viral protein). The Dengue viral protein can be at least one member selected from the group consisting of a Den1 viral protein, a Den2 viral protein, a Den3 viral protein and a Den4 viral protein. The Pam2Cys and the flavivirus protein can be components of a fusion protein.
[0223] In still another embodiment, the invention is a method of stimulating an immune response in a subject, comprising the step of administering to the subject a composition that includes the compositions, fusion proteins and polypeptides of the invention.
[0224] "Stimulating an immune response," as used herein, refers to the generation of antibodies to at least a portion of an antigen or a viral protein (e.g., a West Nile viral protein, a Dengue viral protein, a Langat viral protein, a Kunjin viral protein, a Murray Valley encephalitis viral protein, a Japanese encephalitis viral protein, a Tick-borne encephalitis viral protein, a Yellow fever viral protein and a hepatitis C viral protein). Stimulating an immune response in a subject can include the production of humoral and/or cellular immune responses that are reactive against the antigen or viral protein. In stimulating an immune response in the subject, the subject may be protected from infection by the antigen or virus or conditions associated with infection by the antigen or virus that may diminish or be halted as a consequence of stimulating an immune response in the subject.
[0225] The compositions, fusion proteins and polypeptides of the invention for use in methods to stimulate immune responses in subjects, can be evaluated for the ability to stimulate an immune response in a subject using well-established methods. Exemplary methods to determine whether the compositions, fusion proteins and polypeptides of the invention stimulate an immune response in a subject, include measuring the production of antibodies specific to the antigen or viral protein (e.g., IgG antibodies) by a suitable technique such as, ELISA assays; the potential to induce antibody-dependent enhancement (ADE) of a secondary infection; macrophage-like assays; neutralization assessed by using the Plaque Reduction Neutralization Test (PRNT80); the ability to generate serum antibodies in non-human models (e.g., mice, rabbits, monkeys) (Putnak, et al., Vaccine 23:4442-4452 (2005)); the ability to survive a challenge of exposure to an antigen, in particular, a viral antigen employing non-human animals, such as mice and monkeys.
[0226] A "subject," as used herein, can be a mammal, such as a primate or rodent (e.g., rat, mouse). In a particular embodiment, the subject is a human.
[0227] In a further embodiment, the invention is a method of stimulating an immune response in a subject, comprising the step of administering to the subject a composition that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one viral protein selected from the group consisting of a West Nile viral protein, a Langat viral protein, a Kunjin viral protein, a Murray Valley encephalitis viral protein, a Japanese encephalitis viral protein, a Tick-borne encephalitis viral protein, and a Yellow fever virus protein.
[0228] In yet another embodiment, the invention is a method of stimulating an immune response in a subject, comprising the step of administering to the subject a composition that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one Den2 envelope protein, wherein the Den2 envelope protein is selected from the group consisting of SEQ ID NO: 22, SEQ ID NO: 40 and SEQ ID NO: 97.
[0229] In another embodiment, the invention is a method of stimulating an immune response in a subject, comprising the step of administering to the subject a fusion protein that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one viral protein selected from the group consisting of a West Nile viral protein, a Langat viral protein, a Kunjin viral protein, a Murray Valley encephalitis viral protein, a Japanese encephalitis viral protein, a Tick-borne encephalitis viral protein and a Yellow fever viral protein.
[0230] In still another embodiment, the invention is a method stimulating an immune response in a subject, comprising the step of administering to the subject a composition that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein.
[0231] An additional embodiment of the invention is a method stimulating an immune response in a subject, comprising the step of administering to the subject a fusion protein that includes at least a portion of at least one member selected from the group consisting of a fljB/STF2, an E. coli fliC, and a S. muenchen fliC and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein (e.g., KGMSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSTQDEKGVT QNGRLITANPIVTDKEKPVNIEAEPPFGENYIVVGAGEKALKLSWFKK (SEQ ID NOS: 21 and 96)), a Den2 viral envelope protein (e.g., SEQ ID NOS: 22, 40 and KGMSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKTPFEIMDLEKRHVL GRLTTVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLDWFKK (SEQ ID NO: 97)), a Den3 viral envelope protein (e.g., SEQ ID NO: 23 and KGMSYAMCLNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTEDGQGKAH NGRLITANPVVTKKEEPVNIEAEPPFGESNIVIGIGDKALKINWYRK (SEQ ID NO: 98)) and a Den4 viral envelope protein (e.g., SEQ ID NO: 24 and KGMSYTMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEK VVGRIISPTPFAENTNSVTNIELERPLDSYIVIGVGDSALTLHWFRK (SEQ ID NO: 99)).
[0232] In a further embodiment, the invention is a method of stimulating an immune response in a subject, comprising the step of administering to the subject a fusion protein that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein.
[0233] In yet another embodiment, the invention is a method of stimulating an immune response in a subject, comprising the step of administering to the subject a composition comprising at least a portion of at least one antigen and at least a portion of at least one flagellin, wherein at least one of the flagellins lack at least a portion of a hinge region.
[0234] In another embodiment, the invention is a method of stimulating an immune response in a subject, comprising the step of administering to the subject a fusion protein comprising at least a portion of at least one antigen and at least a portion of at least one flagellin, wherein at least one of the flaggelins lack at least a portion of a hinge region.
[0235] In another embodiment, the invention is a method of stimulating an immune response in a subject, comprising the step of administering to the subject a fusion protein comprising at least a portion of at least one antigen and at least a portion of at least one flagellin, wherein at least one of the flagellins lack at least a portion of the hinge region.
[0236] In another embodiment, the invention is a method of stimulating protective immunity in a subject, comprising the step of administering to the subject a composition that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one viral protein selected from the group consisting of a West Nile viral protein, a Langat viral protein, a Kunjin viral protein, a Murray Valley encephalitis viral protein, a Japanese encephalitis viral protein, a Tick-borne encephalitis viral protein, and a Yellow fever virus protein.
[0237] In a further embodiment, the invention is a method of stimulating protective immunity in a subject, comprising the step of administering to the subject a composition that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one Den2 envelope protein, wherein the Den2 envelope protein is at least one member selected from the group consisting of SEQ ID NO: 22, SEQ ID NO: 40 and SEQ ID NO: 97.
[0238] In still another embodiment, the invention is a method of stimulating protective immunity in a subject, comprising the step of administering to the subject a fusion protein that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one viral protein selected from the group consisting of a West Nile viral protein, a Langat viral protein, a Kunjin viral protein, a Murray Valley encephalitis viral protein, a Japanese encephalitis viral protein, a Tick-borne encephalitis viral protein and a Yellow fever viral protein.
[0239] In an additional embodiment, the invention is a method of stimulating protective immunity in a subject, comprising the step of administering to the subject a composition that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein.
[0240] In another embodiment, the invention is a method of stimulating protective immunity in a subject, comprising the step of administering to the subject a fusion protein that includes at least a portion of at least one member selected from the group consisting of a Salmonella typhimurium flagellin type 2 (fljB/STF2), an E. coli fliC, and a S. muenchen fliC and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein.
[0241] In a further embodiment, the invention is a method of stimulating protective immunity in a subject, comprising the step of administering to the subject a fusion protein that includes at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one member selected from the group consisting of a Den1 viral envelope protein, a Den2 viral envelope protein, a Den3 viral envelope protein and a Den4 viral envelope protein.
[0242] In yet another embodiment, the invention is a method of stimulating protective immunity in a subject, comprising the step of administering to the subject a composition comprising at least a portion of at least one antigen and at least a portion of at least one flagellin, wherein at least one of the flagellins lacks at least a portion of a hinge region.
[0243] In yet another embodiment, the invention is a method of stimulating protective immunity in a subject, comprising the step of administering to the subject a fusion protein comprising at least a portion of at least one antigen and at least a portion of at least one flagellin, wherein at least one of the flagellins lacks at least a portion of a hinge region.
[0244] "Stimulates a protective immune response," as used herein, means administration of the compositions of the invention, such as the fusion proteins (e.g., fusion proteins that include a TLR agonist and at least a portion of a flavivirus), results in production of antibodies to the protein to thereby cause a subject to survive challenge by an otherwise lethal dose of a viral protein, such as a flavivirus. Techniques to determine a lethal dose of a virus (e.g., a flavivirus) are known to one of skill in the art (see, for example, Harmon, M. W., et al., J. Clin. Microbiol. 26:333-337 (1988); Reed, L. J., et al., Am. J. Hyg. 27:493-497 (1938); Rose, T., et al., J. Clin. Microbiol. 37:937-943 (1999); Walls, H. H. et al., J. Clin. Microbiol. 23:240-245 (1986); Current Protocols in Immunology, 19.11.1-19.11.32, Cottey, R., et al., John Wiley & Sons, Inc (2001)). Exemplary techniques for determining a lethal dose can include administration of varying doses of virus and a determination of the percent of subjects that survive following administration of the dose of virus (e.g., LD10, LD20, LD40, LD50, LD60, LD70, LD80, LD90). For example, a lethal dose of a virus that results in the death of 50% of a population of subjects is referred to as an "LD50"; a lethal dose of a virus that results in the death of 80% of a population of subjects is referred to herein as "LD80"; a lethal dose of a virus that results in death of 90% of a population of subjects is referred to herein as "LD90."
[0245] For example, determination of the LD90 can be conducted in subjects (e.g., mice) by administering intranasally or intrapentoneally varying doses (e.g., dilutions, such as log and half-log dilutions of plague forming units (pfu) (e.g., 10 pfu) followed by an assessment of the survival of the subjects about 14 days to about 21 days after infection with the virus. Protective immunity can be assessed by physical appearance of the subject, general demeanor (active), weight (initial loss of weight followed by return to a weight about the weight of the subject prior to infection with the virus) and survival after about 14 to about 21 days following infection with the flavivirus.
[0246] Assessment of stimulation of protective immunity can also be made by employing assays that assess the ability of the antibodies produced in response to the compositions of the invention (e.g., a portion of a flavivirus, such as a protein portion of West Nile virus, JE virus or Dengue virus) to result in survival of the subject (see, for example, Current Protocols in Immunology, 19.11.1-19.11.32, Cottey, R., et al., John Wiley & Sons, Inc (2001)).
[0247] In another embodiment, the invention is a method of making fusion proteins or components of fusion proteins (e.g., TLR agonists, at least a portion of a flavivirus) described herein. Methods for making fusion proteins and the components of fusion proteins can include production of fusion proteins in host cells (e.g., eukaroytic host cells, prokaryotic host cells) by, for example, transfecting or transforming host cells with nucleic acid constructs encoding the fusion proteins or components of the fusion proteins.
[0248] The methods of making a protein that stimulates an immune response or stimulates a protective immune response in a subject can further include the step of deleting at least one glycosylation site in the nucleic acid sequence encoding the PAMP, TRL agonist or antigen (e.g., flavivirus). The glycosylation site that is deleted can include an N-glycosylation site or an O-glycosylation site.
[0249] The host cell employed in the methods described herein can be a prokaryotic host cell. The prokaryotic host cell can be at least one member selected from the group consisting of an E. coli prokaryotic host cell, a Pseudomonas prokaryotic host cell, a Bacillus prokaryotic host cell, a Salmonella prokaryotic host cell and a P. fluorescens prokaryotic host cell.
[0250] The eukaryotic host cells employed in the methods of the invention can include a Saccharomyces eukaryotic host cell, an insect eukaryotic host cell (e.g., at least one member selected from the group consisting of a Baculovirus infected insect cell, such as Spodoptera frugiperda (Sf9) or Trichhoplusia ni (High5) cells; and a Drosophila insect cell, such as Dme12 cells), a fungal eukaryotic host cell, a parasite eukaryotic host cell (e.g., a Leishmania tarentolae eukaryotic host cell), CHO cells, yeast cells (e.g., Pichia) and a Kluyveromyces lactis host cell.
[0251] Suitable eukaryotic host cells and vectors can also include plant cells (e.g., tomato; chloroplast; mono- and dicotyledonous plant cells; Arabidopsis thaliana; Hordeum vulgare; Zea mays; potato, such as Solanum tuberosum; carrot, such as Daucus carona L.; and tobacco, such as Nicotiana tabacum, Nicotiana benthamiana (Gils, M., et al., Plant Biotechnol J. 3:613-20 (2005); He, D. M., et al., Colloids Surf B Biointerfaces, (2006); Huang, Z., et al., Vaccine 19:2163-71 (2001); Khandelwal, A., et al., Virology. 308:207-15 (2003); Marquet-Blouin, E., et al., Plant Mol Biol 51:459-69 (2003); Sudarshana, M. R., et al. Plant Biotechnol J. 4:551-9 (2006); Varsani, A., et al., Virus Res, 120:91-6 (2006); Kamarajugadda S., et al., Expert Rev Vaccines 5:839-49 (2006); Koya V, et al., Infect Immun. 73:8266-74 (2005); Zhang, X., et al., Plant Biotechnol J. 4:419-32 (2006)).
[0252] The proteins made by the methods of the invention and the compositions of the invention can be purified and characterized employing well-known methods (e.g., gel chromatography, cation exchange chromatography, SDS-PAGE), as described herein.
[0253] In a further embodiment, the invention is the host cells and vectors that include the nucleic acid sequences of the invention or encoded fusion proteins of the invention.
[0254] An "effective amount," when referring to the amount of a composition, fusion protein or a polypeptide of the invention, refers to that amount or dose of the composition, fusion protein, or a polypeptide, that, when administered to the subject is an amount sufficient for therapeutic efficacy (e.g., an amount sufficient to stimulate an immune response in the subject). The compositions, fusion proteins, or polypeptides of the invention can be administered in a single dose or in multiple doses.
[0255] The methods of the present invention can be accomplished by the administration of the compositions, fusion proteins or polypeptides of the invention by enteral or parenteral means. Specifically, the route of administration is by oral ingestion (e.g., drink, tablet, capsule form) or intramuscular injection of the composition, fusion protein or polypeptide. Other routes of administration as also encompassed by the present invention including intravenous, intradermal, intraarterial, intraperitoneal, or subcutaneous routes, and nasal administration. Suppositories or transdermal patches can also be employed.
[0256] The compositions, fusion proteins or polypeptides of the invention can be administered ex vivo to a subject's autologous dendritic cells. Following exposure of the dendritic cells to the composition, fusion protein or polypeptide of the invention, the dendritic cells can be administered to the subject.
[0257] The compositions, fusion proteins or polypeptides of the invention can be administered alone or can be coadministered to the patient. Coadministration is meant to include simultaneous or sequential administration of the composition, fusion protein or polypeptide of the invention individually or in combination. Where the composition, fusion protein or polypeptide are administered individually, the mode of administration can be conducted sufficiently close in time to each other (for example, administration of the composition close in time to administration of the fusion protein) so that the effects on stimulating an immune response in a subject are maximal. It is also envisioned that multiple routes of administration (e.g., intramuscular, oral, transdermal) can be used to administer the compositions and fusion proteins of the invention.
[0258] The compositions, fusion proteins or polypeptide of the invention can be administered alone or as admixtures with conventional excipients, for example, pharmaceutically, or physiologically, acceptable organic, or inorganic carrier substances suitable for enteral or parenteral application which do not deleteriously react with the extract. Suitable pharmaceutically acceptable carriers include water, salt solutions (such as Ringer's solution), alcohols, oils, gelatins and carbohydrates such as lactose, amylose or starch, fatty acid esters, hydroxymethylcellulose, and polyvinyl pyrrolidine. Such preparations can be sterilized and, if desired, mixed with auxillary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like which do not deleteriously react with the compositions, fusion proteins or polypeptides of the invention. The preparations can also be combined, when desired, with other active substances to reduce metabolic degradation. The compositions, fusion proteins or polypeptides of the invention can be administered by is oral administration, such as a drink, intramuscular or intraperitoneal injection. The compositions, fusion proteins, or polypeptides alone, or when combined with an admixture, can be administered in a single or in more than one dose over a period of time to confer the desired effect (e.g., alleviate prevent flavivirus infection, to alleviate symptoms of flavivirus infection).
[0259] When parenteral application is needed or desired, particularly suitable admixtures for the compositions, fusion proteins or polypeptides are injectable, sterile solutions, preferably oily or aqueous solutions, as well as suspensions, emulsions, or implants, including suppositories. In particular, carriers for parenteral administration include aqueous solutions of dextrose, saline, pure water, ethanol, glycerol, propylene glycol, peanut oil, sesame oil, polyoxyethylene-block polymers, and the like. Ampules are convenient unit dosages. The compositions, fusion proteins or polypeptides can also be incorporated into liposomes or administered via transdermal pumps or patches. Pharmaceutical admixtures suitable for use in the present invention are well-known to those of skill in the art and are described, for example, in Pharmaceutical Sciences (17th Ed., Mack Pub. Co., Easton, Pa.) and WO 96/05309 the teachings of which are hereby incorporated by reference.
[0260] The compositions, fusion proteins and polypeptides of the invention can be administered to a subject on a presenting carrier. "Presenting carrier," as used herein, means any composition that presents the compositions, fusion proteins and polypeptides of the invention to the immune system of the subject to generate an immune response in the subject. The presentation of the compositions, fusion proteins and polypeptides of the invention would preferably include exposure of antigenic portions of the viral protein to generate antibodies. The components (e.g., PAMP and a viral protein) of the compositions, fusion proteins and polypeptides of the invention are in close physical proximity to one another on the presenting carrier. The compositions, fusion proteins and polypeptides of the invention can be attached to the presenting carrier by covalent or noncovalent attachment. Preferably, the presenting carrier is biocompatible. "Biocompatible," as used herein, means that the presenting carrier does not generate an immune response in the subject (e.g., the production of antibodies). The presenting carrier can be a biodegradable substrate presenting carrier, such as a polymer bead or a liposome. The presenting carrier can further include alum or other suitable adjuvants. The presenting carrier can be a virus (e.g., adenovirus, poxvirus, alphavirus), bacteria (e.g., Salmonella) or a nucleic acid (e.g., plasmid DNA).
[0261] The compositions and methods of the invention can further include a carrier. "Carrier," as used herein, refers to a molecule (e.g., protein, peptide) that can enhance stimulation of a protective immune response. Carriers can be physically attached (e.g., linked by recombinant technology, peptide synthesis, chemical conjugation or chemical reaction) to a composition (e.g., a protein portion of a naturally occurring viral hemagglutinin) or admixed with the composition.
[0262] Carriers for use in the methods and compositions described herein can include, for example, at least one member selected from the group consisting of Tetanus toxoid (TT), Vibrio cholerae toxoid, Diphtheria toxoid (DT), a cross-reactive mutant (CRM) of diphtheria toxoid, E. coli enterotoxin, E. coli B subunit of heat labile enterotoxin (LTB), Tobacco mosaic virus (TMV) coat protein, protein Rabies virus (RV) envelope protein (glycoprotein), thyroglobulin (Thy), heat shock protein HSP 60 Kda, Keyhole limpet hemocyamin (KLH), an early secreted antigen tuberculosis-6 (ESAT-6), exotoxin A, choleragenoid, hepatitis B core antigen, and the outer membrane protein complex of N. meningiditis (OMPC) (see, for example, Schneerson, R., et al., Prog Clin Biol Res 47:77-94 (1980); Schneerson, R., et al., J Exp Med 152:361-76 (1980); Chu, C., et al., Infect Immun 40: 245-56 (1983); Anderson, P., Infect Immun 39:233-238 (1983); Anderson, P., et al., J Clin Invest 76:52-59 (1985); Fenwick, B. W., et al., 54: 583-586 (1986); Que, J. U., et al. Infect Immun 56:2645-9 (1988); Que, J. U., et al. Infect Immun 56:2645-9 (1988); (Que, J. U., et al. Infect Immun 56:2645-9 (1988); Murray, K., et al., Biol Chem 380:277-283 (1999); Fingerut, E., et al., Vet Immunol Immunopathol 112:253-263 (2006); and Granoff, D. M., et al., Vaccine 11:Suppl 1:S46-51 (1993)).
[0263] Exemplary carrier proteins for use in the methods and compositions described herein can include at least one member selected from the group consisting of SEQ ID NOS: 275-282:
TABLE-US-00004 Cross-reactive mutant (CRM) of diphtheria toxin including, CRM197 (SEQ ID NO: 275) GADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDW KGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAE TIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYI NNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRRSVGSSLS CINLDWDVIRDKTKTKIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEF HQTALEHPELSELKTVTGTNPVFAGANYAAWAVNVAQVIDSETADNLEKT TAALSILPGIGSVMGIADGAVHHNTEEIVAQSIALSSLMVAQAIPLVGEL VDIGFAAYNFVESIINLFQVVHNSYNRPAYSPGHKTQPFLHDGYAVSWNT VEDSIIRTGFQGESGHDIKITAENTPLPIAGVLLPTIPGKLDVNKSKTHI SVNGRKIRMRCRAIDGDVTFCRPKSPVYVGNGVHANLHVAFHRSSSEKIH SNEISSDSIGVLGYQKTVDHTKVNSKLSLFFEIKS Coat protein of Tobacco mosaic virus (TMV) coat protein (SEQ ID NO: 276) MMAYSIPTPSQLVYFTENYADYIPFVNRLINARSNSFQTQSGRDELREIL IKSQVSVVSPISRFPAEPAYYIYLRDPSISTVYTALLQSTDTRNRVIEVE NSTNVTTAEQLNAVRRTDDASTAIHNNLEQLLSLLTNGTGVFNRTSFESA SGLTWLVTTTPRTA Coat protein of alfalfa mosaic virus (AMV) (SEQ ID NO: 277) MSSSQKKAGGKAGKPTKRSQNYAALRKAQLPKPPALKVPVAKPTNTILPQ TGCVWQSLGTPLSLSSSNGLGARFLYSFLKDFAAPRILEEDLIFRMVFSI TPSHAGSFCLTDDVTTEDGRAVAHGNPMQEFPHGAFHANEKFGFELVFTA PTHAGMQNQNFKHSYAVALCLDFDALPEGSRNPSYRFNEVWVERKAFPRA GPLRSLITVGLFDDADDLDRQ Coat protein of Potato virus X (SEQ ID NO: 278) MTTPANTTQATGSTTSTTTKTAGATPATTSGLFTIPDGEFFSTARAIVAS NAVATNEDLSKIEAIWKDMKVPTDTMAQAAWDLVRHCADVGSSAQTEMID TGPYSNGISRARLAAAIKEVCTLRQFCMKYAPVVWNWMLTNNSPPANWQA QGFKPEHKFAAFDFFNGVTNPAAIMPKEGLIRPPSEAEMNAAQTAAFVKI TKARAQSNDFASLDAAVTRGRITGTTTAEAVVTLPPP Porins from Neisseria sp, e.g., class I outer membrane protein of Neisseria meningitides (SEQ ID NO: 279) MRKKLTALVLSALPLAAVADVSLYGEIKAGVEGRNYQLQLTEAQAANGGA SGQVKVTKVTKAKSRIRTKISDFGSFIGFKGSEDLGEGLKAVWQLEQDVS VAGGGATQWGNRESFIGLAGEFGTLRAGRVANQFDDASQAIDPWDSNNDV ASQLGIFKRHDDMPVSVRYDSPEFSGFSGSVQFVPAQNSKSAYKPAYWTT VNTGSATTTTFVPAVVGKPGSDVYYAGLNYKNGGFAGNYAFKYARHANVG RDAFELFLLGSGSDQAKGTDPLKNHQVHRLTGGYEEGGLNLALAAQLDLS ENGDKTKNSTTEIAATASYRFGNAVPRISYAHGFDFIERGKKGENTSYDQ IIAGVDYDFSKRTSAIVSGAWLKRNTGIGNYTQINAASVGLRHKF Major fimbrial subunit protein type I (Fimbrillin) (SEQ ID NO: 280) MVLKTSNSNRAFGVGDDESKVAKLTVMVYNGEQQEAIKSAENATKVEDIK CSAGQRTLVVMANTGAMELVGKTLAEVKALTTELTAENQEAAGLIMTAEP KTIVLKAGKNYIGYSGTGEGNHIENDPLKIKRVHARMAFTEIKVQMSAAY DNIYTFVPEKIYGLIAKKQSNLFGATLVNADANYLTGSLTTFNGAYTPAN YANVPWLSRNYVAPAADAPQGFYVLENDYSANGGTIHPTILCVYGKLQKN GADLAGADLAAAQAANWVDAEGKTYYPVLVNFNSNNYTYDSNYTPKNKIE RNHKYDIKLTITGPGTNNPENPITESAHLNVQCTVAEWVLVGQNATW Mycoplasma fermentans macrophage activating lipopeptide (MALP-2) (SEQ ID NO: 281) MKKSKKILLGLSPIAAVLPAVAVSCGNNDESNISFKEKDISKYTTTNANG KQVVKNAELLKLKPVLITDEGKIDDKSFNQSAFEALKAINKQTGIEINSV EPSSNFESAYNSALSAGHKIWVLNGFKHQQSIKQYIDAHREELERNQIKI IGIDFDIETEYKWFYSLQFNIKESAFTTGYAIASWLSEQDESKRVVASFG VGAFPGVTTFNEGFAKGILYYNQKHKSSKIYHTSPVKLDSGFTAGEKMNT VINNVLSSTPADVKYNPHVILSVAGPATFETVRLANKGQYVIGVDSDQGM IQDKDRILTSVLKHIKQAVYETLLDLILEKEEGYKPYVVKDKKADKKWSH FGTQKEKWIGVAENHFSNTEEQAKINNKIKEAIKMFKELPEDFVKYINSD KALKDGNKIDNVSERLEAIISAINKAAK p19 protein of Mycobacterium tuberculosis (SEQ ID NO: 282) ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRY EVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRT VSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
[0264] The compositions of the invention can further include at least one adjuvant. Adjuvants contain agents that can enhance the immune response against substances that are poorly immunogenic on their own (see, for example, Immunology Methods Manual, vol. 2, I. Lefkovits, ed., Academic Press, San Diego, Calif., 1997, ch. 13). Immunology Methods Manual is available as a four volume set, (Product Code Z37, 435-0); on CD-ROM, (Product Code Z37, 436-9); or both, (Product Code Z37, 437-7). Adjuvants can be, for example, mixtures of natural or synthetic compounds that, when administered with compositions of the invention, such as proteins that stimulate a protective immune response made by the methods described herein, further enhance the immune response to the protein. Compositions that further include adjuvants may further increase the protective immune response stimulated by compositions of the invention by, for example, stimulating a cellular and/or a humoral response (i.e., protection from disease versus antibody production). Adjuvants can act by enhancing protein uptake and localization, extend or prolong protein release, macrophage activation, and T and B cell stimulation. Adjuvants for use in the methods and compositions described herein can be mineral salts, oil emulsions, mycobacterial products, saponins, synthetic products and cytokines Adjuvants can be physically attached (e.g., linked by recombinant technology, by peptide synthesis or chemical reaction) to a composition described herein or admixed with the compositions described herein.
[0265] The dosage and frequency (single or multiple doses) administered to a subject can vary depending upon a variety of factors, including prior exposure to an antigen, a viral protein, the duration of viral infection, prior treatment of the viral infection, the route of administration of the composition, fusion protein or polypeptide; size, age, sex, health, body weight, body mass index, and diet of the subject; nature and extent of symptoms of flavivirus exposure, flavivirus infection and the particular flavivirus responsible for the infection (e.g., a West Nile flavivirus, a Dengue flavivirus, a Langat flavivirus, a Kunjin flavivirus, a Murray Valley encephalitis flavivirus, a Japanese encephalitis flavivirus, a Tick-borne encephalitis flavivirus, a Yellow fever flavivirus and a hepatitis C flavivirus), kind of concurrent treatment, complications from the flavivirus exposure, flavivirus infection or other health-related problems. Other therapeutic regimens or agents can be used in conjunction with the methods and compositions, fusion proteins or polypeptides of the present invention. For example, the administration of the compositions, fusion proteins or polypeptides can be accompanied by other viral therapeutics or use of agents to treat the symptoms of the flavivirus infection (e.g., high fever, numbness, DHF, meningoencephalitis). Adjustment and manipulation of established dosages (e.g., frequency and duration) are well within the ability of those skilled in the art.
[0266] The teachings of all of the references cited herein are hereby incorporated by reference in their entirety.
[0267] The present invention is further illustrated by the following examples, which are not intended to be limited in any way.
EXEMPLIFICATION
Example 1
Materials and Methods
PCR Amplification and DNA Primers
[0268] All PCR amplifications were performed using Pfu Ultra Hotstart PCR Master Mix (Catalog number 600630) from Stratagene (La Jolla, Calif.) according to the manufacturer's recommendations. DNA primers were purchased from Sigma Genosys and are described below.
TABLE-US-00005 STF28BGF-1: (SEQ ID NO: 41) CTCGGGAGATCTGCACAAGTAATCAACACTAACAGTCT STF28MCR-1: (SEQ ID NO: 42) CCATGGGCTAGCAGGATCCACCGGCGCTCCCTGCACGTTCA STF28MCF-2: (SEQ ID NO: 43) GGAGCGCCGGTGGATCCTGCTAGCCCATGGACCGAAAACCCG STF28ECR-2: (SEQ ID NO: 44) TCTGCAGAATTCACGTAACAGAGACAGCACGTTCTGCGGGACGTCCCGCA GAACGTGCTGTCTCTGTTACGTGAATTCTGCAGA pET24AR: (SEQ ID NO: 45) 5 TCCGGCGTAGAGGATCGAGA STF2-E3R3: (SEQ ID NO: 46) CAATTGACCTTCAAGCTTCGAATTGCCCTTACGTAACAGAGACAGCACGT TCTG AX-E3F3: (SEQ ID NO: 47) AAGCTTGAAGGTCAATTGGAATTCCCTAGGACTAGTATGGAAAAATTGCA GTTGAAG pET24AF: (SEQ ID NO: 48) GCTTAATGCGCCGCTACAGG 5'WNE28: (SEQ ID NO: 49) GCGGCCGCTCATGGAAAAATTGCAGTTGAAGGGAACAACC 3'WNE28: (SEQ ID NO: 50) CCGCGGTTTGCCAATGCTGCTTCCAGACTTGT NdeI-STF2: (SEQ ID NO: 51) CCGGCATGCCATATGGCACAAGTAATCAACACTAACAGTCTGTCGCTGC B1pI-EdIII: (SEQ ID NO: 52) GCATGCTCAGCTTATTAAGGGTTTGCCAATGCTGCTTCCCAGACTTGTG JE EIII primer: (SEQ ID NO: 53) TACGTGAATTCAGCAGATATCCAGCAC
Cloning of pET/STF2Δ.EIII
[0269] Full length flagellin of Salmonella typhimurium fljb (flagellin phase 2) (also referred to herein as "STF2") is encoded by a 1.5 kb gene. A truncated version of the STF2 (STF2Δ, SEQ ID NO: 3, encoded by SEQ ID NO: 4) was generated by deleting the hyper-variable region that spans amino acids 170 to 415 of SEQ ID NO: 1. The deleted region was replaced with a short flexible linker (GAPVDPASPW, SEQ ID NO: 56) designed to facilitate interactions of the NH2 and COOH termini sequences necessary for TLR5 signaling. To generate this construct, a two-step PCR was used. In the first reaction, STF2.OVA ((FIG. 61) SEQ ID NO: 152 encoding amino acid sequence SEQ ID NO: 153 of FIG. 62) served as the DNA template and STF28BGF-1 and STF28MCR-1 were used as primer pairs. In a separate reaction, the same DNA template was combined with primers STF28MCF-2 and STF28ECR-2.
[0270] The PCR amplification reactions generated about 500 bp and about 270 bp fragments, respectively. These PCR products were combined in a final PCR reaction using STF28BGF-1 and STF28ECR-2 as primers. The amplified DNA product from this reaction (about 0.77 kb) was digested with BglII and EcoRI restriction enzymes and ligated into pMTBiP/V5-His B (Invitrogen, Carlsbad, Calif.) that had previously been digested with BglII and EcoRI and treated with alkaline phosphatase. An aliquot of the ligation mix was used to transform TOP10 cells (InVitrogen, Carlsbad, Calif.). PCR screening was performed using vector specific primers, pMTFOR (methionine promoter) (CATCTCAGTGCAACTAAA, SEQ ID NO: 156) and BGHREV (bovine growth hormone poly A) (TAGAAGGCACAGTCGAGG, SEQ ID NO: 157), to identify several positive clones. All positive clones were further analyzed by restriction mapping analysis and confirmed by DNA sequencing. The resultant construct pMT/STF2Δ was used to generate pMT/STF2Δ.EIII+.
[0271] The domain III of the West Nile virus envelope protein (FIGS. 45 and 46) of pET/STF2Δ.EIII+ (SEQ ID NOS: 70, 71) was derived from the Drosophila expression plasmid pMT/STF2.E. This plasmid contains full-length STF2 (amino acids 1-506, SEQ ID NO: 1) fused to the West Nile Virus envelope protein (amino acids 1-406, SEQ ID NO:39, FIG. 45). The pMT/STF2.E (SEQ ID NO: 158) clone AX-1 was used as a DNA template and 5'WNE28 (SEQ ID NO: 49) and 3'WNE28 (SEQ ID NO: 50) served as primers for PCR amplification. In order to facilitate restriction analysis and subsequent cloning steps, the 5' primer encoded a novel NotI site (New England Biolabls, Beverly, Mass.) and the 3' primer contained a unique SacII site. The amplified EIII+ DNA fragment (345 bp; SEQ ID NO: 178 that encodes amino acids 292-406 of SEQ ID NO: 39) was subcloned into pCR-Blunt II-TOPO cloning vector (InVitrogen, Carlsbad, Calif.) to generate plasmid TOPOEIII. A stop codon was subsequently introduced downstream of the EIII+ sequence by blunting the SacII and SpeI restriction sites using T4 DNA polymerase.
[0272] To generate pMT/STF2Δ.EIII+ (SEQ ID NOS: 70, 71), the EIII+ fragment was isolated from TOPOEIII+ using NotI and BamHI restriction sites and ligated into the NotI and SacII restriction sites in pMT/STF2Δ. The BamHI site of the EIII+ DNA fragment and the SacII site of pMTSTF2Δ were blunted with T4 DNA polymerase prior to ligation. The STF2Δ.EIII+ sequence (SEQ ID NOS: 70, 71) from pMT/STF2Δ.EIII+ was isolated by PCR amplification using the primers NdeI-STF2 and BlpI-EdIII. To generate pET/STF2Δ.EIII+ (SEQ ID NO: 71), the PCR product was digested with NdeI and BlpI and ligated into pET24a plasmid that had been predigested with NdeI and BlpI. The ligation mix was transformed into Mach-1 cells (InVitrogen, Carlsbad, Calif.) and the cells were grown on LB supplemented with 50 μg/ml kanamycin. Several colonies were screened by restriction mapping and were verified by DNA sequencing.
Cloning of pET/STF2.EIII+
[0273] The West Nile virus EIII+ sequence of pET/STF2.EIII+ (SEQ ID NOS: 54, 55) was derived from pETSTF2.E (SEQ ID NOS: 158, 159). This E. coli expression plasmid contains full-length STF2 (amino acids 1-506) fused to the West Nile Virus envelope protein (amino acids 292-406 of SEQ ID NO: 39, which is SEQ ID NO: 7). In two independent PCR reactions, pET/STF2.E was used as the DNA template. One reaction used the primers pET24AR:5 (SEQ ID NO: 45) and STF2-E3R3: (SEQ ID NO: 46) and the other used AX-E3F3 (SEQ ID NO: 47) and pET24AF (SEQ ID NO: 48). These PCR reactions generated a 1.5 kb fragment that consisted of full-length STF2 and a 340 bp fragment that comprised the EIII domain plus additional amino acids that extended into domain I of the envelope protein. Aliquots of these PCR amplification reactions were combined, and the two products served as templates for a PCR reaction with the external primers pET24AR (SEQ ID NO: 45) and pET24AF (SEQ ID NO: 48). This resulted in the generation of about a 1.8 kb DNA fragment that fused EIII+ sequence (SEQ ID NO: 178, a nucleic acid sequence encoding amino acids 292-406 of SEQ ID NO: 39, which is SEQ ID NO: 7) to STF2. The PCR product was digested with NdeI and BlpI and gel purified and ligated by compatible ends to a pET24a vector that had previously been digested with compatible enzymes and de-phosphorylated. The ligation mix was transformed into Mach-1 cells (InVitrogen, Carlsbad, Calif.) as described for pET/STF2Δ.EIII+. Several colonies were screened by restriction mapping and two clones were verified by DNA sequencing.
Cloning of pET/STF2Δ.JEIII+
[0274] A portion of the envelope protein of a Japanese encephalitis virus (JEV) (strain SA-14-14-2 (Jai, L., et al., Chin Med J (Eng) 116:941-943 (2003)); currently employed in a JEV vaccine encoded by domain III was custom synthesized by DNA 2. Inc (Menlo Park, Calif.). The portion of domain III was excised from the pJ2:G01510 using NotI and Blp I site that flank the insert. The DNA insert was gel isolated and cloned by compatible ends to pET24A/STF2Δ.EIII+ (SEQ ID NOS: 70, 71) that had previously been digested with the appropriate enzymes to release the West Nile virus EIII+ insert. The deleted vector was then gel purified and ligated to an aliquot of JE EIII+. The ligation mix was used to transform TOP-10 cells (InVitrogen, Carlsbad, Calif.) and the cells were grown on LB supplemented with 50 μg/ml kanamycin. Several colonies were screened by restriction mapping and were verified by DNA sequencing.
[0275] The resulting construct, pET24A/STF2Δ.JEIII (SEQ ID NOS: 5, 6) was BLR (DE3) strain (Novagen) and expression was monitored in several clones using Commassie Blue staining which was confirmed by Western blot using anti-flagellin antibodies. Using, pET24A/STF2Δ.JEIII+ as the DNA template and the JE EIII+ oligonucleotide as primer (SEQ ID NO: 53) the cysteine residue in the linker region between STF2Δ and JEIII+ was changed to a serine residue using QuikChange Site Directed Mutagenesis Kit (Stratagene, LaJolla, Calif.) according to the manufacturer's instructions. The clone was verified by sequencing and assayed for expression as described for pET24A/STF2Δ.JEIII+ above.
[0276] When a cysteine residue in a linker in change to a serine residue the fusion protein in also referred to herein by inclusion of an "s" in the designation of the fusion protein. For example, "STF2Δ.EIII+" includes a cysteine residue in the linker (FIG. 29, SEQ ID NO: 71), whereas "STF2Δ.EIIIs+" include a serine residue substituted for the cysteine residue in the linker (FIG. 30, SEQ ID NO: 72).
Cloning the EIII Domain of Each Dengue Virus Fused to the C-Terminal End of Flagellin (STF2Δ)
[0277] Initially, obtaining biologically active material from the fusion of the entire envelope protein of West Nile virus was difficult, perhaps due to the presence of multiple cysteines residues (12 cysteines) in the envelope protein (see SEQ ID NO: 39, FIG. 45). However, when the region encoding domain III (EIII) of the protein was sub-cloned, the fusion protein was abundantly expressed in E. coli and was highly efficacious in mice. Although there is an overall sequence dissimilarity among the 4 distinct DEN viruses (Den1, Den2, Den3, Den4, SEQ ID NOS: 160-167, FIGS. 67-74) the three-dimensional structures within domain III of the envelope protein are similar among the flaviviruses. This domain in DEN and other flaviviruses encodes the majority of the type-specific contiguous critical/dominant neutralizing epitopes. Domain III of the dengue viruses (Den1, Den2, Den3 and Den4) has been expressed in bacteria and shown to be immunogenic, capable of inducing neutralizing antibodies in experimental animals (Simmons, M., et al., Am. J. Trop. Med. Hyg 65:159 (2001)). Domain III corresponding to residues about 295 to about 399 (exact numbering depends on the particular DEN virus, for example, of SEQ ID NOS: 160, 162, 164, 166) of the four different DEN viruses have been codon-optimized for expression in E. coli. The synthetic gene was amplified by using PCR and sub-cloned into the NotI site of the vector pET/STF2Δ generating pET/STF2Δ.DEN1EIII, pET/STF2Δ.DEN2EIII, pET/STF2Δ.DEN3EIII and pET/STF2Δ.DEN4EIII (SEQ ID NOS: 80, 82, 84 AND 86).
E. Coli Production of STF2.EIII+, STF2Δ.EIII+, STF2Δ.EIIIs+ and STF2Δ.JEIII+
[0278] Cell cultures (6 L) of BLR(DE3) pLysS that harbor pETSTF2.EIII+ (SEQ ID NOS: 54, 55), pETSTF2Δ.EIII+ (SEQ ID NOS: 70, 71), pETSTF2Δ.EIIIs+ (SEQ ID NOS: 72, 73) or pETSTF2Δ.JEIII+ SEQ ID NOS: 5, 6) were grown in LB medium containing 15 μg/ml kanamycin, 12.5 μg/ml tetracycline and 24 μg/ml chloramphenicol. At an OD600 of about 0.6 protein expression was induced with 1 mM IPTG for about 3 h at about 37° C. Following induction, cells were harvested by centrifugation (7000 rpm×7 minutes in a Sorvall RC5C centrifuge) and resuspended in 2×PBS, 1% glycerol, DNAse, 1 mM PMSF, protease inhibitor cocktail and 1 mg/ml lysozyme. The suspension was passed through a microfluidizer to lyse the cells and the lysate was centrifuged (45,000 g for one hour in a Beckman Optima L ultracentrifuge) to separate the soluble fraction from inclusion bodies. Under these growth and induction conditions, STF2.EIII+ was expressed as a soluble protein and STF2Δ.EIII+ (SEQ ID NOS: 70, 71), STF2Δ.EIIIs+ (SEQ ID NOS: 72, 73) and STF2Δ.JEIII+ (SEQ ID NOS: 5, 6) formed inclusion bodies.
Purification of STF2.EIII+
[0279] Cell lysate containing soluble STF2.EIII+ (SEQ ID NOS: 54, 55) was applied to Sepharose Q resin (Amersham Biosciences, Piscataway, N.J.) in the presence of 0.5 M NaCl to reduce DNA, endotoxin, and other contaminants. The flow-through fraction was collected and the conductivity adjusted by a 10-fold dilution with buffer A (Buffer A: 100 mM Tris-C1, pH 8.0). The diluted material was re-loaded onto Q Sepharose and bound protein was eluted with a linear gradient from 20% to 60% Buffer B (Buffer B: 100 mM Tris-Cl, 1 M NaCl, pH 8.0). Fractions containing STF2.EIII+ were pooled and further processed by Superdex-200 gel (SD200) filtration chromatography in the presence of Na-deoxycholate to remove residual endotoxin (running buffer: 1% Na-deoxycholate, 100 mM NaCl, 100 mM Tris-HCl, 1% glycerol, pH 8.0). Following SD200 chromatography, the eluted protein was loaded directly onto Q Sepharose and washed extensively with buffer A to remove detergent. Bound protein was again eluted with a linear gradient from 20% to 60% Buffer B. In one preparation (Batch 057), this step was substituted with a detergent removal procedure using Extract-D detergent removal gel (Pierce Biotechnology, Rockford, Ill.). The purified protein was dialyzed against buffer containing 50 mM Tris, 100 mM NaCl and 1% glycerol and stored at -80° C.
Purification of STF2Δ.EIII+
[0280] STF2Δ.EIII+ inclusion bodies were collected by low-speed centrifugation (7000 rpm×7 minutes in a Sorvall RC5C centrifuge) and solubilized with buffer containing 8 M urea, 100 mM Tris-HCl, 5 mM EDTA, pH 8.0. The urea concentration of the solubilized protein was adjusted to 1 M and the sample was loaded onto Q Sepharose. The bound protein was eluted using a linear gradient from 0% to 100% Buffer B. (Buffer A: 100 mM Tris-HCl, 5 mM EDTA, 1 M urea, pH 8.0. Buffer B: 100 mM Tris-Cl, 5 mM EDTA, 1 M NaCl, 1 M urea, pH 8.0). Due to the formation of protein aggregates following elution, the urea concentration of the Q Sepharose material was adjusted to 8 M. The protein was further purified by gel filtration chromatography using SD200. The column was pre-equilibrated with 100 mM Tris-HCl, pH 8.0, 100 mM NaCl, 1% glycerol, 8 M urea plus 1% Na-deoxycholate. The eluted protein was subjected to a second IEX chromatography step using Source Q to remove 1% Na-deoxycholate. Bound protein was eluted with a linear gradient from 20% to 60% Buffer B. (Buffer A: 100 mM Tris-C1, pH 8.0, 8 M urea, 5 mM EDTA. Buffer B: 100 mM Tris-HCl, pH 8.0, 5 mM EDTA, 8 M urea, 1 M NaCl). Final polishing of the protein was completed by gel filtration chromatography using SD200 (Running Buffer: 100 mM Tris-HCl, pH 8.0, 8 M urea, 100 mM NaCl and 1% glycerol). Reducing agent was added to the SD200 fraction (2.5 mM DTT) and the protein was refolded by step-wise dialysis against decreasing concentrations of urea. The urea concentration was reduced sequentially against buffers that contained 100 mM Tris-HCl, pH 8.0, 100 mM NaCl, 1% glycerol and 6 M, 4 M, 2 M or no urea.
Refolding and Purification of STF2Δ.EIII+ Trimer
[0281] STF2Δ.EIII+ (SEQ ID NOS: 70, 71) from urea-solubilized inclusion bodies was efficiently refolded to form trimer product by simple dialysis as described above the trimer (3 of these STFΔ.EIII fusion proteins) was deduced based on molecular weight in SDS-PAGE. Following dialysis, endotoxin was removed by multiple extractions with Triton X-114. The trimer was purified and separated from monomer and aggregates by 5200 size exclusion chromatography. The final product migrated as a single band with an apparent molecular weight of about 130 kDa on SDS-PAGE.
Refolding and Purification of STF2Δ.EIII+ Monomer
[0282] The monomeric form of STF2Δ.EIII+ (SEQ ID NOS: 70, 71) was produced consistently and efficiently by refolding using rapid dilution, which prevented individual STF2Δ.EIII+ fusion proteins from interacting with one another to form meutimers, such as trimers (supra). STF2Δ.EIII+ solubilized from inclusion bodies in 4M urea was raised to 8M urea without reductant. The protein was then rapidly diluted in Tris/NaCl/glycerol buffer, pH 8.0, to about 0.1 mg/ml and a final urea concentration of 0.1M at room temperature. The monomer was further purified and separated from aggregates by 5200 size exclusion chromatography. The final product migrated as a single band with an apparent molecular weight of about 43 kDa on SDS-PAGE.
Purification of STF2Δ.EIIIs+ (Serine Substitution of the Linker Between STF2Δ and EIII+, SEQ ID NO: 72)
[0283] STF2Δ.EIIIs+ (SEQ ID NOS: 72, 73) from solubilized inclusion bodies was refolded using a rapid dilution method similar to that used to refold the STF2Δ.EIII+ monomer. The refolded protein was captured on a butyl sepharose column and eluted while removing most of the endotoxin contamination. Eluate from the butyl sepharose purification was concentrated and put through 4 cycles of Triton X-114 extractions to reduce endotoxin levels down to about <0.1 EU/μg before a final purification step over SD200 gel filtration. The final pooled product migrated as a single band with an apparent molecular weight of about 43 kDa on SDS-PAGE and contained a trace amount of Triton X-114 (about 0.000015%).
Purification of STF2Δ.JEIII+ (SEQ ID NOS: 5, 6)
[0284] Protein was isolated from inclusion bodies under denaturing conditions. Inclusion bodies were washed with detergent (0.5% Triton X 100) and solubilized in 8 M urea, resulting in partial purification of the target protein. For endotoxin removal, protein was applied on a Source S cation exchange column at low pH (about 3.5) and eluted with a salt gradient (0 to about 1M NaCl). The protein was refolded using rapid dilution as described for STF2Δ.EIII+ monomer. The protein was then concentrated and further purified using SD200 to separate the monomeric form of the protein from aggregates. The purified material migrated with an apparent molecular weight of about 43 kDa on SDS PAGE and contained acceptable levels of endotoxin (about 0.03 EU/ug).
Fed Batch Production of Fusion Proteins
[0285] STF2Δ.EIIIs+ was produced in an aerobic bioreactor using a fed batch process. Three control loops were placed to control pH by acid (2 N HCl) or base (3 N NH4OH) addition, temperature by heating (heating blanket) or cooling (time cycled cooling loop), and dissolved oxygen by compressed air flow (manually controlled), agitation (mixing speed) and O2 flow (timed cycled) in cascade. Cells [BLR(DE3) pLysS that harbor the STF2Δ.EIIIs+ were adapted to and banked in MRSF media (see infra), and frozen in 25% glycerol. Cells were scaled up for the bioreactor by adding 1 mL of banked cells to 1 L of MRSF media and agitating at about 37° C. for about 15.5 to about 16.5 hours. Cells from the scale up process were added in a about 1:10 ratio to MRSF or MRBR synthetic media at about 37° C. and about 0.5 vvm air flow.
[0286] The process was run in batch mode at about 37° C. until the cells oxygen consumption was such that the compressed air flow is about 1.5 vvm and the agitation is at the maximum, about 6 hours, when the temperature is dropped to between about 25° C. and about 33° C. The feed can be started before the culture is induced, or up to about 1 and about 1/2 hours after. The feed rate can be kept constant, or adjusted based on process variables (dissolved oxygen, glucose concentration). The culture was induced with IPTG upon batch glucose exhaustion. The culture was maintained for a minimum of about 2 hours and a maximum of about 20 hours.
TABLE-US-00006 g/L MRBR Media Composition Glucose 20 KH2PO4 2.2 (NH4)2SO4 4.5 Citric Acid 1.0 MgSO4(7H20) 1.0 CaCl2 0.04 Trace Metals 1 ml Thiamine HCl 0.01 Antifoam 0.05 MRSF Media Composition Glucose 10 (20 in bioreactor) KH2PO4 7.8 (NH4)2SO4 2.33 Citric Acid 1.0 MgSO4(7H20) 1.0 CaCl2 0.04 Trace Metals 1 ml Thiamine HCl 0.01 Kanamycin 0.0075 (shake flask only) Trace Metal Solution 1000x Component EDTA, disodium 5 FeSO4(7H2O) 10 ZnSO4(7H2O) 2 MnSO4(H2O) 2 CoCl2(6H2O) 0.2 CuSO4(5H2O) 0.1 Na2MoO4(2H2O) 0.2 H3BO3 0.1 Feed Media Composition NaCl 0.5 FeSO4(7H2O) 2 CaCl2 3.5 MgSO4(7H2O) 12 Thiamine HC1 1 Trace Metals 1 ml Glucose 100
[0287] STF2Δ.EIIIs+ was produced as inclusion bodies. Upon harvest, the cells were separated from the conditioned media by centrifugation (Beckman Avanti J-20 XP, JLA 8.1000 rotor, 10 kxg for about 20 minutes at about 4° C.) and resuspended in equal volume of 50 mM Tris, 100 mM NaCl, 1 mM EDTA, pH 8.0. The centrifugation was repeated under the same conditions, with the cells resuspended in a minimum volume of the same buffer. The suspension was passed through a homogenizer (APV-1000) at >10,000 psi for at least two passes.
[0288] The solids can be separated and the STF2Δ.EIIIs solubilized by one of three methods; centrifugation, filtration, or fluidized bed chromatography.
Method 1
[0289] Solids are separated by centrifugation (Beckman Avanti J-20 XP, JA 20 rotor, 20 kxg for 20 minutes at 4° C.) and resuspended in 50 mM tris, 1 m NaCl, 1 mM EDTA, 1% glycerol, 0.5% Triton X-100, pH 8.0. This process was repeated up to 6 times (total) at increasing speeds and times (to a maximum of about 40 kxg for about 20 minutes). After the final pellet recovery, the pellet was resuspended in 50 mM Tris, 0.1M NaCl, 1 mM EDTA, pH 8.0 and clarified by centrifugation (Beckman Avanti J-20 XP, JA 20 rotor, 40 kxg for about 20 minutes at about 4° C.) The pellet was resuspended and dissolved in 50 mM Tris, 0.1M NaCl, 1 mM EDTA, 4 M urea, pH 8.0. Insolubles were removed by centrifugation (Beckman Avanti J-20 XP, JA 20 rotor, 40 kxg for about 50 minutes at about 4° C.), the supernatant retained for further processing.
[0290] After the multiple washes described above, STF2Δ.EIIIs can also be dissolved in 50 mM acetate, 10 mM NaCl, 8M urea, pH about 4.1 to about 5.3 and clarified by centrifugation (Beckman Avanti J-20 XP, JA 20 rotor, 20 kxg for about 20 minutes).
Method 2
[0291] After homogenization, the lysate was captured in body feed and STF2Δ.EIIIs+ extracted with urea containing buffer. Body feed is a filter aid designed to trap particles in a cake above a depth filter. The body feed (Advanced Minerals Corporation CelPure 65) is a diatomite (silica powder) with a high surface area and low permeability, retaining <0.2 μm particles. The filter aid was pre-mixed with the lysate and pumped over a depth filter (Ertel 703), building up a cake containing both body feed and lysate particles. The suspension creates a depth filter as the particles settle on the filter pad. A 50 mM Tris, 100 mM NaCl pH 8.0 wash was performed to remove soluble proteins and nucleic acids. A subsequent wash with 50 mM Tris, 100 mM NaCl, 4 M urea, pH 8 solubilizes and removes the STF2Δ.EIIIs from the body feed for further processing.
Method 3
[0292] After the cells were initially resuspended in buffer, they were resuspended in sodium chloride and urea containing buffer at pH about 6 to about 8 and homogenized. The lysate was applied on a Streamline CST fluidized bed column (GE Healthcare) where the STF2Δ.EIIIs+ binds to the resin and the particulates flow through. STF2Δ.EIIIs+ may be eluted in low salt conditions at a pH greater than the load pH, in the presence or absence of detergents such as Triton X-100 or polysorbate 80.
SDS-PAGE
[0293] Proteins (typically about 5 μg) were diluted in SDS-PAGE sample buffer with and without β-mercaptoethanol. The samples were boiled for 5 minutes and loaded onto a 4-20% SDS polyacrylamide gel. Following electrophoresis, gels were stained with coomassie blue to visualize protein bands.
Endotoxin Assay
[0294] Endotoxin levels were measured using the QCL-1000 Quantitative Chromogenic LAL test kit (BioWhittaker #50-648U, Walkersville, Md.), following the manufacturer's instructions for the microplate method.
[0295] Protein Assay
[0296] Protein concentrations were determined by the MicroBCA Protein Assay Reagent Kit in a 96-well format using BSA as a standard (Pierce Biotechnology, Rockford, Ill.).
TLR5 Bioactivity Assay
[0297] HEK293 cells (ATCC, Catalog No. CRL-1573 Manassas, Va.) constitutively express TLR5, and secrete several soluble factors, including IL-8, in response to TLR5 signaling. Cells were seeded in 96-well microplates (about 50,000 cells/well), fusion proteins added and incubated overnight. The next day, the conditioned medium was harvested, transferred to a clean 96-well microplate, and frozen at -20° C. After thawing, the conditioned medium was assayed for the presence of IL-8 in a sandwich ELISA using an anti-human IL-8 matched antibody pair (Pierce, #M801E and #M802B, Rockford, Ill.) following the manufacturer's instructions. Optical density was measured using a microplate spectrophotometer (FARCyte, Amersham Biosciences, Piscataway, N.J.).
Plaque Reduction Neturalization Test (PRNT)
[0298] PRNT was performed according to Wang, et al., J. Immunol. 167:5273-5277 (2001). Briefly, serum samples were heat inactivated by incubation in a 56° C. water bath for about 30 min and were serially diluted in PBS with 5% gelatin from 1/10 to 1/2560. West Nile virus was diluted in PBS with 5% gelatin so that the final concentration was about 100 PFU/well. Virus was mixed with about 75 μl serum in a 96-well plate at about 37° C. for about 1 h. Aliquots of serum-virus mixture were inoculated onto confluent monolayers of Vero cells in a six-well tissue culture plate. The cells were incubated at about 37° C. for 1 h, and the plates were shaken every 15 min. The agarose overlay was then added. The overlay was prepared by mixing equal volumes of a solution consisting of 100 ml 2×MEM (Life Technologies) with sterile 2% agarose. Both solutions were placed in a 40° C. water bath for 1 h before adding the overlay. The cells were incubated for 4 days at 37° C. in a humidified 5% CO2-air mixture. A second overlay with an additional 4% neutral red was added on day 5. Virus plaques were counted about 12 h later.
Antigenicity of STF2Δ-Fusion Proteins
[0299] ELISA plates (96-well) were coated overnight at 4° C. with serial dilutions (100 μl/well) of purified STF2Δ-fusion proteins (SEQ ID NOS: 158, 159, 54, 55, 70, 71) in PBS (about 2 μg/ml). Plates were blocked with 200 μl/well of Assay Diluent Buffer (ADB; BD Pharmingen) for one hour at room temperature. The plates were washed 3× in PBS-Tween, and then incubated with antibodies reactive with flagellin or the E domain of the construct. The expression of flagellin was detected using the mAb 6H11 (Intotek), while the antigenicity of WNV-E was monitored using a panel of mAb (5C5, 7H2, 5H10, 3A3, and 3D9) (Beasley, D. W., et al., J. Virol. 76:13097-13100 (2002)) were purchased from Bioreliance (Road Rockville, Md.). Antibodies diluted in ADB (about 100 μl/well) were incubated overnight at 4° C. The plates were washed 3× with PBS-T. HRP-labeled goat anti-mouse IgG antibodies (Jackson Immunochemical, West Grove, Pa.) diluted in ADB were added (100 μl/well) and the plates were incubated at room temperature for 1 hour. The plates were washed 3× with PBS-T. After adding TMB (3,3',5,5'-tetramentylbenzidine) Ultra substrate (Pierce Biotechnology, Rockford, Ill.) and monitoring color development, A450 was measured on a Tecan Farcyte microspectrophotometer.
Immunization of Mice
[0300] C3H/HeN mice (10 per group) were immunized intraperitoneally or subcutaneously with the indicated concentrations of fusion proteins or synthetic peptides on days 0, 14 and 28. On days 21 and 35, immunized animals were bled by retro-orbital puncture. Sera were harvested by clotting and centrifugation of the heparin-free blood samples. On day 35, mice were challenged with a lethal dose of WNV strain 2741 (Wang, T., et al., J. Immunol. 167:5273-5277 (2001)). Survival was monitored for 21 days post-challenge.
Serum Antibody Determination
[0301] West Nile envelope protein specific IgG levels were determined by ELISA. ELISA plates (96-wells) were coated overnight at about 4° C. with 100 μl/well of West Nile E protein mAb 5C5, 7H2, 5H10, 3A3, and 3D9 (Beasley, D. W., et al., J. Viro. 76:13097-13100 (2002)) (Bioreliance, Road Rockville, Md.) in PBS at a concentration of 2 μg/ml. Plates were blocked with 200 μl/well of Assay Diluent Buffer (ADB; BD Pharmingen, San Diego Calif.) for one hour at room temperature. The plates were washed 3× in PBS-T. Dilutions of the sera in ADB were added (100 μl/well) and the plates were incubated overnight at 4° C. The plates were washed 3× with PBS-T. HRP-labeled goat anti-mouse IgG antibodies (Jackson Immunochemical, West Grove, Pa.) diluted in ADB were added (100 μl/well) and the plates were incubated at room temperature for 1 hour. The plates were washed 3× with PBS-T. After adding TMB (3,3',5,5'-tetramentylbenzidine) Ultra substrate (Pierce Biotechnology, Rockford, Ill.) and monitoring color development, A450 was measured on a Tecan Farcyte microspectrophotometer.
Production of Pam3Cys.WNV001 Peptide Synthesis
[0302] Pam3Cys.WNV001 was synthesized by Bachem Bioscience, Inc. (King of Prussia, Pa.). WNV001 is a 20 amino acid peptide (SEQ ID NO: 168) of the West Nile virus envelope protein chemically coupled to a tri-palmitoylcysteine (Pam3Cys) moiety through the amino terminal serine residue of the peptide. The chemical name for Pam3Cys.WNV001 is [Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-LTSGHLKCRVKMEKLQLKGT (SEQ ID NO: 168) acetate salt]. The molecular mass of Pam3Cys.WNV001 is 3163.3 daltons. The peptide was synthesized by Bachem using solid phase synthesis methodologies and FMOC chemistry. The amino acid sequence of Pam3Cys.WNV001 was assembled on an H-Pro-2-chlorotrityl chloride resin by solid phase peptide synthesis. The peptide chain was elongated by successive coupling of the amino acid derivatives. Each coupling step was preceded by an Fmoc-deprotection step and were accompanied by repeated washing of the resin. After coupling of the last amino acid derivative, the final Fmoc-deprotection step was performed. Finally, the peptide resin was washed and dried under reduced pressure. During solid phase peptide synthesis color indicator tests were performed for each step to monitor the completion of the Fmoc-cleavage and the subsequent coupling of the amino acid derivatives. To couple Pam3Cys-OH to the elongated peptide, the lipid moiety was pre-activated with N,N'-dicyclohexyl-carbodiimide (DCCI) in the presence of 1-hydroxybenzotriazole (HOBt). The resulting solution was filtered and added to the peptide resin. At the end of the reaction time the peptide resin was washed and dried under reduced pressure. Color indicator tests were performed to control the coupling of Pam3Cys-OH. The completed peptide was cleaved from the resin by incubating with trifluoroacetic acid (TFA). The liberated product (crude peptide material) was precipitated from the reaction mixture and lyophilized. The crude product was used for initial immunogenicity studies.
Synthesis of WNV-E Peptide Arrays
[0303] Peptide arrays (FIGS. 57 and 60) were synthesized by Sigma Genosys (Woodlands, Tex.).
Results:
West Nile Fusion Protein
[0304] West Nile virus (WNV) has emerged in recent years in temperate regions of Europe and North America, presenting a threat to public and animal health. The most serious manifestation of WNV infection is fatal encephalitis (inflammation of the brain) in humans and horses, as well as mortality in certain domestic and wild birds. WNV has also been a significant cause of human illness in the United States. The envelope glycoprotein of West Nile (WNV-E) and other flaviviruses may generate neutralizing and protective antibodies. By linking this antigen to a Toll-like receptor ligand, the compositions, fusion proteins and polypeptides described herein may target appropriate antigen presenting cells without the need for adjuvant or other immune modulator formulations.
[0305] As described herein, several strategies have been implemented to facilitate production of West Nile virus envelope (WNV-E) fusion proteins in E. coli. One approach is to engineer a smaller WNV-E antigen by fusing domain III (EIII) and, optionally, with amino acids of domain II of the WNV-E protein to full-length STF2 (e.g., STF2.E, STF2.EIII+). Domain III is responsible for virus-host interactions and retains many West Nile virus neutralizing antibody epitopes. It also contains only 2 of the 12 cysteine residues present within the full length envelope protein, making expression in E. coli more feasible. A second approach has been to delete the hyper-variable hinge region of flagellin (e.g., STF2Δ) thereby creating a smaller fusion protein (STF2Δ.EIII+). The hyper-variable region of flagellin is not required for TLR5 signaling and its removal may also reduce the immunogenic potential of flagellin. Both STF2.EIII+ and STF2Δ.EIII+ have been expressed in E. coli and purified. The purified proteins have been characterized for TLR5 signaling activity in bioassays and for E epitope display in ELISA assays using a panel of WNV-E polyclonal and neutralizing monoclonal antibodies. Results from these studies indicate that STF2Δ.EIII+ has higher PAMP activity and more conformation-sensitive neutralizing WNV-E epitopes than STF2.EIII+.
Purity of STF2.EIII+ and STF2Δ.EIII+
[0306] Several lots of STF2.EIII+ and STF2Δ.EIII+ have been produced in E. coli and purified (Table 1). STF2.EIII+ was expressed as a soluble protein and purified under non-denaturing conditions using a 4-step process, as described above, that included anion exchange chromatography and gel filtration. Final yields from 6 L cultures ranged from about 0.9 mg to about 3.8 mg and all preparations contained low levels of endotoxin as measured by standard LAL procedures (about <0.1 EU/μg protein, see supra). In contrast, STF2Δ.EIII+ formed inclusion bodies in E. coli, and was purified under denaturing conditions. All chromatography steps used to purify STF2Δ.EIII+ required the use of 8M urea. Following purification, the denatured protein was refolded by step-wise dialysis to allow for gradual urea removal. Refolding was typically carried out at protein concentrations of about 0.3 mg/ml without any loss due to protein precipitation. Two preparations of STF2Δ.EIII+ from a single 6 L culture yielded about 1.2 and about 6.7 mg of protein, both of which had acceptable endotoxin levels. As expected, purified STF2.EIII+ and STF2Δ.EIII+ migrated on SDS PAGE under reducing conditions as about 65 kDa and about 43 kDa proteins, respectively. Notably, STF2Δ.EIII+ migrated slightly faster under non-reducing conditions. This altered migration may be due to disulfide bond formation involving the two cysteines residues in domain III of the envelope protein. As well, a larger species of STF2Δ.EIII+ was detected by Western blot analysis whose molecular weight is consistent with a trimer form of the protein ("(STF2Δ.EIII+)×3 or 3 units of STF2Δ.EIII+").
TABLE-US-00007 TABLE 1 Endotoxin levels and TLR-5 activity for STF2.EIII+ (SEQ ID NO: 55) and STF2Δ.EIII+ (SEQ ID NO: 71) fusion proteins. Batch Yield Endotoxin Number Protein (mg) Levels (EU/μg) TLR-5 EC50 052 STF2.EIII+ 3.8 0.03 >5000.00 ng/ml 054 STF2.EIII+ 0.9 0.02 1195.00 ng/ml 057 STF2.EIII+ 1.6 0.07 197.92 ng/ml 044 STF2Δ.EIII+ 1.2 0.07 1.13 ng/ml 045 STF2Δ.EIII+ 6.7 0.07 4.34 ng/ml
TLR5 Activity in the HEK293 IL-8 Assay
[0307] To compare the PAMP activity of both fusion proteins, a TLR5 bioassay was performed. HEK293 IL-8 cells were treated with serial dilutions of two independent protein batches (FIGS. 47A and 47B). Cultures were incubated for a 24 hour period and conditioned media were harvested and assayed for IL-8 production by ELISA. As shown in FIG. 47A, STF2Δ.EIII+ showed potent TLR-5 activity. Regression analysis of the titration curve determined the EC50 of batches 2004-044 and 2004-045 to be 1.13 ng/ml and 4.34 ng/ml, respectively (Table 1, supra). In both cases, the TLR5 specific-activity was at least about 10-fold higher than the control protein STF2.OVA. In contrast, 2 preparations of STF2.EIII+ showed significantly weaker TLR5 activity than STF2.OVA. The EC50 of STF2.EIII+ batches 054 and 057 were about 1195.00 ng/ml and about 197.92 ng/ml.
Antigenicity of STF2.EIII+ and STF2Δ.EIII+
[0308] The antigenicity of STF2.EIII+ and STF2Δ.EIII+ was examined by direct ELISA using a flagellin monoclonal antibody specific for the N-terminal region of STF2 (6H11, Inotek Pharmaceuticals, Beverly, Mass.) and a panel of WNV-E-specific antibodies (5C5, 5H10, 3A3, 7H2 and 3D9, Bioreliance, Road Rockville, Md.) previously shown to neutralize West Nile virus in vitro. As shown in FIG. 48, a comparison of the reactivity of full length West Nile virus envelope protein with STF2Δ.EIII+ revealed that West Nile virus monoclonal antibodies 5C5, 5H10, 3A3 and 7H2, but not 3D9 recognize the fusion protein. This pattern of reactivity is consistent with the proposed location of 5C5, 5H10, 3A3 and 7H2 epitopes within EIII. The epitope for 3D9 lies outside of domain III of the West Nile virus envelope protein. As expected, all West Nile virus monoclonal antibodies reacted with full length West Nile virus envelope protein and the flagellin monoclonal only reacted with STF2Δ.EIII+. Both proteins reacted with a polyclonal West Nile virus envelope antiserum, but STF2Δ.EIII+ reactivity was somewhat reduced, perhaps due to the reduced number of potential epitopes present in the smaller domain.
[0309] Using 5C5 and 7H10 WNV monoclonal antibodies, a direct antigenic comparison was made between STF2.EIII+ and STF2Δ.EIII+ (FIGS. 49A, 49B, 49C and 49D). In these studies, plates were coated with the indicated proteins and then detected with polyclonal rabbit anti-E, or mouse monoclonal antibodies as described. As shown in FIGS. 49A, 49B, 49C and 49D, both STF2.EIII+ and STF2Δ.EIII+ were readily detected with the flagellin monoclonal antibody with no significant differences in reactivity. However, distinct reactivity with the anti-envelope monoclonal antibodies was observed. The reactivity of STF2Δ.EIII+ with either 5C5 or 7H2 was significantly greater than that observed with STF2.EIII+. Collectively, these results indicate that the flagellin 6H11 epitope of STF2Δ.EIII+ is uncompromised and is comparable to the flagellin sequence of STF2.EIII+. They also highlight distinct differences in the antigenicity of the EIII domains of these proteins and indicate that STF2Δ.EIII+ contains more of the critical conformation dependent neutralizing epitopes than STF2.EIII+.
Efficacy and Immunogenicity
[0310] Several efficacy studies designed to examine the protective efficacy our candidates in C3H/HeN mice following challenge with West Nile virus have been completed. Studies typically consisted of 5 groups of mice (10 mice per group) immunized intraperitoneally (i.p.) or subcutaneously (s.c.) on days 0, 14 and 28. On days 21 and 35, sera were harvested and tested for West Nile virus envelope protein--IgG antibody (ELISA) and the ability to neutralize West Nile virus in vitro (PRNT assay). On day 35, mice were challenged with a lethal dose of West Nile virus strain 2741. Survival was monitored for 21 days post-challenge.
[0311] Mice were immunized with PBS, Drosophila conditioned medium containing STF2.E (CM, positive control), 25 μg of STF2Δ.EIII+i.p., 25 μg STF2Δ.EIII+ s.c., 25 μg STF2.EIII+ i.p. and 25 μg STF2.EIII+ s.c. The West Nile virus envelope protein antibody responses and survival data are shown FIGS. 50 and 51. By day 35 all groups that received STF2Δ.EIII+ had significant levels of West Nile virus envelope protein IgG. In contrast, mice that received STF2.EIII+ had no measurable West Nile virus envelope protein antibody response. Administration of STF2Δ.EIII+ i.p. or s.c led to 100% survival following West Nile virus challenge. Consistent with the poor immunogenicity of STF2.EIII+, little to no protection was provided by this candidate when compared to the PBS control. The poor immunogenicity and efficacy of STF2.EIII+ in this study are attributed to the reduced TLR5 activity and/or the weak EIII epitope reactivity of this protein.
Plaque Reduction Neutralization Titers
[0312] To further evaluate the West Nile virus envelope protein antibody response elicited by STF2Δ.EIII+ and potentially correlate protective efficacy with neutralizing antibody titers, the plaque reduction neutralization test (PRNT) was performed. Day 35 serum samples from efficacy studies described above were tested for their ability to block West Nile virus infection in cultured Vero cells. Briefly, pooled mouse serum samples were heat-inactivated and serially diluted two-fold in PBS with 0.5% gelatin. Dilutions starting with 1:10 were incubated with about 100 pfu of the West Nile virus strain 2741. The virus/serum mixture was incubated at about 37° C. for 1 h and then inoculated onto confluent monolayers of Vero cells (ATCC, Catalog Number CCL-81, Manassas, Va.) in duplicate wells of 6-well tissue culture plates. The virus was allowed to adsorb to the cell monolayer prior to adding a 1% agarose overlay. Infected cell cultures were incubated for 4 days at 37° C. followed by a second agarose overlay containing 4% neutral red. Virus plaques were counted 12 h later. Serum titers that led to 80% reduction in viral plaque numbers (PRNT80) were recorded.
[0313] A summary of the PRNT80 data from efficacy studies concerning STF2.EIII+ and STF2Δ.EIII+ is presented in Table 2 below. In two independent studies involving STF2.EIII+ where survival of about 50% or less was reported, pooled sera failed to inhibit plaque formation. This finding is not surprising given the weak antibody response elicited by this construct. In three efficacy studies involving STF2Δ.EIII+ where survival was about 70% or greater, pooled sera had neutralization titers of 1:40 or better. Neutralization titers of 1:40 or greater typically correlate with protection in vivo.
TABLE-US-00008 TABLE 2 Survivial and PRNT80 Results for STF2.EIII+ (SEQ ID NO: 55), STF2Δ.EIII+ (SEQ ID NO: 71) and STF2.E (SEQ ID NO: 159) CM (Control Media) Fusion Proteins Survival PRNT80 Batch Candidate Route Study # (%) (dilution) 054 STF2.EIII+ i.p. 3 50 Negative 057 STF2.EIII+ i.p. 4 11 Negative 057 STF2.EIII+ s.c. 4 20 negative 044 STF2Δ.EIII+ i.p. 2 70 1:40 045 STF2Δ.EIII+ i.p. 3 90 1:40 045 STF2Δ.EIII+ s.c. 3 100 1:160 045 STF2Δ.EIII+ i.p. 4 100 1:80 045 STF2Δ.EIII+ s.c. 4 100 1:40 -- STF2.E CM i.p. 3 90 1:640 -- STF2.E CM i.p. 4 -- 1:1280
STF2Δ.EIIIs+ a Modified Version of STF2Δ.EIII+
[0314] Protein preparations of STF2Δ.EIII+ tested in the mouse efficacy studies described above were purified by anion-exchange and size-exclusion chromatography steps carried out under denaturing conditions followed by refolding using step-wise dialysis. With this process, two predominant species that correspond to the monomeric and trimeric forms of STF2Δ.EIII+ were generated and present as a mixture in the final product. To minimize the heterogeneity of the final product, new refolding and purification methods have been developed that favor the production of either monomer or trimer. Because it is unclear which form of STF2Δ.EIII+ is the active component or if both are equally potent, both species have been produced in milligram quantities and tested for efficacy in mice.
[0315] It was initially unclear as to why STF2Δ.EIII+ refolding resulted in the formation of a trimeric species. However, when the sequence of the STF2Δ.EIII+ expression construct was re-examined, we identified a cysteine residue within the linker sequence that separates STF2Δ from EIII+. The presence of this cysteine would likely interfere with the formation of the appropriate disulfide bond during refolding and might account for the trimeric form of STF2Δ.EIII+. This unnecessary cysteine was changed to a serine using site-directed mutagenesis and the modified protein (STF2Δ.EIIIs+) was produced and purified. It should be noted that refolding the serine-substituted construct yielded only monomeric protein.
[0316] Protective efficacy of STF2Δ.EIII+ (monomer) and STF2Δ.EIIIs+ (trimer) were evaluated in C3H/HeN mice following challenge with West Nile virus. Five groups of mice (10 per group) were immunized with about 25 ug of protein s.c. on days 0, 14 and 28. On days 21 and 35, sera were harvested and tested for WNV-E IgG antibody (ELISA). On day 38, mice were challenged with a lethal dose of WNV strain 2741 and survival was monitored for 21 days. ELISA results from boost 2 (day 35, FIG. 52) and survival data (FIG. 53) indicate that all constructs elicited significant levels of WNV-E reactive IgG prior to viral challenge and provided about 90% to about 100% protection against the lethal infection. These findings indicate that monomeric or multimeric (e.g., trimers) forms of STFΔ.EIII+ are efficacious and removal of the additional cysteine from the construct does not appreciably impact potency. Removal of the cysteine within the linker sequence may simplify purification of the protein by reducing heterogeneity following protein refolding.
Conclusion
[0317] Two recombinant fusion proteins containing the Salmonella typhimurium flagellin (STF2) fused to EIII+ domain of West Nile virus envelope protein have been generated. One includes the full length STF2 sequence (STF2.EIII+) and the other a modified version of STF2 that lacks the internal hypervariable region of STF2 (STF2Δ.EIII+). Both proteins have been expressed in E. coli and purified by conventional means using anion exchange chromatography and gel filtration. STF2.EIII+ was produced as a soluble protein and was purified under non-denaturing conditions. In contrast, STF2Δ.EIII+ was expressed as an insoluble protein and was purified under denaturing conditions and refolded by step-wise dialysis to remove urea. In HEK293 IL8 assays, preparations of STF2Δ.EIII+ showed greater TLR-5 activity than STF2.EIII+.
[0318] In envelope protein epitope display analysis using ELISA assays and West Nile virus envelope protein antibodies, STF2Δ.EIII+ displayed more of the critical conformation dependent neutralizing epitopes. Consistent with the potent TLR-5 activity and envelope protein epitope antigenicity observed with STF2Δ.EIII+, STF2Δ.EIII+ was highly immunogenic and efficacious in mice challenged with a lethal dose of West Nile virus. Because monomeric and trimeric species of STF2Δ.EIII+ were generated during the purification process of this protein, a cysteine within the linker sequence of the expression construct was changed to a serine. Removal of this cysteine eliminated the production of trimeric forms of the protein during refolding and resulted in the generation of monomeric product that displayed potent efficacy in vivo.
Japanese Encephalitis Fusion Protein
[0319] JE virus is localized in Asia and northern Australia (about 50,000 cases with about 10,000 deaths annually). An approved inactivated virus vaccine was recently associated with a case of acute disseminated encephalomyelitis, prompting the Japanese Ministry of Health, Labor and Welfare to recommend the nationwide suspension of the vaccine. Given the complexities of producing inactivated viruses in infected mouse brains or even in cell culture, and the potential for adverse events associated with inactivated viruses, the opportunity for recombinant-based JE vaccine is appealing.
[0320] A STF2Δ.JEIII+ fusion construct was constructed. The JE EIII+ DNA fragment was generated synthetically and codon optimized for expression in E. coli. The sequence was ligated into pET24STF2Δ to generate pETSTF2Δ.JEIII+. Expression constructs have been screened by restriction analysis and for expression in E. coli BLR(DE3) by IPTG induction. The DNA sequence of each construct has been confirmed, and production of the protein has been scaled up. A batch of material has been generated. A total of about 24 mg of material was purified. This material has potent TLR5 activity, acceptable levels of endotoxin (about 0.03 EU/μg) and a A280/A260 ratio of about 1.3.
Flavivirus Peptides
Identification of WNV-E Specific Antibody Epitopes
[0321] To identify linear epitopes within the West Nile virus envelope protein that are recognized by antisera from STFΔ.EIIIs+ immunized mice, several synthetic peptide arrays were generated. One array consisted of overlapping peptides of 20 amino acids in length that spanned the entire West Nile virus domain III and parts of domain II (FIG. 60). ELISA results with this array identified a highly reactive 20 amino acid sequence that mapped to the N-terminal region of domain III and included part of the domain I domain CRVKMEKLQLKGTTYGVCSK (SEQ ID NO: 125). To fine map this epitope, additional arrays were generated that focused on the domain I and II junctions (FIGS. 57 and 60). These arrays included an alanine substitution scan to identify amino acids critical for antibody binding (FIG. 60). As shown in FIGS. 54 and 55, antisera from STF2Δ.EIII (monomer and trimer) and STF2Δ.EIIIs+ immunized mice reacted with peptides that spanned the EI/EIII junction (peptides E-30 to E-42) and included the E2-21 peptide CRVKMEKLQLKGTTYGVCSK (SEQ ID NO: 125). This reactivity was severely reduced when specific amino acids (E6, K7, L10 and K11) were changed to alanines (FIG. 56). Although it is not known if the antibodies that recognize this epitope are neutralizing, efforts are underway to design and test a peptide vaccine based on this region of WNV-E.
Immunogenicity of Pam3Cys.WNV001 Peptide Vaccine
[0322] A lipidated West Nile virus envelope protein fused to Pam3Cys on the N-terminal end was synthesized using the 20 amino acid sequence LTSGHLKCRVKMEKLQLKGT (SEQ ID NO:169) (Putnak, R., et al, Vaccine 23:4442-4452 (2005)). The immunogenicity of this peptide was tested in C3H/HeN mice and compared to peptide without Pam3Cys (FIG. 58). The reactivity of antisera from immunized animals was tested by direct ELISA as described in the legend and the results indicate that the Pam3Cys.WNV001 peptide is significantly more immunogenic than the peptide without the TLR2 modification. The antisera from these studies will be tested in virus neutralization assays (PRNT) to determine if the antibodies elicited will neutralize West Nile virus in vitro. The lipidated peptide will also be tested in the West Nile virus challenge model to assess protective efficacy against a lethal virus challenge.
Assay Development
Competition ELISA Assay Development
[0323] To assess the neutralizing potential of antisera derived from immunized mice, a competition ELISA assay was developed using well-characterized monoclonal antibody (7H2) that neutralizes West Nile virus in culture and reacts with a conformation-sensitive epitope within the EIII domain of the West Nile virus envelope protein antigen. The assay was designed as a capture ELISA that measures the ability of sera from immunized animals to prevent 7H2 from binding West Nile virus envelope protein. Serial dilutions ranging from 1:10 to 1:5000 of day 35 mouse antisera from efficacy study 4 (FIGS. 50 and 51, Table 2) were incubated with biotinylated West Nile virus envelope protein and then added to ELISA plates pre-coated with 7H2 monoclonal antibody (Bioreliance, Road Rockville, Md.). Following several washes to remove unbound material, bound West Nile virus envelope protein was detected using avidin-HRP. Results from a representative experiment are shown in FIG. 54. At dilutions of 1:25, a measurable loss of West Nile virus envelope protein binding to 7H2-coated plates was observed when antisera derived from animals immunized with STF2Δ.EIIIs where tested. No competition was detected with antisera derived from mock immunized animals that received PBS in place of antigen. These initial results demonstrate that antibodies elicited by STF2Δ.EIII+ compete with 7H2 for binding Wests Nile virus envelope protein. These findings are consistent with the protection from WNV infection observed in animals immunized with STF2Δ.EIII+ and help establish a correlation between antibody epitope reactivity in vitro and efficacy in vivo.
Example 2
Materials and Methods
Cloning and Expression of Fusion Proteins
[0324] STF2Δ.EIIIs+ (SEQ ID NO: 72) and STF2Δ.JEIIIs+ (SEQ ID NO: 76) were cloned and expressed as described above.
Protein Purification
[0325] Fusion protein (STF2Δ.EIIIs+ (SEQ ID NO: 72) was purified as described above. The fusion protein STF2Δ.JEIIIs+ (SEQ ID NO: 76) was purified as described above for STF2Δ.JEIII+ (SEQ ID NOS: 5, 6). STF2Δ (SEQ ID NO: 3) and EIII+ (SEQ ID NO: 7) proteins were purified using conventional chromatography as described herein and, if expressed in E. coli, required refolding steps due to low solubility in E. coli. Under standard growth and induction conditions described in materials and methods, STF2Δ (SEQ ID NO: 3) and EIII+ (SEQ ID NO: 7) proteins were expressed as insoluble proteins and formed inclusion bodies (IBs). STF2Δ (SEQ ID NO: 3) inclusion bodies were solubilized in 8 M urea in 50 mM Na Acetate, pH 4.0. The solubilized protein was captured on SP fast flow Sepharose® under denaturing conditions and selectively eluted with 8 M urea, 50 mM Na Acetate, pH 4.0 buffer containing 0.2 M NaCl. The eluted material was pooled, dialyzed against 50 mM Tris-HCl, pH 8.0, and refolded by rapid dilution of about 1:10 into 50 mM Tris-HCl, pH 8.0, to a final protein concentration of about 0.1 mg/ml. The refolded SP pool was loaded directly on Q high performance Sepharose® and bound protein eluted with about 20 column volumes of a linear gradient from 0 to about 0.5 M NaCl in 50 mM Tris-HCl, pH 8.0.
[0326] EIII+ (SEQ ID NO: 7) inclusion bodies were solubilized with 8 M urea in 50 mM Na Acetate, pH 6.3. The protein was applied to SP fast flow Sepharose® (GE/Amersham Biosciences). Bound protein was eluted with 50 mM Na Acetate, pH 6.3, 8 M urea containing 0.2 M NaCl. SP peak fractions were pooled and dialyzed against 50 mM Tris-HCl, pH 8.5. To refold the protein, the dialyzed sample was diluted about 1:10 (final protein concentration of about 0.1 mg/ml) in 50 mM Tris-HCl, pH 8.5. The refolded SP pool was loaded directly on Q high performance Sepharose® (GE/Amersham). Under these conditions, the majority of EIII+ (SEQ ID 7) did not bind Q and eluted with the flow-through fraction. The Q HP FT was concentrated to about 2 mg/ml (Amicon® Ultra-15, 5K MW cutoff, Millipore) and applied to size exclusion chromatography (SEC) (SD200, GE/Amersham) pre-equilibrated in Tris-buffered saline (TBS) (25 mM Tris-HCl, pH 7.4, 0.13 M NaCl, 2.7 mM KCl).
[0327] For use as ELISA reagents, WNV E (SEQ ID NO: 39) and JE E (SEQ ID NO: 171) proteins were produced in stable Drosophila Dmel-2 cells with a six amino acid histidine repeat fused to the c-terminus of the polypeptide according to manufacturer's directions (Invitrogen, Carlsbad, Calif.). Stable Drosophila cell pools were expanded as adherent cultures and adapted to suspension growth in selection media (Drosophila SFM, 18 mM L-glutamine, 1× penicillin/streptomycin, and 25 μg/mL blasticidin). Protein expression was induced with 0.5 mM CuSO4 and E protein was purified by affinity chromatography using nickel NTA according to the manufacturer's directions (Sigma, St. Louis, Mo.).
Efficacy of STF2Δ.JEIIIs+ (SEQ ID NO: 76)
[0328] Three groups of C57BL/6 mice (20 mice per group) received three intramuscular (i.m.) immunizations with PBS, 2.5 μg of STF2Δ.JEIIIs+ (SEQ ID NO: 76) fusion protein in 1× Tris-buffered saline (TBS) or about one-third (1/3) the human dose of JE vaccine (about 0.3 ml of reconstituted lyophilized killed virus distributed by Sanofi Pasteur, manufactured by BIKEN).
[0329] Seven days after each immunization, mice were bled and sera examined by ELISA for antibodies to JE E protein. Antigen-specific IgG responses to JE E and STF2 were determined by ELISA. ELISA plates (96 well) (Costar, Catalog No: 9018, Corning, N.Y.) were coated overnight at about 4° C. with about 100 μl/well of recombinant JE E protein expressed in Drosophila and placed in PBS (5 μg/ml). Plates were blocked with 200 μl/well of Assay Diluent Buffer (ADB; BD Pharmingen, Catalog No: 555213, San Diego, Calif.) for about one hour at room temperature. The plates were washed three times in PBS buffer containing 0.05% (v/v) Tween 20 (PBS-T). Dilutions of immune sera in ADB were added (about 100 μl/well) and the plates were incubated overnight at about 4° C. The plates were washed three times with PBS-T. HRP-labeled goat anti-mouse IgG antibodies (Jackson Immunochemical, Catalog No: 115-035-146, West Grove, Pa.) diluted in ADB were added (about 100 μl/well) and the plates were incubated at room temperature for about 1 hour. The plates were washed three times with PBS-T. After adding TMB Ultra substrate (Pierce, Catalog No: 34028, Rockford, Ill.) and monitoring color development, A450 was measured on a Tecan Farcyte (Durham, N.C.) microplate spectrophotometer.
[0330] Following the third immunization, mice were challenged with the P3 JE strain (Ni, H., et al., J. Gen Virol. 77:1449-1455 (1996) of JE virus intraperitoneally (i.p.) with an amount of virus equal to ten times the dose needed to cause death in 50% of the mice (10XLD50; one LD50 about 10 plaque forming units (pfu).
Results
[0331] The immunogenicity of STF2Δ.EIIIs+ (SEQ ID NO: 72) was compared with an equimolar amount of STF2Δ (SEQ ID NO: 3) and EIII+ (SEQ ID NO: 7) formulated as a protein cocktail. As shown in FIGS. 81A and 81B, STF2Δ.EIIIs+ (SEQ ID NO: 72) elicited measurable WNV-E-specific antibodies, whereas, the STF2Δ (SEQ ID NO: 3)+EIII+ (SEQ ID NO: 7) mixture did not elicit an E-specific response even though flagellin antibodies were readily detectable in these immunized animals. This pattern of antibody response was also observed following the first boost (days 14) suggesting that a prime and single boost regimen is sufficient to induce a significant antibody response.
[0332] Immunizing with EIII+ alone did not elicit E-specific antibodies demonstrating the poor immunogenicity of this purified antigen as described herein. The efficacy of STF2Δ.EIIIs+ (SEQ ID NO: 72) was demonstrated by challenging mice with WNV as described herein. As shown in FIG. 82, mice immunized with STF2Δ.EIIIs+ (SEQ ID NO: 72) were 100% protected. In contrast, no protective advantage over PBS was observed in mice that received STF2Δ (SEQ ID NO: 3) or EIII.sup.+ (SEQ ID NO: 7) as separate immunogens or as a protein mixture. These data show that both flagellin and EIII+ (SEQ ID NO: 7) are required for protection.
[0333] Immunogenicity was also examined in TLR5-deficient mice in a C57BL/6 background (Feuillet, V., et al., Proc Natl Acad Sci USA, 103(33): 12487-92 (2006)). Mice were immunized as described above (see FIGS. 83A and 83B), and sera from immunized mice were collected and analyzed for WNV E-specific IgG antibodies. Following immunization with STF2Δ.EIIIs+ (SEQ ID NO: 72), TLR5-deficient animals exhibited markedly lower WNV-E and flagellin IgG responses when compared to wild-type mice (FIGS. 83A and 83B) These studies demonstrate that TLR5 can be required to elicit a significant antigen-specific immune response.
Immunogenicity and Efficacy of STF2Δ.JEIIIs+ (SEQ ID NO: 76)
[0334] The immunogenicity and efficacy of STF2Δ.JEIIIs+ has been demonstrated in mice. To compare the potency of the fusion protein to an approved vaccine and demonstrate non-inferiority (potency that is equal to or better than a vaccine currently in use), an efficacy and immunogenicity study was performed using a JE vaccine (JE Vax, distributed by Sanofi Pasteur, manufactured by BIKEN) approved for use within the US. Three groups of C57BL/6 mice were immunized three times as described above and sera were collected following each immunization and analyzed for JE E protein-specific IgG antibodies. As shown in FIGS. 84A, 84B and 84C, mice immunized with the STF2Δ.JEIIIs+ (SEQ ID NO: 76) fusion protein developed higher JE E protein-specific antibody titers (about 10-fold) than mice immunized with JE Vax (FIGS. 84A, 84B and 84C). These results suggest that the fusion protein is more immunogenic with regard to the E protein than the JE Vax under these conditions. Once immunized, mice were challenged with a lethal dose of JE virus and the survival results 19 days post-challenge are shown (FIG. 85). When challenged with virus delivered ip, STF2Δ.JEIIIs+ (SEQ ID NO: 76) provided comparable protection (100% efficacy) from a lethal challenge when compared to the JE Vax vaccine. Thus, these data indicate that the fusion proteins described herein that include JE are not inferior to an approved JE vaccine with regard to efficacy following ip challenge.
Discussion
[0335] The presence of a functional TLR5 and the physical association of EIII+ (SEQ ID NO: 7) domain to flagellin (STF2Δ (SEQ ID NO: 3)) can generate a protective immune response. When administered to TLR5 knockout mice as a fusion protein (STF2Δ. EIII+), reduced E-specific antibody response was observed and when delivered to wild type animals as separate protein components, no E antigen-specific antibody responses were evident. When administered to wild-type mice followed by a challenged with WNV, only animals that received the EIII+ (SEQ ID NO: 7) fused to flagellin (STF2Δ (SEQ ID NO: 3)) survived a lethal West Nile viral dose. In addition, flagellin-JE fusion protein (STF2Δ.JEIIIs+ (e.g., SEQ ID NO: 76) similar in design to STF2Δ.EIIIs+ (SEQ ID NO: 72) is both immunogenic and efficacious in mice challenged with a lethal dose of Japanese encephalitis virus (JEV). Importantly, the efficacy of this recombinant protein vaccine is not inferior to the approved JE vaccine (JE Vax), which is currently in use within the US and abroad.
EQUIVALENTS
[0336] While this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims.
Sequence CWU
1
1
2821506PRTs. typhimurium 1Met Ala Gln Val Ile Asn Thr Asn Ser Leu Ser Leu
Leu Thr Gln Asn1 5 10 15
Asn Leu Asn Lys Ser Gln Ser Ala Leu Gly Thr Ala Ile Glu Arg Leu
20 25 30 Ser Ser Gly Leu
Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln 35
40 45 Ala Ile Ala Asn Arg Phe Thr Ala Asn
Ile Lys Gly Leu Thr Gln Ala 50 55 60
Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr
Glu Gly65 70 75 80
Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ala
85 90 95 Val Gln Ser Ala Asn
Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile 100
105 110 Gln Ala Glu Ile Thr Gln Arg Leu Asn Glu
Ile Asp Arg Val Ser Gly 115 120
125 Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ala Gln Asp Asn
Thr Leu 130 135 140
Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Asp Ile Asp Leu145
150 155 160 Lys Gln Ile Asn Ser
Gln Thr Leu Gly Leu Asp Ser Leu Asn Val Gln 165
170 175 Lys Ala Tyr Asp Val Lys Asp Thr Ala Val
Thr Thr Lys Ala Tyr Ala 180 185
190 Asn Asn Gly Thr Thr Leu Asp Val Ser Gly Leu Asp Asp Ala Ala
Ile 195 200 205 Lys
Ala Ala Thr Gly Gly Thr Asn Gly Thr Ala Ser Val Thr Gly Gly 210
215 220 Ala Val Lys Phe Asp Ala
Asp Asn Asn Lys Tyr Phe Val Thr Ile Gly225 230
235 240 Gly Phe Thr Gly Ala Asp Ala Ala Lys Asn Gly
Asp Tyr Glu Val Asn 245 250
255 Val Ala Thr Asp Gly Thr Val Thr Leu Ala Ala Gly Ala Thr Lys Thr
260 265 270 Thr Met Pro
Ala Gly Ala Thr Thr Lys Thr Glu Val Gln Glu Leu Lys 275
280 285 Asp Thr Pro Ala Val Val Ser Ala
Asp Ala Lys Asn Ala Leu Ile Ala 290 295
300 Gly Gly Val Asp Ala Thr Asp Ala Asn Gly Ala Glu Leu
Val Lys Met305 310 315
320 Ser Tyr Thr Asp Lys Asn Gly Lys Thr Ile Glu Gly Gly Tyr Ala Leu
325 330 335 Lys Ala Gly Asp
Lys Tyr Tyr Ala Ala Asp Tyr Asp Glu Ala Thr Gly 340
345 350 Ala Ile Lys Ala Lys Thr Thr Ser Tyr
Thr Ala Ala Asp Gly Thr Thr 355 360
365 Lys Thr Ala Ala Asn Gln Leu Gly Gly Val Asp Gly Lys Thr
Glu Val 370 375 380
Val Thr Ile Asp Gly Lys Thr Tyr Asn Ala Ser Lys Ala Ala Gly His385
390 395 400 Asp Phe Lys Ala Gln
Pro Glu Leu Ala Glu Ala Ala Ala Lys Thr Thr 405
410 415 Glu Asn Pro Leu Gln Lys Ile Asp Ala Ala
Leu Ala Gln Val Asp Ala 420 425
430 Leu Arg Ser Asp Leu Gly Ala Val Gln Asn Arg Phe Asn Ser Ala
Ile 435 440 445 Thr
Asn Leu Gly Asn Thr Val Asn Asn Leu Ser Glu Ala Arg Ser Arg 450
455 460 Ile Glu Asp Ser Asp Tyr
Ala Thr Glu Val Ser Asn Met Ser Arg Ala465 470
475 480 Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu
Ala Gln Ala Asn Gln 485 490
495 Val Pro Gln Asn Val Leu Ser Leu Leu Arg 500
505 21518DNAs. typhimurium 2atggcacaag taatcaacac taacagtctg
tcgctgctga cccagaataa cctgaacaaa 60tcccagtccg cactgggcac cgctatcgag
cgtctgtctt ctggtctgcg tatcaacagc 120gcgaaagacg atgcggcagg tcaggcgatt
gctaaccgtt tcaccgcgaa catcaaaggt 180ctgactcagg cttcccgtaa cgctaacgac
ggtatctcca ttgcgcagac cactgaaggc 240gcgctgaacg aaatcaacaa caacctgcag
cgtgtgcgtg aactggcggt tcagtctgct 300aacagcacca actcccagtc tgacctcgac
tccatccagg ctgaaatcac ccagcgcctg 360aacgaaatcg accgtgtatc cggccagact
cagttcaacg gcgtgaaagt cctggcgcag 420gacaacaccc tgaccatcca ggttggcgcc
aacgacggtg aaactatcga tatcgatctg 480aagcagatca actctcagac cctgggtctg
gactcactga acgtgcagaa agcgtatgat 540gtgaaagata cagcagtaac aacgaaagct
tatgccaata atggtactac actggatgta 600tcgggtcttg atgatgcagc tattaaagcg
gctacgggtg gtacgaatgg tacggcttct 660gtaaccggtg gtgcggttaa atttgacgca
gataataaca agtactttgt tactattggt 720ggctttactg gtgctgatgc cgccaaaaat
ggcgattatg aagttaacgt tgctactgac 780ggtacagtaa cccttgcggc tggcgcaact
aaaaccacaa tgcctgctgg tgcgacaact 840aaaacagaag tacaggagtt aaaagataca
ccggcagttg tttcagcaga tgctaaaaat 900gccttaattg ctggcggcgt tgacgctacc
gatgctaatg gcgctgagtt ggtcaaaatg 960tcttataccg ataaaaatgg taagacaatt
gaaggcggtt atgcgcttaa agctggcgat 1020aagtattacg ccgcagatta cgatgaagcg
acaggagcaa ttaaagctaa aactacaagt 1080tatactgctg ctgacggcac taccaaaaca
gcggctaacc aactgggtgg cgtagacggt 1140aaaaccgaag tcgttactat cgacggtaaa
acctacaatg ccagcaaagc cgctggtcat 1200gatttcaaag cacaaccaga gctggcggaa
gcagccgcta aaaccaccga aaacccgctg 1260cagaaaattg atgccgcgct ggcgcaggtg
gatgcgctgc gctctgatct gggtgcggta 1320caaaaccgtt tcaactctgc tatcaccaac
ctgggcaata ccgtaaacaa tctgtctgaa 1380gcgcgtagcc gtatcgaaga ttccgactac
gcgaccgaag tttccaacat gtctcgcgcg 1440cagattctgc agcaggccgg tacttccgtt
ctggcgcagg ctaaccaggt cccgcagaac 1500gtgctgtctc tgttacgt
15183277PRTs. typhimurium 3Met Ala Gln
Val Ile Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn1 5
10 15 Asn Leu Asn Lys Ser Gln Ser Ala
Leu Gly Thr Ala Ile Glu Arg Leu 20 25
30 Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala
Ala Gly Gln 35 40 45
Ala Ile Ala Asn Arg Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala 50
55 60 Ser Arg Asn Ala Asn
Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly65 70
75 80 Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln
Arg Val Arg Glu Leu Ala 85 90
95 Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser
Ile 100 105 110 Gln
Ala Glu Ile Thr Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly 115
120 125 Gln Thr Gln Phe Asn Gly
Val Lys Val Leu Ala Gln Asp Asn Thr Leu 130 135
140 Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr
Ile Asp Ile Asp Leu145 150 155
160 Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Ser Leu Asn Val His
165 170 175 Gly Ala Pro
Val Asp Pro Ala Ser Pro Trp Thr Glu Asn Pro Leu Gln 180
185 190 Lys Ile Asp Ala Ala Leu Ala Gln
Val Asp Ala Leu Arg Ser Asp Leu 195 200
205 Gly Ala Val Gln Asn Arg Phe Asn Ser Ala Ile Thr Asn
Leu Gly Asn 210 215 220
Thr Val Asn Asn Leu Ser Glu Ala Arg Ser Arg Ile Glu Asp Ser Asp225
230 235 240 Tyr Ala Thr Glu Val
Ser Asn Met Ser Arg Ala Gln Ile Leu Gln Gln 245
250 255 Ala Gly Thr Ser Val Leu Ala Gln Ala Asn
Gln Val Pro Gln Asn Val 260 265
270 Leu Ser Leu Leu Arg 275 4832DNAs. typhimurium
4atggcacaag taatcaacac taacagtctg tcgctgctga cccagaataa cctgaacaaa
60tcccagtccg cactgggcac cgctatcgag cgtctgtctt ctggtctgcg tatcaacagc
120gcgaaagacg atgcggcagg tcaggcgatt gctaaccgtt tcaccgcgaa catcaaaggt
180ctgactcagg cttcccgtaa cgctaacgac ggtatctcca ttgcgcagac cactgaaggc
240gcgctgaacg aaatcaacaa caacctgcag cgtgtgcgtg aactggcggt tcagtctgct
300aacagcacca actcccagtc tgacctcgac tccatccagg ctgaaatcac ccagcgcctg
360aacgaaatcg accgtgtatc cggccagact cagttcaacg gcgtgaaagt cctggcgcag
420gacaacaccc tgaccatcca ggttggcgcc aacgacggtg aaactatcga tatcgatctg
480aagcagatca actctcagac cctgggtctg gactcactga acgtgcatgg agcgccggtg
540gatcctgcta gcccatggac cgaaaacccg ctgcagaaaa ttgatgccgc gctggcgcag
600gtggatgcgc tgcgctctga tctgggtgcg gtacaaaacc gtttcaactc tgctatcacc
660aacctgggca ataccgtaaa caatctgtct gaagcgcgta gccgtatcga agattccgac
720tacgcgaccg aagtttccaa catgtctcgc gcgcagattt tgcagcaggc cggtacttcc
780gttctggcgc aggctaacca ggtcccgcag aacgtgctgt ctctgttacg tg
83251215DNAArtificial SequencepET/STF2delta.JEIII+ 5atggcacaag taatcaacac
taacagtctg tcgctgctga cccagaataa cctgaacaaa 60tcccagtccg cactgggcac
cgctatcgag cgtctgtctt ctggtctgcg tatcaacagc 120gcgaaagacg atgcggcagg
tcaggcgatt gctaaccgtt tcaccgcgaa catcaaaggt 180ctgactcagg cttcccgtaa
cgctaacgac ggtatctcca ttgcgcagac cactgaaggc 240gcgctgaacg aaatcaacaa
caacctgcag cgtgtgcgtg aactggcggt tcagtctgct 300aacagcacca actcccagtc
tgacctcgac tccatccagg ctgaaatcac ccagcgcctg 360aacgaaatcg accgtgtatc
cggccagact cagttcaacg gcgtgaaagt cctggcgcag 420gacaacaccc tgaccatcca
ggttggcgcc aacgacggtg aaactatcga tatcgatctg 480aagcagatca actctcagac
cctgggtctg gactcactga acgtgcatgg agcgccggtg 540gatcctgcta gcccatggac
cgaaaacccg ctgcagaaaa ttgatgccgc gctggcgcag 600gtggatgcgc tgcgctctga
tctgggtgcg gtacaaaacc gtttcaactc tgctatcacc 660aacctgggca ataccgtaaa
caatctgtct gaagcgcgta gccgtatcga agattccgac 720tacgcgaccg aagtttccaa
catgtctcgc gcgcagattt tgcagcaggc cggtacttcc 780gttctggcgc aggctaacca
ggtcccgcag aacgtgctgt ctctgttacg tgaattctgc 840agatatccag cacagtggcg
gccgctcatg gacaaactgg ctctgaaagg cacaacctat 900ggcatgtgta cagaaaaatt
ctcgttcgcg aaaaatccgg tggacactgg tcacggaaca 960gttgtcattg aactctccta
ctctgggagt gatggcccct gcaaaattcc gattgtttcc 1020gttgcgagcc tcaatgacat
gacccccgtt gggcggctgg tgacagtgaa ccccttcgtc 1080gcgacttcca gtgccaactc
aaaggtgctg gtcgagatgg aacccccctt cggagactcc 1140tacatcgtag ttggaagggg
agacaagcag atcaaccacc attggcacaa agctggaagc 1200acgctgggca aggcc
12156405PRTArtificial
SequencepET/STF2delta.JEIII+ 6Met Ala Gln Val Ile Asn Thr Asn Ser Leu Ser
Leu Leu Thr Gln Asn1 5 10
15 Asn Leu Asn Lys Ser Gln Ser Ala Leu Gly Thr Ala Ile Glu Arg Leu
20 25 30 Ser Ser Gly
Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln 35
40 45 Ala Ile Ala Asn Arg Phe Thr Ala
Asn Ile Lys Gly Leu Thr Gln Ala 50 55
60 Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr
Thr Glu Gly65 70 75 80
Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ala
85 90 95 Val Gln Ser Ala Asn
Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile 100
105 110 Gln Ala Glu Ile Thr Gln Arg Leu Asn Glu
Ile Asp Arg Val Ser Gly 115 120
125 Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ala Gln Asp Asn
Thr Leu 130 135 140
Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Asp Ile Asp Leu145
150 155 160 Lys Gln Ile Asn Ser
Gln Thr Leu Gly Leu Asp Ser Leu Asn Val His 165
170 175 Gly Ala Pro Val Asp Pro Ala Ser Pro Trp
Thr Glu Asn Pro Leu Gln 180 185
190 Lys Ile Asp Ala Ala Leu Ala Gln Val Asp Ala Leu Arg Ser Asp
Leu 195 200 205 Gly
Ala Val Gln Asn Arg Phe Asn Ser Ala Ile Thr Asn Leu Gly Asn 210
215 220 Thr Val Asn Asn Leu Ser
Glu Ala Arg Ser Arg Ile Glu Asp Ser Asp225 230
235 240 Tyr Ala Thr Glu Val Ser Asn Met Ser Arg Ala
Gln Ile Leu Gln Gln 245 250
255 Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln Val Pro Gln Asn Val
260 265 270 Leu Ser Leu
Leu Arg Glu Phe Cys Arg Tyr Pro Ala Gln Trp Arg Pro 275
280 285 Leu Met Asp Lys Leu Ala Leu Lys
Gly Thr Thr Tyr Gly Met Cys Thr 290 295
300 Glu Lys Phe Ser Phe Ala Lys Asn Pro Val Asp Thr Gly
His Gly Thr305 310 315
320 Val Val Ile Glu Leu Ser Tyr Ser Gly Ser Asp Gly Pro Cys Lys Ile
325 330 335 Pro Ile Val Ser
Val Ala Ser Leu Asn Asp Met Thr Pro Val Gly Arg 340
345 350 Leu Val Thr Val Asn Pro Phe Val Ala
Thr Ser Ser Ala Asn Ser Lys 355 360
365 Val Leu Val Glu Met Glu Pro Pro Phe Gly Asp Ser Tyr Ile
Val Val 370 375 380
Gly Arg Gly Asp Lys Gln Ile Asn His His Trp His Lys Ala Gly Ser385
390 395 400 Thr Leu Gly Lys Ala
405 7115PRTArtificial SequenceWest Nile domain III 7Met Glu
Lys Leu Gln Leu Lys Gly Thr Thr Tyr Gly Val Cys Ser Lys1 5
10 15 Ala Phe Lys Phe Leu Gly Thr
Pro Ala Asp Thr Gly His Gly Thr Val 20 25
30 Val Leu Glu Leu Gln Tyr Thr Gly Thr Asp Gly Pro
Cys Lys Val Pro 35 40 45
Ile Ser Ser Val Ala Ser Leu Asn Asp Leu Thr Pro Val Gly Arg Leu
50 55 60 Val Thr Val
Asn Pro Phe Val Ser Val Ala Thr Ala Asn Ala Lys Val65 70
75 80 Leu Ile Glu Leu Glu Pro Pro Phe
Gly Asp Ser Tyr Ile Val Val Gly 85 90
95 Arg Gly Glu Gln Gln Ile Asn His His Trp His Lys Ser
Gly Ser Ser 100 105 110
Ile Gly Lys 115 8103PRTArtificial SequenceWest Nile domain III
8Gly Thr Thr Tyr Gly Val Cys Ser Lys Ala Phe Lys Phe Ala Arg Thr1
5 10 15 Pro Ala Asp Thr Gly
His Gly Thr Val Val Leu Glu Leu Gln Tyr Thr 20
25 30 Gly Lys Asp Gly Pro Cys Lys Val Pro Ile
Ser Ser Val Ala Ser Leu 35 40 45
Asn Asp Leu Thr Pro Val Gly Arg Leu Val Thr Val Asn Pro Phe
Val 50 55 60 Ser
Val Ala Thr Ala Asn Ser Lys Val Leu Ile Glu Leu Glu Pro Pro65
70 75 80 Phe Gly Asp Ser Tyr Ile
Val Val Gly Arg Gly Glu Gln Gln Ile Asn 85
90 95 His His Trp His Lys Ser Gly 100
9102PRTArtificial SequenceWest Nile domain III 9Gly Thr Thr Tyr
Gly Val Cys Ser Lys Ala Phe Lys Phe Leu Gly Thr1 5
10 15 Pro Ala Asp Thr Gly His Gly Thr Val
Val Leu Glu Leu Gln Tyr Thr 20 25
30 Gly Thr Asp Gly Pro Cys Lys Val Pro Ile Ser Ser Val Ala
Ser Leu 35 40 45
Asn Asp Leu Thr Pro Val Gly Arg Leu Val Thr Val Asn Pro Phe Val 50
55 60 Ser Val Ala Thr Ala
Asn Ala Lys Val Leu Ile Glu Leu Glu Pro Pro65 70
75 80 Phe Gly Asp Ser Tyr Val Val Gly Arg Gly
Glu Gln Gln Ile Asn His 85 90
95 His Trp His Lys Ser Gly 100
1027PRTArtificial SequenceWest Nile domain III 10Glu Leu Glu Pro Pro Phe
Gly Asp Ser Tyr Ile Val Val Gly Arg Gly1 5
10 15 Glu Gln Gln Ile Asn His His Trp His Lys Ser
20 25 11345DNAArtificial SequenceWest
Nile domain III 11atggaaaaat tgcagttgaa gggaacaacc tatggcgtct gttcaaaggc
tttcaagttt 60cttgggactc ccgcagacac aggtcacggc actgtggtgt tggaattgca
gtacactggc 120acggatggac cttgcaaagt tcctatctcg tcagtggctt cattgaacga
cctaacgcca 180gtgggcagat tggtcactgt caaccctttt gtttcagtgg ccacggccaa
cgctaaggtc 240ctgattgaat tggaaccacc ctttggagac tcatacatag tggtgggcag
aggagaacaa 300cagatcaatc accattggca caagtctgga agcagcattg gcaaa
3451296PRTArtificial SequenceLangat virus 12Gly Leu Thr Tyr
Thr Val Cys Asp Lys Thr Lys Phe Thr Trp Lys Arg1 5
10 15 Ala Pro Thr Asp Ser Gly His Asp Thr
Val Val Met Glu Val Gly Phe 20 25
30 Ser Gly Thr Arg Pro Cys Arg Ile Pro Val Arg Ala Val Ala
His Gly 35 40 45
Val Pro Glu Val Asn Val Ala Met Leu Ile Thr Pro Asn Pro Thr Met 50
55 60 Glu Asn Asn Gly Gly
Gly Phe Ile Glu Met Gln Leu Pro Pro Gly Asp65 70
75 80 Asn Ile Ile Tyr Val Gly Asp Leu Asn His
Gln Trp Phe Gln Lys Gly 85 90
95 13103PRTArtificial SequenceKunjin virus 13Gly Thr Thr Tyr
Gly Val Cys Ser Lys Ala Phe Arg Phe Leu Gly Thr1 5
10 15 Pro Ala Asp Thr Gly His Gly Thr Val
Val Leu Glu Leu Gln Tyr Thr 20 25
30 Gly Thr Asp Gly Pro Cys Lys Ile Pro Ile Ser Ser Val Ala
Ser Leu 35 40 45
Asn Asp Leu Thr Pro Val Gly Arg Leu Val Thr Val Asn Pro Phe Val 50
55 60 Ser Val Ser Thr Ala
Asn Ala Lys Val Leu Ile Glu Leu Glu Pro Pro65 70
75 80 Phe Gly Asp Ser Tyr Ile Val Val Gly Arg
Gly Glu Gln Gln Ile Asn 85 90
95 His His Trp His Lys Ser Gly 100
14103PRTArtificial SequenceMurray Valley virus 14Gly Thr Thr Tyr Gly Met
Cys Thr Glu Lys Phe Thr Phe Ser Lys Asn1 5
10 15 Pro Ala Asp Thr Gly His Gly Thr Val Val Leu
Glu Leu Gln Tyr Thr 20 25 30
Gly Ser Asp Gly Pro Cys Lys Ile Pro Ile Ser Ser Val Ala Ser Leu
35 40 45 Asn Asp Met
Thr Pro Val Gly Arg Met Val Thr Ala Asn Pro Tyr Val 50
55 60 Ala Ser Ser Thr Ala Asn Ala Lys
Val Leu Val Glu Ile Glu Pro Pro65 70 75
80 Phe Gly Asp Ser Tyr Ile Val Val Gly Arg Gly Asp Lys
Gln Ile Asn 85 90 95
His His Trp His Lys Glu Gly 100
15103PRTArtificial SequenceJapanese encephalitis virus 15Gly Thr Thr Tyr
Gly Met Cys Thr Glu Lys Phe Ser Phe Ala Lys Asn1 5
10 15 Pro Ala Asp Thr Gly His Gly Thr Val
Val Ile Glu Leu Ser Tyr Ser 20 25
30 Gly Ser Asp Gly Pro Cys Lys Ile Pro Ile Val Ser Val Ala
Ser Leu 35 40 45
Asn Asp Met Thr Pro Val Gly Arg Leu Val Thr Val Asn Pro Phe Val 50
55 60 Ala Thr Ser Ser Ala
Asn Ser Lys Val Leu Val Glu Met Glu Pro Pro65 70
75 80 Phe Gly Ser Asp Tyr Ile Val Val Gly Met
Gly Asp Lys Gln Ile Asn 85 90
95 His His Trp His Lys Ala Gly 100
1626PRTArtificial SequenceJapanese encephalitis virus 16Glu Met Glu Pro
Pro Phe Gly Asp Ser Tyr Ile Val Val Met Gly Asp1 5
10 15 Lys Gln Ile Asn His His Trp His Lys
Ala 20 25 1795PRTArtificial
SequenceTick-borne encephalitis virus 17Gly Leu Thr Tyr Thr Met Cys Asp
Lys Thr Lys Phe Thr Trp Lys Arg1 5 10
15 Ala Pro Thr Asp Ser Gly His Asp Thr Val Val Met Glu
Val Thr Phe 20 25 30
Ser Gly Thr Lys Pro Cys Arg Ile Pro Val Arg Ala Val Ala His Gly
35 40 45 Ser Pro Asp Val
Asn Val Ala Met Leu Ile Thr Pro Asn Pro Thr Ile 50 55
60 Glu Asn Asn Gly Gly Gly Phe Ile Glu
Met Gln Leu Pro Pro Gly Asp65 70 75
80 Asn Ile Ile Tyr Val Gly Glu Leu Ser His Gln Trp Phe Gln
Lys 85 90 95
1894PRTArtificial SequenceYellow fever virus 18Gly Leu Thr Tyr Thr Met
Cys Asp Lys Thr Phe Thr Trp Lys Arg Ala1 5
10 15 Pro Thr Asp Ser Gly His Asp Thr Val Val Met
Glu Val Thr Phe Ser 20 25 30
Gly Thr Lys Pro Cys Arg Ile Pro Val Arg Ala Val Ala His Gly Ser
35 40 45 Pro Asp Val
Asn Val Ala Met Leu Ile Thr Pro Asn Pro Thr Ile Glu 50
55 60 Asn Asn Gly Gly Gly Phe Ile Glu
Met Gln Leu Pro Pro Gly Asp Asn65 70 75
80 Ile Ile Tyr Val Gly Glu Leu Ser His Gln Trp Phe Gln
Lys 85 90
1995PRTArtificial SequenceEnvelope protein flavivirus 19Gly Thr Thr Tyr
Gly Met Cys Ser Lys Lys Phe Thr Phe Arg Pro Ala1 5
10 15 Asp Thr Gly His Gly Thr Val Val Leu
Glu Leu Gln Tyr Ser Gly Asp 20 25
30 Gly Pro Cys Lys Ile Pro Ile Ser Val Ala Ser Lys Asn Asp
Leu Thr 35 40 45
Pro Val Gly Arg Leu Val Thr Val Asn Pro Phe Val Ser Ser Thr Ala 50
55 60 Asn Ala Lys Val Leu
Ile Glu Met Glu Pro Pro Phe Gly Asp Ser Tyr65 70
75 80 Ile Val Val Gly Gly Glu Gln Ile Asn His
His Trp His Lys Gly 85 90
95 2027PRTArtificial SequenceDengue virus 20Glu Ala Glu Pro Pro Phe Gly
Glu Ser Tyr Ile Val Val Gly Ala Gly1 5 10
15 Glu Lys Ala Leu Lys Leu Ser Trp Phe Lys Lys
20 25 2127PRTArtificial SequenceDengue
virus 21Glu Thr Glu Pro Pro Phe Gly Glu Ser Tyr Ile Val Val Gly Ala Gly1
5 10 15 Glu Lys Ala
Leu Lys Leu Ser Trp Phe Lys Lys 20 25
2227PRTArtificial SequenceDengue virus 22Glu Ala Glu Pro Pro Phe Gly Asp
Ser Tyr Ile Ile Ile Gly Val Glu1 5 10
15 Pro Gln Gln Leu Lys Leu Asn Trp Phe Lys Lys
20 25 2327PRTArtificial SequenceDengue virus
23Glu Ala Glu Pro Pro Phe Gly Glu Ser Asn Ile Val Ile Gly Ile Gly1
5 10 15 Asp Lys Ala Leu
Lys Ile Asn Trp Tyr Lys Lys 20 25
2427PRTArtificial SequenceDengue virus 24Glu Leu Glu Pro Pro Phe Gly Glu
Ser Tyr Ile Val Ile Gly Val Gly1 5 10
15 Asn Ser Ala Leu Thr Leu His Trp Phe Arg Lys
20 25 2548DNAArtificial SequenceLinker
25aagggcaatt cgaagcttga aggtcaattg gaattcccta ggactagt
482616PRTArtificial SequenceLinker 26Lys Gly Asn Ser Lys Leu Glu Gly Gln
Leu Glu Phe Pro Arg Thr Ser1 5 10
15 2736DNAArtificial SequenceLinker 27gaattctgca gatatccagc
acagtggcgg ccgctc 362812PRTArtificial
SequenceLinker 28Glu Phe Cys Arg Tyr Pro Ala Gln Trp Arg Pro Leu1
5 10 291863DNAArtificial
SequenceSTF2.EIII+ 29atggcacaag taatcaacac taacagtctg tcgctgctga
cccagaataa cctgaacaaa 60tcccagtccg cactgggcac cgctatcgag cgtctgtctt
ctggtctgcg tatcaacagc 120gcgaaagacg atgcggcagg tcaggcgatt gctaaccgtt
tcaccgcgaa catcaaaggt 180ctgactcagg cttcccgtaa cgctaacgac ggtatctcca
ttgcgcagac cactgaaggc 240gcgctgaacg aaatcaacaa caacctgcag cgtgtgcgtg
aactggcggt tcagtctgct 300aacagcacca actcccagtc tgacctcgac tccatccagg
ctgaaatcac ccagcgcctg 360aacgaaatcg accgtgtatc cggccagact cagttcaacg
gcgtgaaagt cctggcgcag 420gacaacaccc tgaccatcca ggttggcgcc aacgacggtg
aaactatcga tatcgatctg 480aagcagatca actctcagac cctgggtctg gactcactga
acgtgcagaa agcgtatgat 540gtgaaagata cagcagtaac aacgaaagct tatgccaata
atggtactac actggatgta 600tcgggtcttg atgatgcagc tattaaagcg gctacgggtg
gtacgaatgg tacggcttct 660gtaaccggtg gtgcggttaa atttgacgca gataataaca
agtactttgt tactattggt 720ggctttactg gtgctgatgc cgccaaaaat ggcgattatg
aagttaacgt tgctactgac 780ggtacagtaa cccttgcggc tggcgcaact aaaaccacaa
tgcctgctgg tgcgacaact 840aaaacagaag tacaggagtt aaaagataca ccggcagttg
tttcagcaga tgctaaaaat 900gccttaattg ctggcggcgt tgacgctacc gatgctaatg
gcgctgagtt ggtcaaaatg 960tcttataccg ataaaaatgg taagacaatt gaaggcggtt
atgcgcttaa agctggcgat 1020aagtattacg ccgcagatta cgatgaagcg acaggagcaa
ttaaagctaa aactacaagt 1080tatactgctg ctgacggcac taccaaaaca gcggctaacc
aactgggtgg cgtagacggt 1140aaaaccgaag tcgttactat cgacggtaaa acctacaatg
ccagcaaagc cgctggtcat 1200gatttcaaag cacaaccaga gctggcggaa gcagccgcta
aaaccaccga aaacccgctg 1260cagaaaattg atgccgcgct ggcgcaggtg gatgcgctgc
gctctgatct gggtgcggta 1320caaaaccgtt tcaactctgc tatcaccaac ctgggcaata
ccgtaaacaa tctgtctgaa 1380gcgcgtagcc gtatcgaaga ttccgactac gcgaccgaag
tttccaacat gtctcgcgcg 1440cagattctgc agcaggccgg tacttccgtt ctggcgcagg
ctaaccaggt cccgcagaac 1500gtgctgtctc tgttacgtat ggaaaaattg cagttgaagg
gaacaaccta tggcgtctgt 1560tcaaaggctt tcaagtttct tgggactccc gcagacacag
gtcacggcac tgtggtgttg 1620gaattgcagt acactggcac ggatggacct tgcaaagttc
ctatctcgtc agtggcttca 1680ttgaacgacc taacgccagt gggcagattg gtcactgtca
acccttttgt ttcagtggcc 1740acggccaacg ctaaggtcct gattgaattg gaaccaccct
ttggagactc atacatagtg 1800gtgggcagag gagaacaaca gatcaatcac cattggcaca
agtctggaag cagcattggc 1860aaa
186330621PRTArtificial SequenceSTF2.EIII+ 30Met Ala
Gln Val Ile Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn1 5
10 15 Asn Leu Asn Lys Ser Gln Ser
Ala Leu Gly Thr Ala Ile Glu Arg Leu 20 25
30 Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp
Ala Ala Gly Gln 35 40 45
Ala Ile Ala Asn Arg Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala
50 55 60 Ser Arg Asn
Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly65 70
75 80 Ala Leu Asn Glu Ile Asn Asn Asn
Leu Gln Arg Val Arg Glu Leu Ala 85 90
95 Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu
Asp Ser Ile 100 105 110
Gln Ala Glu Ile Thr Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly
115 120 125 Gln Thr Gln Phe
Asn Gly Val Lys Val Leu Ala Gln Asp Asn Thr Leu 130
135 140 Thr Ile Gln Val Gly Ala Asn Asp
Gly Glu Thr Ile Asp Ile Asp Leu145 150
155 160 Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Ser
Leu Asn Val Gln 165 170
175 Lys Ala Tyr Asp Val Lys Asp Thr Ala Val Thr Thr Lys Ala Tyr Ala
180 185 190 Asn Asn Gly
Thr Thr Leu Asp Val Ser Gly Leu Asp Asp Ala Ala Ile 195
200 205 Lys Ala Ala Thr Gly Gly Thr Asn
Gly Thr Ala Ser Val Thr Gly Gly 210 215
220 Ala Val Lys Phe Asp Ala Asp Asn Asn Lys Tyr Phe Val
Thr Ile Gly225 230 235
240 Gly Phe Thr Gly Ala Asp Ala Ala Lys Asn Gly Asp Tyr Glu Val Asn
245 250 255 Val Ala Thr Asp
Gly Thr Val Thr Leu Ala Ala Gly Ala Thr Lys Thr 260
265 270 Thr Met Pro Ala Gly Ala Thr Thr Lys
Thr Glu Val Gln Glu Leu Lys 275 280
285 Asp Thr Pro Ala Val Val Ser Ala Asp Ala Lys Asn Ala Leu
Ile Ala 290 295 300
Gly Gly Val Asp Ala Thr Asp Ala Asn Gly Ala Glu Leu Val Lys Met305
310 315 320 Ser Tyr Thr Asp Lys
Asn Gly Lys Thr Ile Glu Gly Gly Tyr Ala Leu 325
330 335 Lys Ala Gly Asp Lys Tyr Tyr Ala Ala Asp
Tyr Asp Glu Ala Thr Gly 340 345
350 Ala Ile Lys Ala Lys Thr Thr Ser Tyr Thr Ala Ala Asp Gly Thr
Thr 355 360 365 Lys
Thr Ala Ala Asn Gln Leu Gly Gly Val Asp Gly Lys Thr Glu Val 370
375 380 Val Thr Ile Asp Gly Lys
Thr Tyr Asn Ala Ser Lys Ala Ala Gly His385 390
395 400 Asp Phe Lys Ala Gln Pro Glu Leu Ala Glu Ala
Ala Ala Lys Thr Thr 405 410
415 Glu Asn Pro Leu Gln Lys Ile Asp Ala Ala Leu Ala Gln Val Asp Ala
420 425 430 Leu Arg Ser
Asp Leu Gly Ala Val Gln Asn Arg Phe Asn Ser Ala Ile 435
440 445 Thr Asn Leu Gly Asn Thr Val Asn
Asn Leu Ser Glu Ala Arg Ser Arg 450 455
460 Ile Glu Asp Ser Asp Tyr Ala Thr Glu Val Ser Asn Met
Ser Arg Ala465 470 475
480 Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln
485 490 495 Val Pro Gln Asn
Val Leu Ser Leu Leu Arg Met Glu Lys Leu Gln Leu 500
505 510 Lys Gly Thr Thr Tyr Gly Val Cys Ser
Lys Ala Phe Lys Phe Leu Gly 515 520
525 Thr Pro Ala Asp Thr Gly His Gly Thr Val Val Leu Glu Leu
Gln Tyr 530 535 540
Thr Gly Thr Asp Gly Pro Cys Lys Val Pro Ile Ser Ser Val Ala Ser545
550 555 560 Leu Asn Asp Leu Thr
Pro Val Gly Arg Leu Val Thr Val Asn Pro Phe 565
570 575 Val Ser Val Ala Thr Ala Asn Ala Lys Val
Leu Ile Glu Leu Glu Pro 580 585
590 Pro Phe Gly Asp Ser Tyr Ile Val Val Gly Arg Gly Glu Gln Gln
Ile 595 600 605 Asn
His His Trp His Lys Ser Gly Ser Ser Ile Gly Lys 610
615 620 311176DNAArtificial SequenceSTF2delta.EIII+
31atggcacaag taatcaacac taacagtctg tcgctgctga cccagaataa cctgaacaaa
60tcccagtccg cactgggcac cgctatcgag cgtctgtctt ctggtctgcg tatcaacagc
120gcgaaagacg atgcggcagg tcaggcgatt gctaaccgtt tcaccgcgaa catcaaaggt
180ctgactcagg cttcccgtaa cgctaacgac ggtatctcca ttgcgcagac cactgaaggc
240gcgctgaacg aaatcaacaa caacctgcag cgtgtgcgtg aactggcggt tcagtctgct
300aacagcacca actcccagtc tgacctcgac tccatccagg ctgaaatcac ccagcgcctg
360aacgaaatcg accgtgtatc cggccagact cagttcaacg gcgtgaaagt cctggcgcag
420gacaacaccc tgaccatcca ggttggcgcc aacgacggtg aaactatcga tatcgatctg
480aagcagatca actctcagac cctgggtctg gactcactga acgtgcatgg agcgccggtg
540gatcctgcta gcccatggac cgaaaacccg ctgcagaaaa ttgatgccgc gctggcgcag
600gtggatgcgc tgcgctctga tctgggtgcg gtacaaaacc gtttcaactc tgctatcacc
660aacctgggca ataccgtaaa caatctgtct gaagcgcgta gccgtatcga agattccgac
720tacgcgaccg aagtttccaa catgtctcgc gcgcagattt tgcagcaggc cggtacttcc
780gttctggcgc aggctaacca ggtcccgcag aacgtgctgt ctctgttacg tatggaaaaa
840ttgcagttga agggaacaac ctatggcgtc tgttcaaagg ctttcaagtt tcttgggact
900cccgcagaca caggtcacgg cactgtggtg ttggaattgc agtacactgg cacggatgga
960ccttgcaaag ttcctatctc gtcagtggct tcattgaacg acctaacgcc agtgggcaga
1020ttggtcactg tcaacccttt tgtttcagtg gccacggcca acgctaaggt cctgattgaa
1080ttggaaccac cctttggaga ctcatacata gtggtgggca gaggagaaca acagatcaat
1140caccattggc acaagtctgg aagcagcatt ggcaaa
117632392PRTArtificial SequenceSTF2delta.EIII+ 32Met Ala Gln Val Ile Asn
Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn1 5
10 15 Asn Leu Asn Lys Ser Gln Ser Ala Leu Gly Thr
Ala Ile Glu Arg Leu 20 25 30
Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln
35 40 45 Ala Ile Ala
Asn Arg Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala 50
55 60 Ser Arg Asn Ala Asn Asp Gly Ile
Ser Ile Ala Gln Thr Thr Glu Gly65 70 75
80 Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg
Glu Leu Ala 85 90 95
Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile
100 105 110 Gln Ala Glu Ile Thr
Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly 115
120 125 Gln Thr Gln Phe Asn Gly Val Lys Val
Leu Ala Gln Asp Asn Thr Leu 130 135
140 Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Asp
Ile Asp Leu145 150 155
160 Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Ser Leu Asn Val His
165 170 175 Gly Ala Pro Val
Asp Pro Ala Ser Pro Trp Thr Glu Asn Pro Leu Gln 180
185 190 Lys Ile Asp Ala Ala Leu Ala Gln Val
Asp Ala Leu Arg Ser Asp Leu 195 200
205 Gly Ala Val Gln Asn Arg Phe Asn Ser Ala Ile Thr Asn Leu
Gly Asn 210 215 220
Thr Val Asn Asn Leu Ser Glu Ala Arg Ser Arg Ile Glu Asp Ser Asp225
230 235 240 Tyr Ala Thr Glu Val
Ser Asn Met Ser Arg Ala Gln Ile Leu Gln Gln 245
250 255 Ala Gly Thr Ser Val Leu Ala Gln Ala Asn
Gln Val Pro Gln Asn Val 260 265
270 Leu Ser Leu Leu Arg Met Glu Lys Leu Gln Leu Lys Gly Thr Thr
Tyr 275 280 285 Gly
Val Cys Ser Lys Ala Phe Lys Phe Leu Gly Thr Pro Ala Asp Thr 290
295 300 Gly His Gly Thr Val Val
Leu Glu Leu Gln Tyr Thr Gly Thr Asp Gly305 310
315 320 Pro Cys Lys Val Pro Ile Ser Ser Val Ala Ser
Leu Asn Asp Leu Thr 325 330
335 Pro Val Gly Arg Leu Val Thr Val Asn Pro Phe Val Ser Val Ala Thr
340 345 350 Ala Asn Ala
Lys Val Leu Ile Glu Leu Glu Pro Pro Phe Gly Asp Ser 355
360 365 Tyr Ile Val Val Gly Arg Gly Glu
Gln Gln Ile Asn His His Trp His 370 375
380 Lys Ser Gly Ser Ser Ile Gly Lys385
390 331224DNAArtificial SequenceSTF2delta.EIII+ 33atggcacaag
taatcaacac taacagtctg tcgctgctga cccagaataa cctgaacaaa 60tcccagtccg
cactgggcac cgctatcgag cgtctgtctt ctggtctgcg tatcaacagc 120gcgaaagacg
atgcggcagg tcaggcgatt gctaaccgtt tcaccgcgaa catcaaaggt 180ctgactcagg
cttcccgtaa cgctaacgac ggtatctcca ttgcgcagac cactgaaggc 240gcgctgaacg
aaatcaacaa caacctgcag cgtgtgcgtg aactggcggt tcagtctgct 300aacagcacca
actcccagtc tgacctcgac tccatccagg ctgaaatcac ccagcgcctg 360aacgaaatcg
accgtgtatc cggccagact cagttcaacg gcgtgaaagt cctggcgcag 420gacaacaccc
tgaccatcca ggttggcgcc aacgacggtg aaactatcga tatcgatctg 480aagcagatca
actctcagac cctgggtctg gactcactga acgtgcatgg agcgccggtg 540gatcctgcta
gcccatggac cgaaaacccg ctgcagaaaa ttgatgccgc gctggcgcag 600gtggatgcgc
tgcgctctga tctgggtgcg gtacaaaacc gtttcaactc tgctatcacc 660aacctgggca
ataccgtaaa caatctgtct gaagcgcgta gccgtatcga agattccgac 720tacgcgaccg
aagtttccaa catgtctcgc gcgcagattt tgcagcaggc cggtacttcc 780gttctggcgc
aggctaacca ggtcccgcag aacgtgctgt ctctgttacg tgaattctgc 840agatatccag
cacagtggcg gccgctcatg gaaaaattgc agttgaaggg aacaacctat 900ggcgtctgtt
caaaggcttt caagtttctt gggactcccg cagacacagg tcacggcact 960gtggtgttgg
aattgcagta cactggcacg gatggacctt gcaaagttcc tatctcgtca 1020gtggcttcat
tgaacgacct aacgccagtg ggcagattgg tcactgtcaa cccttttgtt 1080tcagtggcca
cggccaacgc taaggtcctg attgaattgg aaccaccctt tggagactca 1140tacatagtgg
tgggcagagg agaacaacag atcaatcacc attggcacaa gtctggaagc 1200agcattggca
aacccttaat aagc
122434408PRTArtificial SequenceSTF2delta.EIII+ 34Met Ala Gln Val Ile Asn
Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn1 5
10 15 Asn Leu Asn Lys Ser Gln Ser Ala Leu Gly Thr
Ala Ile Glu Arg Leu 20 25 30
Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln
35 40 45 Ala Ile Ala
Asn Arg Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala 50
55 60 Ser Arg Asn Ala Asn Asp Gly Ile
Ser Ile Ala Gln Thr Thr Glu Gly65 70 75
80 Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg
Glu Leu Ala 85 90 95
Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile
100 105 110 Gln Ala Glu Ile Thr
Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly 115
120 125 Gln Thr Gln Phe Asn Gly Val Lys Val
Leu Ala Gln Asp Asn Thr Leu 130 135
140 Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Asp
Ile Asp Leu145 150 155
160 Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Ser Leu Asn Val His
165 170 175 Gly Ala Pro Val
Asp Pro Ala Ser Pro Trp Thr Glu Asn Pro Leu Gln 180
185 190 Lys Ile Asp Ala Ala Leu Ala Gln Val
Asp Ala Leu Arg Ser Asp Leu 195 200
205 Gly Ala Val Gln Asn Arg Phe Asn Ser Ala Ile Thr Asn Leu
Gly Asn 210 215 220
Thr Val Asn Asn Leu Ser Glu Ala Arg Ser Arg Ile Glu Asp Ser Asp225
230 235 240 Tyr Ala Thr Glu Val
Ser Asn Met Ser Arg Ala Gln Ile Leu Gln Gln 245
250 255 Ala Gly Thr Ser Val Leu Ala Gln Ala Asn
Gln Val Pro Gln Asn Val 260 265
270 Leu Ser Leu Leu Arg Glu Phe Cys Arg Tyr Pro Ala Gln Trp Arg
Pro 275 280 285 Leu
Met Glu Lys Leu Gln Leu Lys Gly Thr Thr Tyr Gly Val Cys Ser 290
295 300 Lys Ala Phe Lys Phe Leu
Gly Thr Pro Ala Asp Thr Gly His Gly Thr305 310
315 320 Val Val Leu Glu Leu Gln Tyr Thr Gly Thr Asp
Gly Pro Cys Lys Val 325 330
335 Pro Ile Ser Ser Val Ala Ser Leu Asn Asp Leu Thr Pro Val Gly Arg
340 345 350 Leu Val Thr
Val Asn Pro Phe Val Ser Val Ala Thr Ala Asn Ala Lys 355
360 365 Val Leu Ile Glu Leu Glu Pro Pro
Phe Gly Asp Ser Tyr Ile Val Val 370 375
380 Gly Arg Gly Glu Gln Gln Ile Asn His His Trp His Lys
Ser Gly Ser385 390 395
400 Ser Ile Gly Lys Pro Leu Ile Ser 405
351899DNAArtificial SequenceSTF2.EIII+ 35atggcacaag taatcaacac taacagtctg
tcgctgctga cccagaataa cctgaacaaa 60tcccagtccg cactgggcac cgctatcgag
cgtctgtctt ctggtctgcg tatcaacagc 120gcgaaagacg atgcggcagg tcaggcgatt
gctaaccgtt tcaccgcgaa catcaaaggt 180ctgactcagg cttcccgtaa cgctaacgac
ggtatctcca ttgcgcagac cactgaaggc 240gcgctgaacg aaatcaacaa caacctgcag
cgtgtgcgtg aactggcggt tcagtctgct 300aacagcacca actcccagtc tgacctcgac
tccatccagg ctgaaatcac ccagcgcctg 360aacgaaatcg accgtgtatc cggccagact
cagttcaacg gcgtgaaagt cctggcgcag 420gacaacaccc tgaccatcca ggttggcgcc
aacgacggtg aaactatcga tatcgatctg 480aagcagatca actctcagac cctgggtctg
gactcactga acgtgcagaa agcgtatgat 540gtgaaagata cagcagtaac aacgaaagct
tatgccaata atggtactac actggatgta 600tcgggtcttg atgatgcagc tattaaagcg
gctacgggtg gtacgaatgg tacggcttct 660gtaaccggtg gtgcggttaa atttgacgca
gataataaca agtactttgt tactattggt 720ggctttactg gtgctgatgc cgccaaaaat
ggcgattatg aagttaacgt tgctactgac 780ggtacagtaa cccttgcggc tggcgcaact
aaaaccacaa tgcctgctgg tgcgacaact 840aaaacagaag tacaggagtt aaaagataca
ccggcagttg tttcagcaga tgctaaaaat 900gccttaattg ctggcggcgt tgacgctacc
gatgctaatg gcgctgagtt ggtcaaaatg 960tcttataccg ataaaaatgg taagacaatt
gaaggcggtt atgcgcttaa agctggcgat 1020aagtattacg ccgcagatta cgatgaagcg
acaggagcaa ttaaagctaa aactacaagt 1080tatactgctg ctgacggcac taccaaaaca
gcggctaacc aactgggtgg cgtagacggt 1140aaaaccgaag tcgttactat cgacggtaaa
acctacaatg ccagcaaagc cgctggtcat 1200gatttcaaag cacaaccaga gctggcggaa
gcagccgcta aaaccaccga aaacccgctg 1260cagaaaattg atgccgcgct ggcgcaggtg
gatgcgctgc gctctgatct gggtgcggta 1320caaaaccgtt tcaactctgc tatcaccaac
ctgggcaata ccgtaaacaa tctgtctgaa 1380gcgcgtagcc gtatcgaaga ttccgactac
gcgaccgaag tttccaacat gtctcgcgcg 1440cagattctgc agcaggccgg tacttccgtt
ctggcgcagg ctaaccaggt cccgcagaac 1500gtgctgtctc tgttacgtga attctgcaga
tatccagcac agtggcggcc gctcatggaa 1560aaattgcagt tgaagggaac aacctatggc
gtctgttcaa aggctttcaa gtttcttggg 1620actcccgcag acacaggtca cggcactgtg
gtgttggaat tgcagtacac tggcacggat 1680ggaccttgca aagttcctat ctcgtcagtg
gcttcattga acgacctaac gccagtgggc 1740agattggtca ctgtcaaccc ttttgtttca
gtggccacgg ccaacgctaa ggtcctgatt 1800gaattggaac caccctttgg agactcatac
atagtggtgg gcagaggaga acaacagatc 1860aatcaccatt ggcacaagtc tggaagcagc
attggcaaa 189936633PRTArtificial
SequenceSTF2.EIII+ 36Met Ala Gln Val Ile Asn Thr Asn Ser Leu Ser Leu Leu
Thr Gln Asn1 5 10 15
Asn Leu Asn Lys Ser Gln Ser Ala Leu Gly Thr Ala Ile Glu Arg Leu
20 25 30 Ser Ser Gly Leu Arg
Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln 35 40
45 Ala Ile Ala Asn Arg Phe Thr Ala Asn Ile
Lys Gly Leu Thr Gln Ala 50 55 60
Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu
Gly65 70 75 80 Ala
Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ala
85 90 95 Val Gln Ser Ala Asn Ser
Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile 100
105 110 Gln Ala Glu Ile Thr Gln Arg Leu Asn Glu
Ile Asp Arg Val Ser Gly 115 120
125 Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ala Gln Asp Asn
Thr Leu 130 135 140
Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Asp Ile Asp Leu145
150 155 160 Lys Gln Ile Asn Ser
Gln Thr Leu Gly Leu Asp Ser Leu Asn Val Gln 165
170 175 Lys Ala Tyr Asp Val Lys Asp Thr Ala Val
Thr Thr Lys Ala Tyr Ala 180 185
190 Asn Asn Gly Thr Thr Leu Asp Val Ser Gly Leu Asp Asp Ala Ala
Ile 195 200 205 Lys
Ala Ala Thr Gly Gly Thr Asn Gly Thr Ala Ser Val Thr Gly Gly 210
215 220 Ala Val Lys Phe Asp Ala
Asp Asn Asn Lys Tyr Phe Val Thr Ile Gly225 230
235 240 Gly Phe Thr Gly Ala Asp Ala Ala Lys Asn Gly
Asp Tyr Glu Val Asn 245 250
255 Val Ala Thr Asp Gly Thr Val Thr Leu Ala Ala Gly Ala Thr Lys Thr
260 265 270 Thr Met Pro
Ala Gly Ala Thr Thr Lys Thr Glu Val Gln Glu Leu Lys 275
280 285 Asp Thr Pro Ala Val Val Ser Ala
Asp Ala Lys Asn Ala Leu Ile Ala 290 295
300 Gly Gly Val Asp Ala Thr Asp Ala Asn Gly Ala Glu Leu
Val Lys Met305 310 315
320 Ser Tyr Thr Asp Lys Asn Gly Lys Thr Ile Glu Gly Gly Tyr Ala Leu
325 330 335 Lys Ala Gly Asp
Lys Tyr Tyr Ala Ala Asp Tyr Asp Glu Ala Thr Gly 340
345 350 Ala Ile Lys Ala Lys Thr Thr Ser Tyr
Thr Ala Ala Asp Gly Thr Thr 355 360
365 Lys Thr Ala Ala Asn Gln Leu Gly Gly Val Asp Gly Lys Thr
Glu Val 370 375 380
Val Thr Ile Asp Gly Lys Thr Tyr Asn Ala Ser Lys Ala Ala Gly His385
390 395 400 Asp Phe Lys Ala Gln
Pro Glu Leu Ala Glu Ala Ala Ala Lys Thr Thr 405
410 415 Glu Asn Pro Leu Gln Lys Ile Asp Ala Ala
Leu Ala Gln Val Asp Ala 420 425
430 Leu Arg Ser Asp Leu Gly Ala Val Gln Asn Arg Phe Asn Ser Ala
Ile 435 440 445 Thr
Asn Leu Gly Asn Thr Val Asn Asn Leu Ser Glu Ala Arg Ser Arg 450
455 460 Ile Glu Asp Ser Asp Tyr
Ala Thr Glu Val Ser Asn Met Ser Arg Ala465 470
475 480 Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu
Ala Gln Ala Asn Gln 485 490
495 Val Pro Gln Asn Val Leu Ser Leu Leu Arg Glu Phe Cys Arg Tyr Pro
500 505 510 Ala Gln Trp
Arg Pro Leu Met Glu Lys Leu Gln Leu Lys Gly Thr Thr 515
520 525 Tyr Gly Val Cys Ser Lys Ala Phe
Lys Phe Leu Gly Thr Pro Ala Asp 530 535
540 Thr Gly His Gly Thr Val Val Leu Glu Leu Gln Tyr Thr
Gly Thr Asp545 550 555
560 Gly Pro Cys Lys Val Pro Ile Ser Ser Val Ala Ser Leu Asn Asp Leu
565 570 575 Thr Pro Val Gly
Arg Leu Val Thr Val Asn Pro Phe Val Ser Val Ala 580
585 590 Thr Ala Asn Ala Lys Val Leu Ile Glu
Leu Glu Pro Pro Phe Gly Asp 595 600
605 Ser Tyr Ile Val Val Gly Arg Gly Glu Gln Gln Ile Asn His
His Trp 610 615 620
His Lys Ser Gly Ser Ser Ile Gly Lys625 630
371143DNAArtificial SequenceSTF2delta.EIII+ 37atggcacaag taatcaacac
taacagtctg tcgctgctga cccagaataa cctgaacaaa 60tcccagtccg cactgggcac
cgctatcgag cgtctgtctt ctggtctgcg tatcaacagc 120gcgaaagacg atgcggcagg
tcaggcgatt gctaaccgtt tcaccgcgaa catcaaaggt 180ctgactcagg cttcccgtaa
cgctaacgac ggtatctcca ttgcgcagac cactgaaggc 240gcgctgaacg aaatcaacaa
caacctgcag cgtgtgcgtg aactggcggt tcagtctgct 300aacagcacca actcccagtc
tgacctcgac tccatccagg ctgaaatcac ccagcgcctg 360aacgaaatcg accgtgtatc
cggccagact cagttcaacg gcgtgaaagt cctggcgcag 420gacaacaccc tgaccatcca
ggttggcgcc aacgacggtg aaactatcga tatcgatctg 480aagcagatca actctcagac
cctgggtctg gactcactga acgtgaccga aaacccgctg 540cagaaaattg atgccgcgct
ggcgcaggtg gatgcgctgc gctctgatct gggtgcggta 600caaaaccgtt tcaactctgc
tatcaccaac ctgggcaata ccgtaaacaa tctgtctgaa 660gcgcgtagcc gtatcgaaga
ttccgactac gcgaccgaag tttccaacat gtctcgcgcg 720cagattctgc agcaggccgg
tacttccgtt ctggcgcagg ctaaccaggt cccgcagaac 780gtgctgtctc tgttacgtat
ggaaaaattg cagttgaagg gaacaaccta tggcgtctgt 840tcaaaggctt tcaagtttct
tgggactccc gcagacacag gtcacggcac tgtggtgttg 900gaattgcagt acactggcac
ggatggacct tgcaaagttc ctatctcgtc agtggcttca 960ttgaacgacc taacgccagt
gggcagattg gtcactgtca acccttttgt ttcagtggcc 1020acggccaacg ctaaggtcct
gattgaattg gaaccaccct ttggagactc atacatagtg 1080gtgggcagag gagaacaaca
gatcaatcac cattggcaca agtctggaag cagcattggc 1140aaa
114338381PRTArtificial
SequenceSTF2delta.EIII+ 38Met Ala Gln Val Ile Asn Thr Asn Ser Leu Ser Leu
Leu Thr Gln Asn1 5 10 15
Asn Leu Asn Lys Ser Gln Ser Ala Leu Gly Thr Ala Ile Glu Arg Leu
20 25 30 Ser Ser Gly Leu
Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln 35
40 45 Ala Ile Ala Asn Arg Phe Thr Ala Asn
Ile Lys Gly Leu Thr Gln Ala 50 55 60
Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr
Glu Gly65 70 75 80
Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ala
85 90 95 Val Gln Ser Ala Asn
Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile 100
105 110 Gln Ala Glu Ile Thr Gln Arg Leu Asn Glu
Ile Asp Arg Val Ser Gly 115 120
125 Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ala Gln Asp Asn
Thr Leu 130 135 140
Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Asp Ile Asp Leu145
150 155 160 Lys Gln Ile Asn Ser
Gln Thr Leu Gly Leu Asp Ser Leu Asn Val Thr 165
170 175 Glu Asn Pro Leu Gln Lys Ile Asp Ala Ala
Leu Ala Gln Val Asp Ala 180 185
190 Leu Arg Ser Asp Leu Gly Ala Val Gln Asn Arg Phe Asn Ser Ala
Ile 195 200 205 Thr
Asn Leu Gly Asn Thr Val Asn Asn Leu Ser Glu Ala Arg Ser Arg 210
215 220 Ile Glu Asp Ser Asp Tyr
Ala Thr Glu Val Ser Asn Met Ser Arg Ala225 230
235 240 Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu
Ala Gln Ala Asn Gln 245 250
255 Val Pro Gln Asn Val Leu Ser Leu Leu Arg Met Glu Lys Leu Gln Leu
260 265 270 Lys Gly Thr
Thr Tyr Gly Val Cys Ser Lys Ala Phe Lys Phe Leu Gly 275
280 285 Thr Pro Ala Asp Thr Gly His Gly
Thr Val Val Leu Glu Leu Gln Tyr 290 295
300 Thr Gly Thr Asp Gly Pro Cys Lys Val Pro Ile Ser Ser
Val Ala Ser305 310 315
320 Leu Asn Asp Leu Thr Pro Val Gly Arg Leu Val Thr Val Asn Pro Phe
325 330 335 Val Ser Val Ala
Thr Ala Asn Ala Lys Val Leu Ile Glu Leu Glu Pro 340
345 350 Pro Phe Gly Asp Ser Tyr Ile Val Val
Gly Arg Gly Glu Gln Gln Ile 355 360
365 Asn His His Trp His Lys Ser Gly Ser Ser Ile Gly Lys
370 375 380 39406PRTArtificial
SequenceWest Nile virus envelope 39Phe Asn Cys Leu Gly Met Ser Asn Arg
Asp Phe Leu Glu Gly Val Ser1 5 10
15 Gly Ala Thr Trp Val Asp Leu Val Leu Glu Gly Asp Ser Cys
Val Thr 20 25 30
Ile Met Ser Lys Asp Lys Pro Thr Ile Asp Val Lys Met Met Asn Met 35
40 45 Glu Ala Ala Asn Leu
Ala Glu Val Arg Ser Tyr Cys Tyr Leu Ala Thr 50 55
60 Val Ser Asp Leu Ser Thr Lys Ala Ala Cys
Pro Thr Met Gly Glu Ala65 70 75
80 His Asn Asp Lys Arg Ala Asp Pro Ala Phe Val Cys Arg Gln Gly
Val 85 90 95 Val
Asp Arg Gly Trp Gly Asn Gly Cys Gly Leu Phe Gly Lys Gly Ser
100 105 110 Ile Asp Thr Cys Ala
Lys Phe Ala Cys Ser Thr Lys Ala Ile Gly Arg 115
120 125 Thr Ile Leu Lys Glu Asn Ile Lys Tyr
Glu Val Ala Ile Phe Val His 130 135
140 Gly Pro Thr Thr Val Glu Ser His Gly Asn Tyr Ser Thr
Gln Val Gly145 150 155
160 Ala Thr Gln Ala Gly Arg Phe Ser Ile Thr Pro Ala Ala Pro Ser Tyr
165 170 175 Thr Leu Lys Leu
Gly Glu Tyr Gly Glu Val Thr Val Asp Cys Glu Pro 180
185 190 Arg Ser Gly Ile Asp Thr Asn Ala Tyr
Tyr Val Met Thr Val Gly Thr 195 200
205 Lys Thr Phe Leu Val His Arg Glu Trp Phe Met Asp Leu Asn
Leu Pro 210 215 220
Trp Ser Ser Ala Gly Ser Thr Val Trp Arg Asn Arg Glu Thr Leu Met225
230 235 240 Glu Phe Glu Glu Pro
His Ala Thr Lys Gln Ser Val Ile Ala Leu Gly 245
250 255 Ser Gln Glu Gly Ala Leu His Gln Ala Leu
Ala Gly Ala Ile Pro Val 260 265
270 Glu Phe Ser Ser Asn Thr Val Lys Leu Thr Ser Gly His Leu Lys
Cys 275 280 285 Arg
Val Lys Met Glu Lys Leu Gln Leu Lys Gly Thr Thr Tyr Gly Val 290
295 300 Cys Ser Lys Ala Phe Lys
Phe Leu Gly Thr Pro Ala Asp Thr Gly His305 310
315 320 Gly Thr Val Val Leu Glu Leu Gln Tyr Thr Gly
Thr Asp Gly Pro Cys 325 330
335 Lys Val Pro Ile Ser Ser Val Ala Ser Leu Asn Asp Leu Thr Pro Val
340 345 350 Gly Arg Leu
Val Thr Val Asn Pro Phe Val Ser Val Ala Thr Ala Asn 355
360 365 Ala Lys Val Leu Ile Glu Leu Glu
Pro Pro Phe Gly Asp Ser Tyr Ile 370 375
380 Val Val Gly Arg Gly Glu Gln Gln Ile Asn His His Trp
His Lys Ser385 390 395
400 Gly Ser Ser Ile Gly Lys 405 4099PRTArtificial
Sequenceflavivirus 40Gly Met Ser Tyr Ser Met Cys Thr Gly Lys Phe Lys Val
Val Lys Glu1 5 10 15
Ile Ala Glu Thr Gln His Gly Thr Ile Val Ile Arg Val Gln Tyr Glu
20 25 30 Gly Asp Gly Ser Pro
Cys Lys Ile Pro Phe Glu Ile Met Asp Leu Glu 35 40
45 Lys Arg His Val Leu Gly Arg Leu Ile Thr
Val Asn Pro Ile Val Thr 50 55 60
Glu Lys Asp Ser Pro Val Asn Ile Glu Ala Glu Pro Pro Phe Gly
Asp65 70 75 80 Ser
Tyr Ile Ile Ile Gly Val Glu Pro Gly Gln Leu Lys Leu Asn Trp
85 90 95 Phe Lys
Lys4138DNAArtificial Sequenceprimer 41ctcgggagat ctgcacaagt aatcaacact
aacagtct 384241DNAArtificial Sequenceprimer
42ccatgggcta gcaggatcca ccggcgctcc ctgcacgttc a
414342DNAArtificial Sequenceprimer 43ggagcgccgg tggatcctgc tagcccatgg
accgaaaacc cg 424484DNAArtificial Sequenceprimer
44tctgcagaat tcacgtaaca gagacagcac gttctgcggg acgtcccgca gaacgtgctg
60tctctgttac gtgaattctg caga
844520DNAArtificial Sequenceprimer 45tccggcgtag aggatcgaga
204654DNAArtificial Sequenceprimer
46caattgacct tcaagcttcg aattgccctt acgtaacaga gacagcacgt tctg
544757DNAArtificial Sequenceprimer 47aagcttgaag gtcaattgga attccctagg
actagtatgg aaaaattgca gttgaag 574820DNAArtificial Sequenceprimer
48gcttaatgcg ccgctacagg
204940DNAArtificial Sequenceprimer 49gcggccgctc atggaaaaat tgcagttgaa
gggaacaacc 405032DNAArtificial Sequenceprimer
50ccgcggtttg ccaatgctgc ttccagactt gt
325149DNAArtificial Sequenceprimer 51ccggcatgcc atatggcaca agtaatcaac
actaacagtc tgtcgctgc 495249DNAArtificial Sequenceprimer
52gcatgctcag cttattaagg gtttgccaat gctgcttccc agacttgtg
495327DNAArtificial Sequenceprimer 53tacgtgaatt cagcagatat ccagcac
27541911DNAArtificial SequenceSTF2.EIII+
54atggcacaag taatcaacac taacagtctg tcgctgctga cccagaataa cctgaacaaa
60tcccagtccg cactgggcac cgctatcgag cgtctgtctt ctggtctgcg tatcaacagc
120gcgaaagacg atgcggcagg tcaggcgatt gctaaccgtt tcaccgcgaa catcaaaggt
180ctgactcagg cttcccgtaa cgctaacgac ggtatctcca ttgcgcagac cactgaaggc
240gcgctgaacg aaatcaacaa caacctgcag cgtgtgcgtg aactggcggt tcagtctgct
300aacagcacca actcccagtc tgacctcgac tccatccagg ctgaaatcac ccagcgcctg
360aacgaaatcg accgtgtatc cggccagact cagttcaacg gcgtgaaagt cctggcgcag
420gacaacaccc tgaccatcca ggttggcgcc aacgacggtg aaactatcga tatcgatctg
480aagcagatca actctcagac cctgggtctg gactcactga acgtgcagaa agcgtatgat
540gtgaaagata cagcagtaac aacgaaagct tatgccaata atggtactac actggatgta
600tcgggtcttg atgatgcagc tattaaagcg gctacgggtg gtacgaatgg tacggcttct
660gtaaccggtg gtgcggttaa atttgacgca gataataaca agtactttgt tactattggt
720ggctttactg gtgctgatgc cgccaaaaat ggcgattatg aagttaacgt tgctactgac
780ggtacagtaa cccttgcggc tggcgcaact aaaaccacaa tgcctgctgg tgcgacaact
840aaaacagaag tacaggagtt aaaagataca ccggcagttg tttcagcaga tgctaaaaat
900gccttaattg ctggcggcgt tgacgctacc gatgctaatg gcgctgagtt ggtcaaaatg
960tcttataccg ataaaaatgg taagacaatt gaaggcggtt atgcgcttaa agctggcgat
1020aagtattacg ccgcagatta cgatgaagcg acaggagcaa ttaaagctaa aactacaagt
1080tatactgctg ctgacggcac taccaaaaca gcggctaacc aactgggtgg cgtagacggt
1140aaaaccgaag tcgttactat cgacggtaaa acctacaatg ccagcaaagc cgctggtcat
1200gatttcaaag cacaaccaga gctggcggaa gcagccgcta aaaccaccga aaacccgctg
1260cagaaaattg atgccgcgct ggcgcaggtg gatgcgctgc gctctgatct gggtgcggta
1320caaaaccgtt tcaactctgc tatcaccaac ctgggcaata ccgtaaacaa tctgtctgaa
1380gcgcgtagcc gtatcgaaga ttccgactac gcgaccgaag tttccaacat gtctcgcgcg
1440cagattctgc agcaggccgg tacttccgtt ctggcgcagg ctaaccaggt cccgcagaac
1500gtgctgtctc tgttacgtaa gggcaattcg aagcttgaag gtcaattgga attccctagg
1560actagtatgg aaaaattgca gttgaaggga acaacctatg gcgtctgttc aaaggctttc
1620aagtttcttg ggactcccgc agacacaggt cacggcactg tggtgttgga attgcagtac
1680actggcacgg atggaccttg caaagttcct atctcgtcag tggcttcatt gaacgaccta
1740acgccagtgg gcagattggt cactgtcaac ccttttgttt cagtggccac ggccaacgct
1800aaggtcctga ttgaattgga accacccttt ggagactcat acatagtggt gggcagagga
1860gaacaacaga tcaatcacca ttggcacaag tctggaagca gcattggcaa a
191155637PRTArtificial SequenceSTF2.EIII+ 55Met Ala Gln Val Ile Asn Thr
Asn Ser Leu Ser Leu Leu Thr Gln Asn1 5 10
15 Asn Leu Asn Lys Ser Gln Ser Ala Leu Gly Thr Ala
Ile Glu Arg Leu 20 25 30
Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln
35 40 45 Ala Ile Ala Asn
Arg Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala 50 55
60 Ser Arg Asn Ala Asn Asp Gly Ile Ser
Ile Ala Gln Thr Thr Glu Gly65 70 75
80 Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu
Leu Ala 85 90 95
Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile
100 105 110 Gln Ala Glu Ile Thr
Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly 115
120 125 Gln Thr Gln Phe Asn Gly Val Lys Val
Leu Ala Gln Asp Asn Thr Leu 130 135
140 Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Asp
Ile Asp Leu145 150 155
160 Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Ser Leu Asn Val Gln
165 170 175 Lys Ala Tyr Asp
Val Lys Asp Thr Ala Val Thr Thr Lys Ala Tyr Ala 180
185 190 Asn Asn Gly Thr Thr Leu Asp Val Ser
Gly Leu Asp Asp Ala Ala Ile 195 200
205 Lys Ala Ala Thr Gly Gly Thr Asn Gly Thr Ala Ser Val Thr
Gly Gly 210 215 220
Ala Val Lys Phe Asp Ala Asp Asn Asn Lys Tyr Phe Val Thr Ile Gly225
230 235 240 Gly Phe Thr Gly Ala
Asp Ala Ala Lys Asn Gly Asp Tyr Glu Val Asn 245
250 255 Val Ala Thr Asp Gly Thr Val Thr Leu Ala
Ala Gly Ala Thr Lys Thr 260 265
270 Thr Met Pro Ala Gly Ala Thr Thr Lys Thr Glu Val Gln Glu Leu
Lys 275 280 285 Asp
Thr Pro Ala Val Val Ser Ala Asp Ala Lys Asn Ala Leu Ile Ala 290
295 300 Gly Gly Val Asp Ala Thr
Asp Ala Asn Gly Ala Glu Leu Val Lys Met305 310
315 320 Ser Tyr Thr Asp Lys Asn Gly Lys Thr Ile Glu
Gly Gly Tyr Ala Leu 325 330
335 Lys Ala Gly Asp Lys Tyr Tyr Ala Ala Asp Tyr Asp Glu Ala Thr Gly
340 345 350 Ala Ile Lys
Ala Lys Thr Thr Ser Tyr Thr Ala Ala Asp Gly Thr Thr 355
360 365 Lys Thr Ala Ala Asn Gln Leu Gly
Gly Val Asp Gly Lys Thr Glu Val 370 375
380 Val Thr Ile Asp Gly Lys Thr Tyr Asn Ala Ser Lys Ala
Ala Gly His385 390 395
400 Asp Phe Lys Ala Gln Pro Glu Leu Ala Glu Ala Ala Ala Lys Thr Thr
405 410 415 Glu Asn Pro Leu
Gln Lys Ile Asp Ala Ala Leu Ala Gln Val Asp Ala 420
425 430 Leu Arg Ser Asp Leu Gly Ala Val Gln
Asn Arg Phe Asn Ser Ala Ile 435 440
445 Thr Asn Leu Gly Asn Thr Val Asn Asn Leu Ser Glu Ala Arg
Ser Arg 450 455 460
Ile Glu Asp Ser Asp Tyr Ala Thr Glu Val Ser Asn Met Ser Arg Ala465
470 475 480 Gln Ile Leu Gln Gln
Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln 485
490 495 Val Pro Gln Asn Val Leu Ser Leu Leu Arg
Lys Gly Asn Ser Lys Leu 500 505
510 Glu Gly Gln Leu Glu Phe Pro Arg Thr Ser Met Glu Lys Leu Gln
Leu 515 520 525 Lys
Gly Thr Thr Tyr Gly Val Cys Ser Lys Ala Phe Lys Phe Leu Gly 530
535 540 Thr Pro Ala Asp Thr Gly
His Gly Thr Val Val Leu Glu Leu Gln Tyr545 550
555 560 Thr Gly Thr Asp Gly Pro Cys Lys Val Pro Ile
Ser Ser Val Ala Ser 565 570
575 Leu Asn Asp Leu Thr Pro Val Gly Arg Leu Val Thr Val Asn Pro Phe
580 585 590 Val Ser Val
Ala Thr Ala Asn Ala Lys Val Leu Ile Glu Leu Glu Pro 595
600 605 Pro Phe Gly Asp Ser Tyr Ile Val
Val Gly Arg Gly Glu Gln Gln Ile 610 615
620 Asn His His Trp His Lys Ser Gly Ser Ser Ile Gly
Lys625 630 635 5610PRTArtificial
SequenceLinker 56Gly Ala Pro Val Asp Pro Ala Ser Pro Trp1 5
10 571218DNAArtificial SequenceWest Nile virus
envelope protein 57ttcaactgcc ttggaatgag caacagagac ttcttggaag gagtgtctgg
agcaacatgg 60gtggatttgg ttctcgaagg cgacagctgc gtgactatca tgtctaagga
caagcctacc 120atcgatgtga agatgatgaa tatggaggcg gccaacctgg cagaggtccg
cagttattgc 180tatttggcta ccgtcagcga tctctccacc aaagctgcgt gcccgaccat
gggagaagct 240cacaatgaca aacgtgctga cccagctttt gtgtgcagac aaggagtggt
ggacaggggc 300tggggcaacg gctgcggact atttggcaaa ggaagcattg acacatgcgc
caaatttgcc 360tgctctacca aggcaatagg aagaaccatc ttgaaagaga atatcaagta
cgaagtggcc 420atttttgtcc atggaccaac tactgtggag tcgcacggaa actactccac
acaggttgga 480gccactcagg cagggagatt cagcatcact cctgcagcgc cttcatacac
actaaagctt 540ggagaatatg gagaggtgac agtggactgt gaaccacggt cagggattga
caccaatgca 600tactacgtga tgactgttgg aacaaagacg ttcttggtcc atcgtgagtg
gttcatggac 660ctcaacctcc cttggagcag tgctggaagt actgtgtgga ggaacagaga
gacgttaatg 720gagtttgagg aaccacacgc cacgaagcag tctgtgatag cattgggctc
acaagaggga 780gctctgcatc aagctttggc tggagccatt cctgtggaat tttcaagcaa
cactgtcaag 840ttgacgtcgg gtcatttgaa gtgtagagtg aagatggaaa aattgcagtt
gaagggaaca 900acctatggcg tctgttcaaa ggctttcaag tttcttggga ctcccgcaga
cacaggtcac 960ggcactgtgg tgttggaatt gcagtacact ggcacggatg gaccttgcaa
agttcctatc 1020tcgtcagtgg cttcattgaa cgacctaacg ccagtgggca gattggtcac
tgtcaaccct 1080tttgtttcag tggccacggc caacgctaag gtcctgattg aattggaacc
accctttgga 1140gactcataca tagtggtggg cagaggagaa caacagatca atcaccattg
gcacaagtct 1200ggaagcagca ttggcaaa
121858506PRTS. muenchen 58Met Ala Gln Val Ile Asn Thr Asn Ser
Leu Ser Leu Leu Thr Gln Asn1 5 10
15 Asn Leu Asn Lys Ser Gln Ser Ala Leu Gly Thr Ala Ile Glu
Arg Leu 20 25 30
Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln 35
40 45 Ala Ile Ala Asn Arg
Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala 50 55
60 Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile
Ala Gln Thr Thr Glu Gly65 70 75
80 Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu
Ala 85 90 95 Val
Gln Ser Ala Asn Gly Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile
100 105 110 Gln Ala Glu Ile Thr
Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly 115
120 125 Gln Thr Gln Phe Asn Gly Val Lys Val
Leu Ala Gln Asp Asn Thr Leu 130 135
140 Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Asp
Ile Asp Leu145 150 155
160 Lys Glu Ile Ser Ser Lys Thr Leu Gly Leu Asp Lys Leu Asn Val Gln
165 170 175 Asp Ala Tyr Thr
Pro Lys Glu Thr Ala Val Thr Val Asp Lys Thr Thr 180
185 190 Tyr Lys Asn Gly Thr Asp Thr Ile Thr
Ala Gln Ser Asn Thr Asp Ile 195 200
205 Gln Thr Ala Ile Gly Gly Gly Ala Thr Gly Val Thr Gly Ala
Asp Ile 210 215 220
Lys Phe Lys Asp Gly Gln Tyr Tyr Leu Asp Val Lys Gly Gly Ala Ser225
230 235 240 Ala Gly Val Tyr Lys
Ala Thr Tyr Asp Glu Thr Thr Lys Lys Val Asn 245
250 255 Ile Asp Thr Thr Asp Lys Thr Pro Leu Ala
Thr Ala Glu Ala Thr Ala 260 265
270 Ile Arg Gly Thr Ala Thr Ile Thr His Asn Gln Ile Ala Glu Val
Thr 275 280 285 Lys
Glu Gly Val Asp Thr Thr Thr Val Ala Ala Gln Leu Ala Ala Ala 290
295 300 Gly Val Thr Gly Ala Asp
Lys Asp Asn Thr Ser Leu Val Lys Leu Ser305 310
315 320 Phe Glu Asp Lys Asn Gly Lys Val Ile Asp Gly
Gly Tyr Ala Val Lys 325 330
335 Met Gly Asp Asp Phe Tyr Ala Ala Thr Tyr Asp Glu Lys Thr Gly Thr
340 345 350 Ile Thr Ala
Lys Thr Thr Thr Tyr Thr Asp Gly Ala Gly Val Ala Gln 355
360 365 Thr Gly Ala Val Lys Phe Gly Gly
Ala Asn Gly Lys Ser Glu Val Val 370 375
380 Thr Ala Thr Asp Gly Lys Thr Tyr Leu Ala Ser Asp Leu
Asp Lys His385 390 395
400 Asn Phe Arg Thr Gly Gly Glu Leu Lys Glu Val Asn Thr Asp Lys Thr
405 410 415 Glu Asn Pro Leu
Gln Lys Ile Asp Ala Ala Leu Ala Gln Val Asp Thr 420
425 430 Leu Arg Ser Asp Leu Gly Ala Val Gln
Asn Arg Phe Asn Ser Ala Ile 435 440
445 Thr Asn Leu Gly Asn Thr Val Asn Asn Leu Ser Ser Ala Arg
Ser Arg 450 455 460
Ile Glu Asp Ser Asp Tyr Ala Thr Glu Val Ser Asn Met Ser Arg Ala465
470 475 480 Gln Ile Leu Gln Gln
Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln 485
490 495 Val Pro Gln Asn Val Leu Ser Leu Leu Arg
500 505 591521DNAS. muenchen 59atggcacaag
tcattaatac aaacagcctg tcgctgttga cccagaataa cctgaacaaa 60tcccagtccg
ctctgggcac cgctatcgag cgtctgtctt ccggtctgcg tatcaacagc 120gcgaaagacg
atgcggcagg tcaggcgatt gctaaccgtt tcaccgcgaa catcaaaggt 180ctgactcagg
cttcccgtaa cgctaacgac ggtatctcca ttgcgcagac cactgaaggc 240gcgctgaacg
aaatcaacaa caacctgcag cgtgtgcgtg aactggcggt tcagtctgct 300aacggtacta
actcccagtc tgaccttgac tctatccagg ctgaaatcac ccagcgtctg 360aacgaaatcg
accgtgtatc cggtcagact cagttcaacg gcgtgaaagt cctggcgcag 420gacaacaccc
tgaccatcca ggttggtgcc aacgacggtg aaactattga tattgattta 480aaagaaatta
gctctaaaac actgggactt gataagctta atgtccagga tgcctacacc 540ccgaaagaaa
ctgctgtaac cgttgataaa actacctata aaaatggtac agatactatt 600acagcccaga
gcaatactga tatccaaact gcaattggcg gtggtgcaac gggggttact 660ggggctgata
tcaaatttaa agatggtcaa tactatttag atgttaaagg cggtgcttct 720gctggtgttt
ataaagccac ttatgatgaa actacaaaga aagttaatat tgatacgact 780gataaaactc
cgttagcaac tgcggaagct acagctattc ggggaacggc cactataacc 840cacaaccaaa
ttgctgaagt aacaaaagag ggtgttgata cgaccacagt tgcggctcaa 900cttgctgctg
caggggttac tggtgccgat aaggacaata ctagccttgt aaaactatcg 960tttgaggata
aaaacggtaa ggttattgat ggtggctatg cagtgaaaat gggcgacgat 1020ttctatgccg
ctacatatga tgagaaaaca ggtacaatta ctgctaaaac aaccacttat 1080acagatggtg
ctggcgttgc tcaaactgga gctgtgaaat ttggtggcgc aaatggtaaa 1140tctgaagttg
ttactgctac cgatggtaaa acttacttag caagcgacct tgacaaacat 1200aacttcagaa
caggcggtga gcttaaagag gttaatacag ataagactga aaacccactg 1260cagaaaattg
atgctgcctt ggcacaggtt gatacacttc gttctgacct gggtgcggta 1320cagaaccgtt
tcaactccgc tatcaccaac ctgggcaata ccgtaaataa cctgtcttct 1380gcccgtagcc
gtatcgaaga ttccgactac gcgaccgaag tctccaacat gtctcgcgcg 1440cagattctgc
agcaggccgg tacctccgtt ctggcgcagg ctaaccaggt tccgcaaaac 1500gtcctctctt
tactgcgtta a
15216012PRTArtificial SequenceLinker 60Glu Phe Ser Arg Tyr Pro Ala Gln
Trp Arg Pro Leu1 5 10
6136DNAArtificial SequenceLinker 61gaattctcta gatatccagc acagtggcgg
ccgctc 366245PRTArtificial SequenceLinker
62Lys Gly Asn Ser Lys Leu Glu Gly Gln Leu Glu Phe Pro Arg Thr Ser1
5 10 15 Pro Val Trp Trp
Asn Ser Ala Asp Ile Gln His Ser Gly Gly Arg Gln 20
25 30 Cys Asp Gly Tyr Leu Gln Asn Ser Pro
Leu Arg Pro Leu 35 40 45
63135DNAArtificial SequenceLinker 63aagggcaatt cgaagcttga aggtcaattg
gaattcccta ggactagtcc agtgtggtgg 60aattctgcag atatccagca cagtggcggc
cgccagtgtg atggatatct gcagaattcg 120cccttgcggc cgctc
13564192PRTArtificial SequenceHepatitis
C E1 64Tyr Gln Val Arg Asn Ser Thr Gly Leu Tyr His Val Thr Asn Asp Cys1
5 10 15 Pro Asn Ser
Ser Ile Val Tyr Glu Ala Ala Asp Ala Ile Leu His Thr 20
25 30 Pro Gly Cys Val Pro Cys Val Arg
Glu Gly Asn Ala Ser Arg Cys Trp 35 40
45 Val Ala Met Thr Pro Thr Val Ala Thr Arg Asp Gly Lys
Leu Pro Ala 50 55 60
Thr Gln Leu Arg Arg His Ile Asp Leu Leu Val Gly Ser Ala Thr Leu65
70 75 80 Cys Ser Ala Leu Tyr
Val Gly Asp Leu Cys Gly Ser Val Phe Leu Val 85
90 95 Gly Gln Leu Phe Thr Phe Ser Pro Arg Arg
His Trp Thr Thr Gln Gly 100 105
110 Cys Asn Cys Ser Ile Tyr Pro Gly His Ile Thr Gly His Arg Met
Ala 115 120 125 Trp
Asp Met Met Met Asn Trp Ser Pro Thr Thr Ala Leu Val Met Ala 130
135 140 Gln Leu Leu Arg Ile Pro
Gln Ala Ile Leu Asp Met Ile Ala Gly Ala145 150
155 160 His Trp Gly Val Leu Ala Gly Ile Ala Tyr Phe
Ser Met Val Gly Asn 165 170
175 Trp Ala Lys Val Leu Val Val Leu Leu Leu Phe Ala Gly Val Asp Ala
180 185 190
65363PRTArtificial SequenceHepatitis C E2 65Glu Thr His Val Thr Gly Gly
Ser Ala Gly His Thr Val Ser Gly Phe1 5 10
15 Val Ser Leu Leu Ala Pro Gly Ala Lys Gln Asn Val
Gln Leu Ile Asn 20 25 30
Thr Asn Gly Ser Trp His Leu Asn Ser Thr Ala Leu Asn Cys Asn Asp
35 40 45 Ser Leu Asn Thr
Gly Trp Leu Ala Gly Leu Phe Tyr His His Lys Phe 50 55
60 Asn Ser Ser Gly Cys Pro Glu Arg Leu
Ala Ser Cys Arg Pro Leu Thr65 70 75
80 Asp Phe Asp Gln Gly Trp Gly Pro Ile Ser Tyr Ala Asn Gly
Ser Gly 85 90 95
Pro Asp Gln Arg Pro Tyr Cys Trp His Tyr Pro Pro Lys Pro Cys Gly
100 105 110 Ile Val Pro Ala Lys
Ser Val Cys Gly Pro Val Tyr Cys Phe Thr Pro 115
120 125 Ser Pro Val Val Val Gly Thr Thr Asp
Arg Ser Gly Ala Pro Thr Tyr 130 135
140 Ser Trp Gly Glu Asn Asp Thr Asp Val Phe Val Leu Asn
Asn Thr Arg145 150 155
160 Pro Pro Leu Gly Asn Trp Phe Gly Cys Thr Trp Met Asn Ser Thr Gly
165 170 175 Phe Thr Lys Val
Cys Gly Ala Pro Pro Cys Val Ile Gly Gly Ala Gly 180
185 190 Asn Asn Thr Leu His Cys Pro Thr Asp
Cys Phe Arg Lys His Pro Asp 195 200
205 Ala Thr Tyr Ser Arg Cys Gly Ser Gly Pro Trp Ile Thr Pro
Arg Cys 210 215 220
Leu Val Asp Tyr Pro Tyr Arg Leu Trp His Tyr Pro Cys Thr Ile Asn225
230 235 240 Tyr Thr Ile Phe Lys
Ile Arg Met Tyr Val Gly Gly Val Glu His Arg 245
250 255 Leu Glu Ala Ala Cys Asn Trp Thr Arg Gly
Glu Arg Cys Asp Leu Glu 260 265
270 Asp Arg Asp Arg Ser Glu Leu Ser Pro Leu Leu Leu Thr Thr Thr
Gln 275 280 285 Trp
Gln Val Leu Pro Cys Ser Phe Thr Thr Leu Pro Ala Leu Ser Thr 290
295 300 Gly Leu Ile His Leu His
Gln Asn Ile Val Asp Val Gln Tyr Leu Tyr305 310
315 320 Gly Val Gly Ser Ser Ile Ala Ser Trp Ala Ile
Lys Trp Glu Tyr Val 325 330
335 Val Leu Leu Phe Leu Leu Leu Ala Asp Ala Arg Val Cys Ser Cys Leu
340 345 350 Trp Met Met
Leu Leu Ile Ser Gln Ala Glu Ala 355 360
66576DNAArtificial SequenceHepatitis C E1 66taccaagtgc gcaactccac
ggggctctac cacgtcacca atgattgccc taactcgagt 60attgtgtacg aggcggccga
tgccatcctg cacactccgg ggtgcgtccc ttgcgttcgc 120gagggcaacg cctcgaggtg
ttgggtggcg atgaccccta cggtggccac cagggatggc 180aaactccccg cgacgcagct
tcgacgtcac atcgatctgc ttgtcgggag cgccaccctc 240tgttcggccc tctacgtggg
ggacctgtgc gggtctgtct ttcttgtcgg ccaactgttt 300accttctctc ccaggcgcca
ctggacgacg caaggttgca attgctctat ctatcccggc 360catataacgg gtcaccgcat
ggcatgggat atgatgatga actggtcccc tacgacggcg 420ttggtaatgg ctcagctgct
ccggatccca caagccatct tggacatgat cgctggtgct 480cactggggag tcctggcggg
catagcgtat ttctccatgg tggggaactg ggcgaaggtc 540ctggtagtgc tgctgctatt
tgccggcgtc gacgcg 576671089DNAArtificial
SequenceHepatitis C E2 67gaaacccacg tcaccggggg aagtgccggc cacactgtgt
ctggatttgt tagcctcctc 60gcaccaggcg ccaagcagaa cgtccagctg atcaacacca
acggcagttg gcacctcaat 120agcacggccc tgaactgcaa tgatagcctc aacaccggct
ggttggcagg gcttttctat 180caccacaagt tcaactcttc aggctgtcct gagaggctag
ccagctgccg accccttacc 240gattttgacc agggctgggg ccctatcagt tatgccaacg
gaagcggccc cgaccagcgc 300ccctactgct ggcactaccc cccaaaacct tgcggtattg
tgcccgcgaa gagtgtgtgt 360ggtccggtat attgcttcac tcccagcccc gtggtggtgg
gaacgaccga caggtcgggc 420gcgcccacct acagctgggg tgaaaatgat acggacgtct
tcgtccttaa caataccagg 480ccaccgctgg gcaattggtt cggttgtacc tggatgaact
caactggatt caccaaagtg 540tgcggagcgc ctccttgtgt catcggaggg gcgggcaaca
acaccctgca ctgccccact 600gattgcttcc gcaagcatcc ggacgccaca tactctcggt
gcggctccgg tccctggatc 660acacccaggt gcctggtcga ctacccgtat aggctttggc
attatccttg taccatcaac 720tacactatat ttaaaatcag gatgtacgtg ggaggggtcg
agcacaggct ggaagctgcc 780tgcaactgga cgcggggcga acgttgcgat ctggaagata
gggacaggtc cgagctcagc 840ccgttactgc tgaccactac acagtggcag gtcctcccgt
gttccttcac aaccctgcca 900gccttgtcca ccggcctcat ccacctccac cagaacattg
tggacgtgca gtacttgtac 960ggggtggggt caagcatcgc gtcctgggcc attaagtggg
agtacgtcgt cctcctgttc 1020cttctgcttg cagacgcgcg cgtctgctcc tgcttgtgga
tgatgctact catatcccaa 1080gcggaagcg
108968595PRTE. coli 68Met Ala Gln Val Ile Asn Thr
Asn Ser Leu Ser Leu Ile Thr Gln Asn1 5 10
15 Asn Ile Asn Lys Asn Gln Ser Ala Leu Ser Ser Ser
Ile Glu Arg Leu 20 25 30
Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln
35 40 45 Ala Ile Ala Asn
Arg Phe Thr Ser Asn Ile Lys Gly Leu Thr Gln Ala 50 55
60 Ala Arg Asn Ala Asn Asp Gly Ile Ser
Val Ala Gln Thr Thr Glu Gly65 70 75
80 Ala Leu Ser Glu Ile Asn Asn Asn Leu Gln Arg Ile Arg Glu
Leu Thr 85 90 95
Val Gln Ala Ser Thr Gly Thr Asn Ser Asp Ser Asp Leu Asp Ser Ile
100 105 110 Gln Asp Glu Ile Lys
Ser Arg Leu Asp Glu Ile Asp Arg Val Ser Gly 115
120 125 Gln Thr Gln Phe Asn Gly Val Asn Val
Leu Ala Lys Asp Gly Ser Met 130 135
140 Lys Ile Gln Val Gly Ala Asn Asp Gly Gln Thr Ile Thr
Ile Asp Leu145 150 155
160 Lys Lys Ile Asp Ser Asp Thr Leu Gly Leu Asn Gly Phe Asn Val Asn
165 170 175 Gly Ser Gly Thr
Ile Ala Asn Lys Ala Ala Thr Ile Ser Asp Leu Thr 180
185 190 Ala Ala Lys Met Asp Ala Ala Thr Asn
Thr Ile Thr Thr Thr Asn Asn 195 200
205 Ala Leu Thr Ala Ser Lys Ala Leu Asp Gln Leu Lys Asp Gly
Asp Thr 210 215 220
Val Thr Ile Lys Ala Asp Ala Ala Gln Thr Ala Thr Val Tyr Thr Tyr225
230 235 240 Asn Ala Ser Ala Gly
Asn Phe Ser Phe Ser Asn Val Ser Asn Asn Thr 245
250 255 Ser Ala Lys Ala Gly Asp Val Ala Ala Ser
Leu Leu Pro Pro Ala Gly 260 265
270 Gln Thr Ala Ser Gly Val Tyr Lys Ala Ala Ser Gly Glu Val Asn
Phe 275 280 285 Asp
Val Asp Ala Asn Gly Lys Ile Thr Ile Gly Gly Gln Lys Ala Tyr 290
295 300 Leu Thr Ser Asp Gly Asn
Leu Thr Thr Asn Asp Ala Gly Gly Ala Thr305 310
315 320 Ala Ala Thr Leu Asp Gly Leu Phe Lys Lys Ala
Gly Asp Gly Gln Ser 325 330
335 Ile Gly Phe Lys Lys Thr Ala Ser Val Thr Met Gly Gly Thr Thr Tyr
340 345 350 Asn Phe Lys
Thr Gly Ala Asp Ala Asp Ala Ala Thr Ala Asn Ala Gly 355
360 365 Val Ser Phe Thr Asp Thr Ala Ser
Lys Glu Thr Val Leu Asn Lys Val 370 375
380 Ala Thr Ala Lys Gln Gly Lys Ala Val Ala Ala Asp Gly
Asp Thr Ser385 390 395
400 Ala Thr Ile Thr Tyr Lys Ser Gly Val Gln Thr Tyr Gln Ala Val Phe
405 410 415 Ala Ala Gly Asp
Gly Thr Ala Ser Ala Lys Tyr Ala Asp Lys Ala Asp 420
425 430 Val Ser Asn Ala Thr Ala Thr Tyr Thr
Asp Ala Asp Gly Glu Met Thr 435 440
445 Thr Ile Gly Ser Tyr Thr Thr Lys Tyr Ser Ile Asp Ala Asn
Asn Gly 450 455 460
Lys Val Thr Val Asp Ser Gly Thr Gly Thr Gly Lys Tyr Ala Pro Lys465
470 475 480 Val Gly Ala Glu Val
Tyr Val Ser Ala Asn Gly Thr Leu Thr Thr Asp 485
490 495 Ala Thr Ser Glu Gly Thr Val Thr Lys Asp
Pro Leu Lys Ala Leu Asp 500 505
510 Glu Ala Ile Ser Ser Ile Asp Lys Phe Arg Ser Ser Leu Gly Ala
Ile 515 520 525 Gln
Asn Arg Leu Asp Ser Ala Val Thr Asn Leu Asn Asn Thr Thr Thr 530
535 540 Asn Leu Ser Glu Ala Gln
Ser Arg Ile Gln Asp Ala Asp Tyr Ala Thr545 550
555 560 Glu Val Ser Asn Met Ser Lys Ala Gln Ile Ile
Gln Gln Ala Gly Asn 565 570
575 Ser Val Leu Ala Lys Ala Asn Gln Val Pro Gln Gln Val Leu Ser Leu
580 585 590 Leu Gln Gly
595 691788DNAE. coli 69atggcacaag tcattaatac caacagcctc tcgctgatca
ctcaaaataa tatcaacaag 60aaccagtctg cgctgtcgag ttctatcgag cgtctgtctt
ctggcttgcg tattaacagc 120gcgaaggatg acgcagcggg tcaggcgatt gctaaccgtt
tcacctctaa cattaaaggc 180ctgactcagg cggcccgtaa cgccaacgac ggtatctccg
ttgcgcagac caccgaaggc 240gcgctgtccg aaatcaacaa caacttacag cgtatccgtg
aactgacggt tcaggcttct 300accgggacta actccgattc ggatctggac tccattcagg
acgaaatcaa atcccgtctg 360gacgaaattg accgcgtatc tggccagacc cagttcaacg
gcgtgaacgt actggcgaaa 420gacggttcaa tgaaaattca ggttggtgcg aatgacggcc
agactatcac gattgatctg 480aagaaaattg actcagatac gctggggctg aatggtttta
acgtgaatgg ttccggtacg 540atagccaata aagcggcgac cattagcgac ctgacagcag
cgaaaatgga tgctgcaact 600aatactataa ctacaacaaa taatgcgctg actgcatcaa
aggcgcttga tcaactgaaa 660gatggtgaca ctgttactat caaagcagat gctgctcaaa
ctgccacggt ttatacatac 720aatgcatcag ctggtaactt ctcattcagt aatgtatcga
ataatacttc agcaaaagca 780ggtgatgtag cagctagcct tctcccgccg gctgggcaaa
ctgctagtgg tgtttataaa 840gcagcaagcg gtgaagtgaa ctttgatgtt gatgcgaatg
gtaaaatcac aatcggagga 900cagaaagcat atttaactag tgatggtaac ttaactacaa
acgatgctgg tggtgcgact 960gcggctacgc ttgatggttt attcaagaaa gctggtgatg
gtcaatcaat cgggtttaag 1020aagactgcat cagtcacgat ggggggaaca acttataact
ttaaaacggg tgctgatgct 1080gatgctgcaa ctgctaacgc aggggtatcg ttcactgata
cagctagcaa agaaaccgtt 1140ttaaataaag tggctacagc taaacaaggc aaagcagttg
cagctgacgg tgatacatcc 1200gcaacaatta cctataaatc tggcgttcag acgtatcagg
ctgtatttgc cgcaggtgac 1260ggtactgcta gcgcaaaata tgccgataaa gctgacgttt
ctaatgcaac agcaacatac 1320actgatgctg atggtgaaat gactacaatt ggttcataca
ccacgaagta ttcaatcgat 1380gctaacaacg gcaaggtaac tgttgattct ggaactggta
cgggtaaata tgcgccgaaa 1440gtaggggctg aagtatatgt tagtgctaat ggtactttaa
caacagatgc aactagcgaa 1500ggcacagtaa caaaagatcc actgaaagct ctggatgaag
ctatcagctc catcgacaaa 1560ttccgttctt ccctgggtgc tatccagaac cgtctggatt
ccgcagtcac caacctgaac 1620aacaccacta ccaacctgtc cgaagcgcag tcccgtattc
aggacgccga ctatgcgacc 1680gaagtgtcca acatgtcgaa agcgcagatc attcagcagg
ccggtaactc cgtgctggca 1740aaagccaacc aggtaccgca gcaggttctg tctctgctgc
agggttaa 1788701224DNAArtificial SequenceSTF2delta.EIII+
70atggcacaag taatcaacac taacagtctg tcgctgctga cccagaataa cctgaacaaa
60tcccagtccg cactgggcac cgctatcgag cgtctgtctt ctggtctgcg tatcaacagc
120gcgaaagacg atgcggcagg tcaggcgatt gctaaccgtt tcaccgcgaa catcaaaggt
180ctgactcagg cttcccgtaa cgctaacgac ggtatctcca ttgcgcagac cactgaaggc
240gcgctgaacg aaatcaacaa caacctgcag cgtgtgcgtg aactggcggt tcagtctgct
300aacagcacca actcccagtc tgacctcgac tccatccagg ctgaaatcac ccagcgcctg
360aacgaaatcg accgtgtatc cggccagact cagttcaacg gcgtgaaagt cctggcgcag
420gacaacaccc tgaccatcca ggttggcgcc aacgacggtg aaactatcga tatcgatctg
480aagcagatca actctcagac cctgggtctg gactcactga acgtgcatgg agcgccggtg
540gatcctgcta gcccatggac cgaaaacccg ctgcagaaaa ttgatgccgc gctggcgcag
600gtggatgcgc tgcgctctga tctgggtgcg gtacaaaacc gtttcaactc tgctatcacc
660aacctgggca ataccgtaaa caatctgtct gaagcgcgta gccgtatcga agattccgac
720tacgcgaccg aagtttccaa catgtctcgc gcgcagattt tgcagcaggc cggtacttcc
780gttctggcgc aggctaacca ggtcccgcag aacgtgctgt ctctgttacg tgaattctgc
840agatatccag cacagtggcg gccgctcatg gaaaaattgc agttgaaggg aacaacctat
900ggcgtctgtt caaaggcttt caagtttctt gggactcccg cagacacagg tcacggcact
960gtggtgttgg aattgcagta cactggcacg gatggacctt gcaaagttcc tatctcgtca
1020gtggcttcat tgaacgacct aacgccagtg ggcagattgg tcactgtcaa cccttttgtt
1080tcagtggcca cggccaacgc taaggtcctg attgaattgg aaccaccctt tggagactca
1140tacatagtgg tgggcagagg agaacaacag atcaatcacc attggcacaa gtctggaagc
1200agcattggca aacccttaat aagc
122471408PRTArtificial SequenceSTF2delta.EIII+ 71Met Ala Gln Val Ile Asn
Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn1 5
10 15 Asn Leu Asn Lys Ser Gln Ser Ala Leu Gly Thr
Ala Ile Glu Arg Leu 20 25 30
Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln
35 40 45 Ala Ile Ala
Asn Arg Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala 50
55 60 Ser Arg Asn Ala Asn Asp Gly Ile
Ser Ile Ala Gln Thr Thr Glu Gly65 70 75
80 Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg
Glu Leu Ala 85 90 95
Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile
100 105 110 Gln Ala Glu Ile Thr
Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly 115
120 125 Gln Thr Gln Phe Asn Gly Val Lys Val
Leu Ala Gln Asp Asn Thr Leu 130 135
140 Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Asp
Ile Asp Leu145 150 155
160 Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Ser Leu Asn Val His
165 170 175 Gly Ala Pro Val
Asp Pro Ala Ser Pro Trp Thr Glu Asn Pro Leu Gln 180
185 190 Lys Ile Asp Ala Ala Leu Ala Gln Val
Asp Ala Leu Arg Ser Asp Leu 195 200
205 Gly Ala Val Gln Asn Arg Phe Asn Ser Ala Ile Thr Asn Leu
Gly Asn 210 215 220
Thr Val Asn Asn Leu Ser Glu Ala Arg Ser Arg Ile Glu Asp Ser Asp225
230 235 240 Tyr Ala Thr Glu Val
Ser Asn Met Ser Arg Ala Gln Ile Leu Gln Gln 245
250 255 Ala Gly Thr Ser Val Leu Ala Gln Ala Asn
Gln Val Pro Gln Asn Val 260 265
270 Leu Ser Leu Leu Arg Glu Phe Cys Arg Tyr Pro Ala Gln Trp Arg
Pro 275 280 285 Leu
Met Glu Lys Leu Gln Leu Lys Gly Thr Thr Tyr Gly Val Cys Ser 290
295 300 Lys Ala Phe Lys Phe Leu
Gly Thr Pro Ala Asp Thr Gly His Gly Thr305 310
315 320 Val Val Leu Glu Leu Gln Tyr Thr Gly Thr Asp
Gly Pro Cys Lys Val 325 330
335 Pro Ile Ser Ser Val Ala Ser Leu Asn Asp Leu Thr Pro Val Gly Arg
340 345 350 Leu Val Thr
Val Asn Pro Phe Val Ser Val Ala Thr Ala Asn Ala Lys 355
360 365 Val Leu Ile Glu Leu Glu Pro Pro
Phe Gly Asp Ser Tyr Ile Val Val 370 375
380 Gly Arg Gly Glu Gln Gln Ile Asn His His Trp His Lys
Ser Gly Ser385 390 395
400 Ser Ile Gly Lys Pro Leu Ile Ser 405
72408PRTArtificial SequenceSTF2delta.EIII+ 72Met Ala Gln Val Ile Asn Thr
Asn Ser Leu Ser Leu Leu Thr Gln Asn1 5 10
15 Asn Leu Asn Lys Ser Gln Ser Ala Leu Gly Thr Ala
Ile Glu Arg Leu 20 25 30
Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln
35 40 45 Ala Ile Ala Asn
Arg Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala 50 55
60 Ser Arg Asn Ala Asn Asp Gly Ile Ser
Ile Ala Gln Thr Thr Glu Gly65 70 75
80 Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu
Leu Ala 85 90 95
Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile
100 105 110 Gln Ala Glu Ile Thr
Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly 115
120 125 Gln Thr Gln Phe Asn Gly Val Lys Val
Leu Ala Gln Asp Asn Thr Leu 130 135
140 Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Asp
Ile Asp Leu145 150 155
160 Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Ser Leu Asn Val His
165 170 175 Gly Ala Pro Val
Asp Pro Ala Ser Pro Trp Thr Glu Asn Pro Leu Gln 180
185 190 Lys Ile Asp Ala Ala Leu Ala Gln Val
Asp Ala Leu Arg Ser Asp Leu 195 200
205 Gly Ala Val Gln Asn Arg Phe Asn Ser Ala Ile Thr Asn Leu
Gly Asn 210 215 220
Thr Val Asn Asn Leu Ser Glu Ala Arg Ser Arg Ile Glu Asp Ser Asp225
230 235 240 Tyr Ala Thr Glu Val
Ser Asn Met Ser Arg Ala Gln Ile Leu Gln Gln 245
250 255 Ala Gly Thr Ser Val Leu Ala Gln Ala Asn
Gln Val Pro Gln Asn Val 260 265
270 Leu Ser Leu Leu Arg Glu Phe Ser Arg Tyr Pro Ala Gln Trp Arg
Pro 275 280 285 Leu
Met Glu Lys Leu Gln Leu Lys Gly Thr Thr Tyr Gly Val Cys Ser 290
295 300 Lys Ala Phe Lys Phe Leu
Gly Thr Pro Ala Asp Thr Gly His Gly Thr305 310
315 320 Val Val Leu Glu Leu Gln Tyr Thr Gly Thr Asp
Gly Pro Cys Lys Val 325 330
335 Pro Ile Ser Ser Val Ala Ser Leu Asn Asp Leu Thr Pro Val Gly Arg
340 345 350 Leu Val Thr
Val Asn Pro Phe Val Ser Val Ala Thr Ala Asn Ala Lys 355
360 365 Val Leu Ile Glu Leu Glu Pro Pro
Phe Gly Asp Ser Tyr Ile Val Val 370 375
380 Gly Arg Gly Glu Gln Gln Ile Asn His His Trp His Lys
Ser Gly Ser385 390 395
400 Ser Ile Gly Lys Pro Leu Ile Ser 405
731227DNAArtificial SequenceSTF2delta.EIII+ 73atggcacaag taatcaacac
taacagtctg tcgctgctga cccagaataa cctgaacaaa 60tcccagtccg cactgggcac
cgctatcgag cgtctgtctt ctggtctgcg tatcaacagc 120gcgaaagacg atgcggcagg
tcaggcgatt gctaaccgtt tcaccgcgaa catcaaaggt 180ctgactcagg cttcccgtaa
cgctaacgac ggtatctcca ttgcgcagac cactgaaggc 240gcgctgaacg aaatcaacaa
caacctgcag cgtgtgcgtg aactggcggt tcagtctgct 300aacagcacca actcccagtc
tgacctcgac tccatccagg ctgaaatcac ccagcgcctg 360aacgaaatcg accgtgtatc
cggccagact cagttcaacg gcgtgaaagt cctggcgcag 420gacaacaccc tgaccatcca
ggttggcgcc aacgacggtg aaactatcga tatcgatctg 480aagcagatca actctcagac
cctgggtctg gactcactga acgtgcatgg agcgccggtg 540gatcctgcta gcccatggac
cgaaaacccg ctgcagaaaa ttgatgccgc gctggcgcag 600gtggatgcgc tgcgctctga
tctgggtgcg gtacaaaacc gtttcaactc tgctatcacc 660aacctgggca ataccgtaaa
caatctgtct gaagcgcgta gccgtatcga agattccgac 720tacgcgaccg aagtttccaa
catgtctcgc gcgcagattt tgcagcaggc cggtacttcc 780gttctggcgc aggctaacca
ggtcccgcag aacgtgctgt ctctgttacg tgaattctct 840agatatccag cacagtggcg
gccgctcatg gaaaaattgc agttgaaggg aacaacctat 900ggcgtctgtt caaaggcttt
caagtttctt gggactcccg cagacacagg tcacggcact 960gtggtgttgg aattgcagta
cactggcacg gatggacctt gcaaagttcc tatctcgtca 1020gtggcttcat tgaacgacct
aacgccagtg ggcagattgg tcactgtcaa cccttttgtt 1080tcagtggcca cggccaacgc
taaggtcctg attgaattgg aaccaccctt tggagactca 1140tacatagtgg tgggcagagg
agaacaacag atcaatcacc attggcacaa gtctggaagc 1200agcattggca aacccttaat
aagctga 12277435DNAArtificial
SequenceLinker 74gaattctcta gatatccagc acagtggcgg ccgct
357512PRTArtificial SequenceLinker 75Glu Phe Ser Arg Tyr Pro
Ala Gln Trp Arg Pro Leu1 5 10
76405PRTArtificial SequencepET/STF2delta.JEIII+ 76Met Ala Gln Val Ile Asn
Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn1 5
10 15 Asn Leu Asn Lys Ser Gln Ser Ala Leu Gly Thr
Ala Ile Glu Arg Leu 20 25 30
Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln
35 40 45 Ala Ile Ala
Asn Arg Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala 50
55 60 Ser Arg Asn Ala Asn Asp Gly Ile
Ser Ile Ala Gln Thr Thr Glu Gly65 70 75
80 Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg
Glu Leu Ala 85 90 95
Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile
100 105 110 Gln Ala Glu Ile Thr
Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly 115
120 125 Gln Thr Gln Phe Asn Gly Val Lys Val
Leu Ala Gln Asp Asn Thr Leu 130 135
140 Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Asp
Ile Asp Leu145 150 155
160 Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Ser Leu Asn Val His
165 170 175 Gly Ala Pro Val
Asp Pro Ala Ser Pro Trp Thr Glu Asn Pro Leu Gln 180
185 190 Lys Ile Asp Ala Ala Leu Ala Gln Val
Asp Ala Leu Arg Ser Asp Leu 195 200
205 Gly Ala Val Gln Asn Arg Phe Asn Ser Ala Ile Thr Asn Leu
Gly Asn 210 215 220
Thr Val Asn Asn Leu Ser Glu Ala Arg Ser Arg Ile Glu Asp Ser Asp225
230 235 240 Tyr Ala Thr Glu Val
Ser Asn Met Ser Arg Ala Gln Ile Leu Gln Gln 245
250 255 Ala Gly Thr Ser Val Leu Ala Gln Ala Asn
Gln Val Pro Gln Asn Val 260 265
270 Leu Ser Leu Leu Arg Glu Phe Ser Arg Tyr Pro Ala Gln Trp Arg
Pro 275 280 285 Leu
Met Asp Lys Leu Ala Leu Lys Gly Thr Thr Tyr Gly Met Cys Thr 290
295 300 Glu Lys Phe Ser Phe Ala
Lys Asn Pro Val Asp Thr Gly His Gly Thr305 310
315 320 Val Val Ile Glu Leu Ser Tyr Ser Gly Ser Asp
Gly Pro Cys Lys Ile 325 330
335 Pro Ile Val Ser Val Ala Ser Leu Asn Asp Met Thr Pro Val Gly Arg
340 345 350 Leu Val Thr
Val Asn Pro Phe Val Ala Thr Ser Ser Ala Asn Ser Lys 355
360 365 Val Leu Val Glu Met Glu Pro Pro
Phe Gly Asp Ser Tyr Ile Val Val 370 375
380 Gly Arg Gly Asp Lys Gln Ile Asn His His Trp His Lys
Ala Gly Ser385 390 395
400 Thr Leu Gly Lys Ala 405 771215DNAArtificial
SequencepET/STF2delta.JEIII+ 77atggcacaag taatcaacac taacagtctg
tcgctgctga cccagaataa cctgaacaaa 60tcccagtccg cactgggcac cgctatcgag
cgtctgtctt ctggtctgcg tatcaacagc 120gcgaaagacg atgcggcagg tcaggcgatt
gctaaccgtt tcaccgcgaa catcaaaggt 180ctgactcagg cttcccgtaa cgctaacgac
ggtatctcca ttgcgcagac cactgaaggc 240gcgctgaacg aaatcaacaa caacctgcag
cgtgtgcgtg aactggcggt tcagtctgct 300aacagcacca actcccagtc tgacctcgac
tccatccagg ctgaaatcac ccagcgcctg 360aacgaaatcg accgtgtatc cggccagact
cagttcaacg gcgtgaaagt cctggcgcag 420gacaacaccc tgaccatcca ggttggcgcc
aacgacggtg aaactatcga tatcgatctg 480aagcagatca actctcagac cctgggtctg
gactcactga acgtgcatgg agcgccggtg 540gatcctgcta gcccatggac cgaaaacccg
ctgcagaaaa ttgatgccgc gctggcgcag 600gtggatgcgc tgcgctctga tctgggtgcg
gtacaaaacc gtttcaactc tgctatcacc 660aacctgggca ataccgtaaa caatctgtct
gaagcgcgta gccgtatcga agattccgac 720tacgcgaccg aagtttccaa catgtctcgc
gcgcagattt tgcagcaggc cggtacttcc 780gttctggcgc aggctaacca ggtcccgcag
aacgtgctgt ctctgttacg tgaattcagc 840agatatccag cacagtggcg gccgctcatg
gacaaactgg ctctgaaagg cacaacctat 900ggcatgtgta cagaaaaatt ctcgttcgcg
aaaaatccgg tggacactgg tcacggaaca 960gttgtcattg aactctccta ctctgggagt
gatggcccct gcaaaattcc gattgtttcc 1020gttgcgagcc tcaatgacat gacccccgtt
gggcggctgg tgacagtgaa ccccttcgtc 1080gcgacttcca gtgccaactc aaaggtgctg
gtcgagatgg aacccccctt cggagactcc 1140tacatcgtag ttggaagggg agacaagcag
atcaaccacc attggcacaa agctggaagc 1200acgctgggca aggcc
121578348DNAArtificial SequenceJEIII+
78atggacaaac tggctctgaa aggcacaacc tatggcatgt gtacagaaaa attctcgttc
60gcgaaaaatc cggtggacac tggtcacgga acagttgtca ttgaactctc ctactctggg
120agtgatggcc cctgcaaaat tccgattgtt tccgttgcga gcctcaatga catgaccccc
180gttgggcggc tggtgacagt gaaccccttc gtcgcgactt ccagtgccaa ctcaaaggtg
240ctggtcgaga tggaaccccc cttcggagac tcctacatcg tagttggaag gggagacaag
300cagatcaacc accattggca caaagctgga agcacgctgg gcaaggcc
34879116PRTArtificial SequenceJEIII+ 79Met Asp Lys Leu Ala Leu Lys Gly
Thr Thr Tyr Gly Met Cys Thr Glu1 5 10
15 Lys Phe Ser Phe Ala Lys Asn Pro Val Asp Thr Gly His
Gly Thr Val 20 25 30
Val Ile Glu Leu Ser Tyr Ser Gly Ser Asp Gly Pro Cys Lys Ile Pro
35 40 45 Ile Val Ser Val
Ala Ser Leu Asn Asp Met Thr Pro Val Gly Arg Leu 50 55
60 Val Thr Val Asn Pro Phe Val Ala Thr
Ser Ser Ala Asn Ser Lys Val65 70 75
80 Leu Val Glu Met Glu Pro Pro Phe Gly Asp Ser Tyr Ile Val
Val Gly 85 90 95
Arg Gly Asp Lys Gln Ile Asn His His Trp His Lys Ala Gly Ser Thr
100 105 110 Leu Gly Lys Ala
115 80389PRTArtificial SequencepET/STF2delta.Den1 EIII 80Met Ala
Gln Val Ile Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn1 5
10 15 Asn Leu Asn Lys Ser Gln Ser
Ala Leu Gly Thr Ala Ile Glu Arg Leu 20 25
30 Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp
Ala Ala Gly Gln 35 40 45
Ala Ile Ala Asn Arg Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala
50 55 60 Ser Arg Asn
Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly65 70
75 80 Ala Leu Asn Glu Ile Asn Asn Asn
Leu Gln Arg Val Arg Glu Leu Ala 85 90
95 Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu
Asp Ser Ile 100 105 110
Gln Ala Glu Ile Thr Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly
115 120 125 Gln Thr Gln Phe
Asn Gly Val Lys Val Leu Ala Gln Asp Asn Thr Leu 130
135 140 Thr Ile Gln Val Gly Ala Asn Asp
Gly Glu Thr Ile Asp Ile Asp Leu145 150
155 160 Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Ser
Leu Asn Val His 165 170
175 Gly Ala Pro Val Asp Pro Ala Ser Pro Trp Thr Glu Asn Pro Leu Gln
180 185 190 Lys Ile Asp
Ala Ala Leu Ala Gln Val Asp Ala Leu Arg Ser Asp Leu 195
200 205 Gly Ala Val Gln Asn Arg Phe Asn
Ser Ala Ile Thr Asn Leu Gly Asn 210 215
220 Thr Val Asn Asn Leu Ser Glu Ala Arg Ser Arg Ile Glu
Asp Ser Asp225 230 235
240 Tyr Ala Thr Glu Val Ser Asn Met Ser Arg Ala Gln Ile Leu Gln Gln
245 250 255 Ala Gly Thr Ser
Val Leu Ala Gln Ala Asn Gln Val Pro Gln Asn Val 260
265 270 Leu Ser Leu Leu Arg Glu Phe Ser Arg
Tyr Pro Ala Gln Trp Arg Pro 275 280
285 Leu Lys Gly Met Ser Tyr Val Met Cys Thr Gly Ser Phe Lys
Leu Glu 290 295 300
Lys Glu Val Ala Glu Thr Gln His Gly Thr Val Leu Val Gln Val Lys305
310 315 320 Tyr Glu Gly Thr Asp
Ala Pro Cys Lys Ile Pro Phe Ser Thr Gln Asp 325
330 335 Glu Lys Gly Val Thr Gln Asn Gly Arg Leu
Ile Thr Ala Asn Pro Ile 340 345
350 Val Thr Asp Lys Glu Lys Pro Val Asn Ile Glu Ala Glu Pro Pro
Phe 355 360 365 Gly
Glu Asn Tyr Ile Val Val Gly Ala Gly Glu Lys Ala Leu Lys Leu 370
375 380 Ser Trp Phe Lys Lys385
811185DNAArtificial SequencepET/STF2delta.Den1 EIII
81atggcacaag taatcaacac taacagtctg tcgctgctga cccagaataa cctgaacaaa
60tcccagtccg cactgggcac cgctatcgag cgtctgtctt ctggtctgcg tatcaacagc
120gcgaaagacg atgcggcagg tcaggcgatt gctaaccgtt tcaccgcgaa catcaaaggt
180ctgactcagg cttcccgtaa cgctaacgac ggtatctcca ttgcgcagac cactgaaggc
240gcgctgaacg aaatcaacaa caacctgcag cgtgtgcgtg aactggcggt tcagtctgct
300aacagcacca actcccagtc tgacctcgac tccatccagg ctgaaatcac ccagcgcctg
360aacgaaatcg accgtgtatc cggccagact cagttcaacg gcgtgaaagt cctggcgcag
420gacaacaccc tgaccatcca ggttggcgcc aacgacggtg aaactatcga tatcgatctg
480aagcagatca actctcagac cctgggtctg gactcactga acgtgcatgg agcgccggtg
540gatcctgcta gcccatggac cgaaaacccg ctgcagaaaa ttgatgccgc gctggcgcag
600gtggatgcgc tgcgctctga tctgggtgcg gtacaaaacc gtttcaactc tgctatcacc
660aacctgggca ataccgtaaa caatctgtct gaagcgcgta gccgtatcga agattccgac
720tacgcgaccg aagtttccaa catgtctcgc gcgcagattt tgcagcaggc cggtacttcc
780gttctggcgc aggctaacca ggtcccgcag aacgtgctgt ctctgttacg tgaattcagc
840agatatccag cacagtggcg gccgctcaaa ggaatgtctt acgtaatgtg cacaggcagt
900ttcaagctgg aaaaagaagt tgccgaaaca cagcatggca cggtactagt ccaagtgaaa
960tatgagggaa cagacgcgcc atgtaagata ccattttcca ctcaagatga gaaaggggcg
1020actcagaacg gaagattgat aaccgcaaat cctatcgtaa ccgacaagga aaagcccgtg
1080aatattgagg cagagcctcc gtttggggag tcgtatatcg tcgttggtgc tggtgaaaag
1140gctttaaagc tcagttggtt caaaaagggg tcaagcattg gtaaa
118582389PRTArtificial SequencepET/STF2delta.Den2 EIII 82Met Ala Gln Val
Ile Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn1 5
10 15 Asn Leu Asn Lys Ser Gln Ser Ala Leu
Gly Thr Ala Ile Glu Arg Leu 20 25
30 Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala
Gly Gln 35 40 45
Ala Ile Ala Asn Arg Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala 50
55 60 Ser Arg Asn Ala Asn
Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly65 70
75 80 Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln
Arg Val Arg Glu Leu Ala 85 90
95 Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser
Ile 100 105 110 Gln
Ala Glu Ile Thr Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly 115
120 125 Gln Thr Gln Phe Asn Gly
Val Lys Val Leu Ala Gln Asp Asn Thr Leu 130 135
140 Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr
Ile Asp Ile Asp Leu145 150 155
160 Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Ser Leu Asn Val His
165 170 175 Gly Ala Pro
Val Asp Pro Ala Ser Pro Trp Thr Glu Asn Pro Leu Gln 180
185 190 Lys Ile Asp Ala Ala Leu Ala Gln
Val Asp Ala Leu Arg Ser Asp Leu 195 200
205 Gly Ala Val Gln Asn Arg Phe Asn Ser Ala Ile Thr Asn
Leu Gly Asn 210 215 220
Thr Val Asn Asn Leu Ser Glu Ala Arg Ser Arg Ile Glu Asp Ser Asp225
230 235 240 Tyr Ala Thr Glu Val
Ser Asn Met Ser Arg Ala Gln Ile Leu Gln Gln 245
250 255 Ala Gly Thr Ser Val Leu Ala Gln Ala Asn
Gln Val Pro Gln Asn Val 260 265
270 Leu Ser Leu Leu Arg Glu Phe Ser Arg Tyr Pro Ala Gln Trp Arg
Pro 275 280 285 Leu
Lys Gly Met Ser Tyr Ser Met Cys Thr Gly Lys Phe Lys Val Val 290
295 300 Lys Glu Ile Ala Glu Thr
Gln His Gly Thr Ile Val Ile Arg Val Gln305 310
315 320 Tyr Glu Gly Asp Gly Ser Pro Cys Lys Thr Pro
Phe Glu Ile Met Asp 325 330
335 Leu Glu Lys Arg His Val Leu Gly Arg Leu Thr Thr Val Asn Pro Ile
340 345 350 Val Thr Glu
Lys Asp Ser Pro Val Asn Ile Glu Ala Glu Pro Pro Phe 355
360 365 Gly Asp Ser Tyr Ile Ile Ile Gly
Val Glu Pro Gly Gln Leu Lys Leu 370 375
380 Asp Trp Phe Lys Lys385
831185DNAArtificial SequencepET/STF2delta.Den2 EIII 83atggcacaag
taatcaacac taacagtctg tcgctgctga cccagaataa cctgaacaaa 60tcccagtccg
cactgggcac cgctatcgag cgtctgtctt ctggtctgcg tatcaacagc 120gcgaaagacg
atgcggcagg tcaggcgatt gctaaccgtt tcaccgcgaa catcaaaggt 180ctgactcagg
cttcccgtaa cgctaacgac ggtatctcca ttgcgcagac cactgaaggc 240gcgctgaacg
aaatcaacaa caacctgcag cgtgtgcgtg aactggcggt tcagtctgct 300aacagcacca
actcccagtc tgacctcgac tccatccagg ctgaaatcac ccagcgcctg 360aacgaaatcg
accgtgtatc cggccagact cagttcaacg gcgtgaaagt cctggcgcag 420gacaacaccc
tgaccatcca ggttggcgcc aacgacggtg aaactatcga tatcgatctg 480aagcagatca
actctcagac cctgggtctg gactcactga acgtgcatgg agcgccggtg 540gatcctgcta
gcccatggac cgaaaacccg ctgcagaaaa ttgatgccgc gctggcgcag 600gtggatgcgc
tgcgctctga tctgggtgcg gtacaaaacc gtttcaactc tgctatcacc 660aacctgggca
ataccgtaaa caatctgtct gaagcgcgta gccgtatcga agattccgac 720tacgcgaccg
aagtttccaa catgtctcgc gcgcagattt tgcagcaggc cggtacttcc 780gttctggcgc
aggctaacca ggtcccgcag aacgtgctgt ctctgttacg tgaattcagc 840agatatccag
cacagtggcg gccgctcaaa ggtatgagct atagcatgtg taccggtaaa 900tttaaagttg
ttaaagaaat tgcggaaacc cagcatggta ccattgttat tcgtgttcag 960tatgaaggtg
atggtagccc gtgtaaaatt ccgtttgaaa ttatggatct ggaaaaacgt 1020catgttctgg
gtcgtctgat taccgttaat ccgattgtta ccgaaaaaga tagcccggtt 1080aatattgaag
cggaaccgcc gtttggtgat agctatatta ttattggtgt tgaaccgggt 1140cagctgaaac
tgaattggtt taaaaaaggt agcagcattg gtcag
118584389PRTArtificial SequencepET/STF2delta.Den3 EIII 84Met Ala Gln Val
Ile Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn1 5
10 15 Asn Leu Asn Lys Ser Gln Ser Ala Leu
Gly Thr Ala Ile Glu Arg Leu 20 25
30 Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala
Gly Gln 35 40 45
Ala Ile Ala Asn Arg Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala 50
55 60 Ser Arg Asn Ala Asn
Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly65 70
75 80 Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln
Arg Val Arg Glu Leu Ala 85 90
95 Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser
Ile 100 105 110 Gln
Ala Glu Ile Thr Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly 115
120 125 Gln Thr Gln Phe Asn Gly
Val Lys Val Leu Ala Gln Asp Asn Thr Leu 130 135
140 Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr
Ile Asp Ile Asp Leu145 150 155
160 Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Ser Leu Asn Val His
165 170 175 Gly Ala Pro
Val Asp Pro Ala Ser Pro Trp Thr Glu Asn Pro Leu Gln 180
185 190 Lys Ile Asp Ala Ala Leu Ala Gln
Val Asp Ala Leu Arg Ser Asp Leu 195 200
205 Gly Ala Val Gln Asn Arg Phe Asn Ser Ala Ile Thr Asn
Leu Gly Asn 210 215 220
Thr Val Asn Asn Leu Ser Glu Ala Arg Ser Arg Ile Glu Asp Ser Asp225
230 235 240 Tyr Ala Thr Glu Val
Ser Asn Met Ser Arg Ala Gln Ile Leu Gln Gln 245
250 255 Ala Gly Thr Ser Val Leu Ala Gln Ala Asn
Gln Val Pro Gln Asn Val 260 265
270 Leu Ser Leu Leu Arg Glu Phe Ser Arg Tyr Pro Ala Gln Trp Arg
Pro 275 280 285 Leu
Lys Gly Met Ser Tyr Ala Met Cys Leu Asn Thr Phe Val Leu Lys 290
295 300 Lys Glu Val Ser Glu Thr
Gln His Gly Thr Ile Leu Ile Lys Val Glu305 310
315 320 Tyr Lys Gly Glu Asp Ala Pro Cys Lys Ile Pro
Phe Ser Thr Glu Asp 325 330
335 Gly Gln Gly Lys Ala His Asn Gly Arg Leu Ile Thr Ala Asn Pro Val
340 345 350 Val Thr Lys
Lys Glu Glu Pro Val Asn Ile Glu Ala Glu Pro Pro Phe 355
360 365 Gly Glu Ser Asn Ile Val Ile Gly
Ile Gly Asp Lys Ala Leu Lys Ile 370 375
380 Asn Trp Tyr Arg Lys385
851185DNAArtificial SequencepET/STF2delta.Den3 EIII 85atggcacaag
taatcaacac taacagtctg tcgctgctga cccagaataa cctgaacaaa 60tcccagtccg
cactgggcac cgctatcgag cgtctgtctt ctggtctgcg tatcaacagc 120gcgaaagacg
atgcggcagg tcaggcgatt gctaaccgtt tcaccgcgaa catcaaaggt 180ctgactcagg
cttcccgtaa cgctaacgac ggtatctcca ttgcgcagac cactgaaggc 240gcgctgaacg
aaatcaacaa caacctgcag cgtgtgcgtg aactggcggt tcagtctgct 300aacagcacca
actcccagtc tgacctcgac tccatccagg ctgaaatcac ccagcgcctg 360aacgaaatcg
accgtgtatc cggccagact cagttcaacg gcgtgaaagt cctggcgcag 420gacaacaccc
tgaccatcca ggttggcgcc aacgacggtg aaactatcga tatcgatctg 480aagcagatca
actctcagac cctgggtctg gactcactga acgtgcatgg agcgccggtg 540gatcctgcta
gcccatggac cgaaaacccg ctgcagaaaa ttgatgccgc gctggcgcag 600gtggatgcgc
tgcgctctga tctgggtgcg gtacaaaacc gtttcaactc tgctatcacc 660aacctgggca
ataccgtaaa caatctgtct gaagcgcgta gccgtatcga agattccgac 720tacgcgaccg
aagtttccaa catgtctcgc gcgcagattt tgcagcaggc cggtacttcc 780gttctggcgc
aggctaacca ggtcccgcag aacgtgctgt ctctgttacg tgaattcagc 840agatatccag
cacagtggcg gccgctcaaa ggaatgagtt atgcaatgtg tttaaataca 900tttgtattaa
aaaaagaagt aagtgaaaca caacatggaa caatattaat aaaagtagaa 960tataaaggag
aagatgcacc atgtaaaata ccatttagta cagaagatgg acaaggaaaa 1020gcacataatg
gaagattaat aacagcaaat ccagtagtaa caaaaaaaga agaaccagta 1080aatatagaag
cagaaccacc atttggagaa agtaatatag taataggaat aggagataaa 1140gcattaaaaa
taaattggta tagaaaagga agtagtatag gaaaa
118586388PRTArtificial SequencepET/STF2delta.Den4 EIII 86Met Ala Gln Val
Ile Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn1 5
10 15 Asn Leu Asn Lys Ser Gln Ser Ala Leu
Gly Thr Ala Ile Glu Arg Leu 20 25
30 Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala
Gly Gln 35 40 45
Ala Ile Ala Asn Arg Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala 50
55 60 Ser Arg Asn Ala Asn
Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly65 70
75 80 Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln
Arg Val Arg Glu Leu Ala 85 90
95 Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser
Ile 100 105 110 Gln
Ala Glu Ile Thr Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly 115
120 125 Gln Thr Gln Phe Asn Gly
Val Lys Val Leu Ala Gln Asp Asn Thr Leu 130 135
140 Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr
Ile Asp Ile Asp Leu145 150 155
160 Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Ser Leu Asn Val His
165 170 175 Gly Ala Pro
Val Asp Pro Ala Ser Pro Trp Thr Glu Asn Pro Leu Gln 180
185 190 Lys Ile Asp Ala Ala Leu Ala Gln
Val Asp Ala Leu Arg Ser Asp Leu 195 200
205 Gly Ala Val Gln Asn Arg Phe Asn Ser Ala Ile Thr Asn
Leu Gly Asn 210 215 220
Thr Val Asn Asn Leu Ser Glu Ala Arg Ser Arg Ile Glu Asp Ser Asp225
230 235 240 Tyr Ala Thr Glu Val
Ser Asn Met Ser Arg Ala Gln Ile Leu Gln Gln 245
250 255 Ala Gly Thr Ser Val Leu Ala Gln Ala Asn
Gln Val Pro Gln Asn Val 260 265
270 Leu Ser Leu Leu Arg Glu Phe Ser Arg Tyr Pro Ala Gln Trp Arg
Pro 275 280 285 Leu
Lys Gly Met Ser Tyr Thr Met Cys Ser Gly Lys Phe Ser Ile Asp 290
295 300 Lys Glu Met Ala Glu Thr
Gln His Gly Thr Thr Val Val Lys Val Lys305 310
315 320 Tyr Glu Gly Ala Gly Ala Pro Cys Lys Val Pro
Ile Glu Ile Arg Asp 325 330
335 Val Asn Lys Glu Lys Val Val Gly Arg Ile Ile Ser Pro Thr Pro Phe
340 345 350 Ala Glu Asn
Thr Asn Ser Val Thr Asn Ile Glu Leu Glu Arg Pro Leu 355
360 365 Asp Ser Tyr Ile Val Ile Gly Val
Gly Asp Ser Ala Leu Thr Leu His 370 375
380 Trp Phe Arg Lys385 871185DNAArtificial
SequencePET/STF2delta.Den4 EIII 87atggcacaag taatcaacac taacagtctg
tcgctgctga cccagaataa cctgaacaaa 60tcccagtccg cactgggcac cgctatcgag
cgtctgtctt ctggtctgcg tatcaacagc 120gcgaaagacg atgcggcagg tcaggcgatt
gctaaccgtt tcaccgcgaa catcaaaggt 180ctgactcagg cttcccgtaa cgctaacgac
ggtatctcca ttgcgcagac cactgaaggc 240gcgctgaacg aaatcaacaa caacctgcag
cgtgtgcgtg aactggcggt tcagtctgct 300aacagcacca actcccagtc tgacctcgac
tccatccagg ctgaaatcac ccagcgcctg 360aacgaaatcg accgtgtatc cggccagact
cagttcaacg gcgtgaaagt cctggcgcag 420gacaacaccc tgaccatcca ggttggcgcc
aacgacggtg aaactatcga tatcgatctg 480aagcagatca actctcagac cctgggtctg
gactcactga acgtgcatgg agcgccggtg 540gatcctgcta gcccatggac cgaaaacccg
ctgcagaaaa ttgatgccgc gctggcgcag 600gtggatgcgc tgcgctctga tctgggtgcg
gtacaaaacc gtttcaactc tgctatcacc 660aacctgggca ataccgtaaa caatctgtct
gaagcgcgta gccgtatcga agattccgac 720tacgcgaccg aagtttccaa catgtctcgc
gcgcagattt tgcagcaggc cggtacttcc 780gttctggcgc aggctaacca ggtcccgcag
aacgtgctgt ctctgttacg tgaattcagc 840agatatccag cacagtggcg gccgctcaag
ggaatgtcat acacgatgtg tagtggtaaa 900ttctctatag acaaagagat ggcagagaca
caacacggga caaccgtcgt gaaggttaag 960tatgaaggag ctggcgcacc gtgcaaagta
cccatcgaaa ttagggatgt aaacaaagag 1020aaggtcgttg ggcgtatcat tagctcaacc
ccacttgcgg aaaatactaa ttctgtaacg 1080aacatagagt tggaaccacc ttttggtgat
agctatatag ttattggtgt gggcaatagt 1140gccttaactc tacattggtt tagaaaagga
tcctcgatcg ggaaa 11858827PRTArtificial SequenceWest
Nile virus 88Leu Thr Ser Gly His Leu Lys Cys Arg Val Lys Met Glu Lys Leu
Gln1 5 10 15 Leu
Lys Gly Thr Thr Tyr Gly Val Cys Ser Lys 20 25
8927PRTArtificial SequenceJapanese encephalitis virus 89Leu Thr
Ser Gly His Leu Lys Cys Arg Leu Lys Met Asp Lys Leu Ala1 5
10 15 Leu Lys Gly Thr Thr Tyr Gly
Met Cys Thr Glu 20 25
9027PRTArtificial SequenceDengue virus 90Ile Phe Ala Gly His Leu Lys Cys
Arg Leu Lys Met Asp Lys Leu Thr1 5 10
15 Leu Lys Gly Met Ser Tyr Val Met Cys Thr Gly
20 25 9127PRTArtificial SequenceDengue virus
91Leu Phe Thr Gly His Leu Lys Cys Arg Leu Arg Met Asp Lys Leu Gln1
5 10 15 Leu Lys Gly Met
Ser Tyr Ser Met Cys Thr Gly 20 25
9227PRTArtificial SequenceDengue virus 92Ile Phe Ala Gly His Leu Lys Cys
Arg Leu Lys Met Asp Lys Leu Lys1 5 10
15 Leu Lys Gly Met Ser Tyr Ala Met Cys Leu Asn
20 25 9327PRTArtificial SequenceDengue virus
93Met Phe Ala Gly His Leu Lys Cys Lys Val Arg Met Glu Lys Leu Arg1
5 10 15 Ile Lys Gly Met
Ser Tyr Thr Met Cys Ser Gly 20 25
9427PRTArtificial SequenceFlavivirus envelope protein 94Xaa Xaa Xaa Gly
His Leu Lys Cys Arg Xaa Xaa Met Xaa Lys Leu Xaa1 5
10 15 Leu Lys Gly Xaa Xaa Tyr Xaa Xaa Cys
Xaa Xaa 20 25 9514PRTArtificial
SequenceFlavivirus envelope protein 95Gly His Leu Lys Cys Arg Met Lys Leu
Leu Lys Gly Tyr Cys1 5 10
96100PRTArtificial SequenceDengue virus 96Lys Gly Met Ser Tyr Val Met
Cys Thr Gly Ser Phe Lys Leu Glu Lys1 5 10
15 Glu Val Ala Glu Thr Gln His Gly Thr Val Leu Val
Gln Val Lys Tyr 20 25 30
Glu Gly Thr Asp Ala Pro Cys Lys Ile Pro Phe Ser Thr Gln Asp Glu
35 40 45 Lys Gly Val Thr
Gln Asn Gly Arg Leu Ile Thr Ala Asn Pro Ile Val 50 55
60 Thr Asp Lys Glu Lys Pro Val Asn Ile
Glu Ala Glu Pro Pro Phe Gly65 70 75
80 Glu Asn Tyr Ile Val Val Gly Ala Gly Glu Lys Ala Leu Lys
Leu Ser 85 90 95
Trp Phe Lys Lys 100 97100PRTArtificial SequenceDengue virus
97Lys Gly Met Ser Tyr Ser Met Cys Thr Gly Lys Phe Lys Val Val Lys1
5 10 15 Glu Ile Ala Glu
Thr Gln His Gly Thr Ile Val Ile Arg Val Gln Tyr 20
25 30 Glu Gly Asp Gly Ser Pro Cys Lys Thr
Pro Phe Glu Ile Met Asp Leu 35 40
45 Glu Lys Arg His Val Leu Gly Arg Leu Thr Thr Val Asn Pro
Ile Val 50 55 60
Thr Glu Lys Asp Ser Pro Val Asn Ile Glu Ala Glu Pro Pro Phe Gly65
70 75 80 Asp Ser Tyr Ile Ile
Ile Gly Val Glu Pro Gly Gln Leu Lys Leu Asp 85
90 95 Trp Phe Lys Lys 100
98100PRTArtificial SequenceDengue virus 98Lys Gly Met Ser Tyr Ala Met Cys
Leu Asn Thr Phe Val Leu Lys Lys1 5 10
15 Glu Val Ser Glu Thr Gln His Gly Thr Ile Leu Ile Lys
Val Glu Tyr 20 25 30
Lys Gly Glu Asp Ala Pro Cys Lys Ile Pro Phe Ser Thr Glu Asp Gly
35 40 45 Gln Gly Lys Ala
His Asn Gly Arg Leu Ile Thr Ala Asn Pro Val Val 50 55
60 Thr Lys Lys Glu Glu Pro Val Asn Ile
Glu Ala Glu Pro Pro Phe Gly65 70 75
80 Glu Ser Asn Ile Val Ile Gly Ile Gly Asp Lys Ala Leu Lys
Ile Asn 85 90 95
Trp Tyr Arg Lys 100 9999PRTArtificial SequenceDengue virus
99Lys Gly Met Ser Tyr Thr Met Cys Ser Gly Lys Phe Ser Ile Asp Lys1
5 10 15 Glu Met Ala Glu
Thr Gln His Gly Thr Thr Val Val Lys Val Lys Tyr 20
25 30 Glu Gly Ala Gly Ala Pro Cys Lys Val
Pro Ile Glu Ile Arg Asp Val 35 40
45 Asn Lys Glu Lys Val Val Gly Arg Ile Ile Ser Pro Thr Pro
Phe Ala 50 55 60
Glu Asn Thr Asn Ser Val Thr Asn Ile Glu Leu Glu Arg Pro Leu Asp65
70 75 80 Ser Tyr Ile Val Ile
Gly Val Gly Asp Ser Ala Leu Thr Leu His Trp 85
90 95 Phe Arg Lys10020PRTArtificial
SequenceFlavivirus envelope protein 100Cys Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 10120PRTArtificial
SequenceFlavivirus envelope protein 101Ser Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 10220PRTArtificial
SequenceFlavivirus envelope protein 102Cys Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Ser Ser Lys 20 10320PRTArtificial
SequenceFlavivirus envelope protein 103Ser Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Ser Ser Lys 20 10420PRTArtificial
SequenceFlavivirus envelope protein 104Cys Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 10520PRTArtificial
SequenceFlavivirus envelope protein 105Ala Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 10620PRTArtificial
SequenceFlavivirus envelope protein 106Cys Ala Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 10720PRTArtificial
SequenceFlavivirus envelope protein 107Cys Arg Ala Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 10820PRTArtificial
SequenceFlavivirus envelope protein 108Cys Arg Val Ala Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 10920PRTArtificial
SequenceFlavivirus envelope protein 109Cys Arg Val Lys Ala Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 11020PRTArtificial
SequenceFlavivirus envelope protein 110Cys Arg Val Lys Met Ala Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 11120PRTArtificial
SequenceFlavivirus envelope protein 111Cys Arg Val Lys Met Glu Ala Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 11220PRTArtificial
SequenceFlavivirus envelope protein 112Cys Arg Val Lys Met Glu Lys Ala
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 11320PRTArtificial
SequenceFlavivirus envelope protein 113Cys Arg Val Lys Met Glu Lys Leu
Ala Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 11420PRTArtificial
SequenceFlavivirus envelope protein 114Cys Arg Val Lys Met Glu Lys Leu
Gln Ala Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 11520PRTArtificial
SequenceFlavivirus envelope protein 115Cys Arg Val Lys Met Glu Lys Leu
Gln Leu Ala Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 11620PRTArtificial
SequenceFlavivirus envelope protein 116Cys Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Ala Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 11720PRTArtificial
SequenceFlavivirus envelope protein 117Cys Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Ala Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 11820PRTArtificial
SequenceFlavivirus envelope protein 118Cys Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Ala Tyr Gly1 5 10
15 Val Cys Ser Lys 20 11920PRTArtificial
SequenceFlavivirus envelope protein 119Cys Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Ala Gly1 5 10
15 Val Cys Ser Lys 20 12020PRTArtificial
SequenceFlavivirus envelope protein 120Cys Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Ala1 5 10
15 Val Cys Ser Lys 20 12120PRTArtificial
SequenceFlavivirus envelope protein 121Cys Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Ala Cys Ser Lys 20 12220PRTArtificial
SequenceFlavivirus envelope protein 122Cys Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Ala Ser Lys 20 12320PRTArtificial
SequenceFlavivirus envelope protein 123Cys Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ala Lys 20 12420PRTArtificial
SequenceFlavivirus envelope protein 124Cys Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Ala 20 12520PRTArtificial
SequenceFlavivirus envelope protein 125Cys Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 12620PRTArtificial
SequenceFlavivirus envelope protein 126Ser Asn Thr Val Lys Leu Thr Ser
Gly His Leu Lys Cys Arg Val Lys1 5 10
15 Met Glu Lys Leu 20 12720PRTArtificial
SequenceFlavivirus envelope protein 127Asn Thr Val Lys Leu Thr Ser Gly
His Leu Lys Cys Arg Val Lys Met1 5 10
15 Glu Lys Leu Gln 20 12820PRTArtificial
SequenceFlavivirus envelope protein 128Thr Val Lys Leu Thr Ser Gly His
Leu Lys Cys Arg Val Lys Met Glu1 5 10
15 Lys Leu Gln Leu 20 12920PRTArtificial
SequenceFlavivirus envelope protein 129Val Lys Leu Thr Ser Gly His Leu
Lys Cys Arg Val Lys Met Glu Lys1 5 10
15 Leu Gln Leu Lys 20 13020PRTArtificial
SequenceFlavivirus envelope protein 130Lys Leu Thr Ser Gly His Leu Lys
Cys Arg Val Lys Met Glu Lys Leu1 5 10
15 Gln Leu Lys Gly 20 13120PRTArtificial
SequenceFlavivirus envelope protein 131Leu Thr Ser Gly His Leu Lys Cys
Arg Val Lys Met Glu Lys Leu Gln1 5 10
15 Leu Lys Gly Thr 20 13220PRTArtificial
SequenceFlavivirus envelope protein 132Thr Ser Gly His Leu Lys Cys Arg
Val Lys Met Glu Lys Leu Gln Leu1 5 10
15 Lys Gly Thr Thr 20 13320PRTArtificial
SequenceFlavivirus envelope protein 133Ser Gly His Leu Lys Cys Arg Val
Lys Met Glu Lys Leu Gln Leu Lys1 5 10
15 Gly Thr Thr Tyr 20 13420PRTArtificial
SequenceFlavivirus envelope protein 134Gly His Leu Lys Cys Arg Val Lys
Met Glu Lys Leu Gln Leu Lys Gly1 5 10
15 Thr Thr Tyr Gly 20 13520PRTArtificial
SequenceFlavivirus envelope protein 135His Leu Lys Cys Arg Val Lys Met
Glu Lys Leu Gln Leu Lys Gly Thr1 5 10
15 Thr Tyr Gly Val 20 13620PRTArtificial
SequenceFlavivirus envelope protein 136Leu Lys Cys Arg Val Lys Met Glu
Lys Leu Gln Leu Lys Gly Thr Thr1 5 10
15 Tyr Gly Val Cys 20 13720PRTArtificial
SequenceFlavivirus envelope protein 137Lys Cys Arg Val Lys Met Glu Lys
Leu Gln Leu Lys Gly Thr Thr Tyr1 5 10
15 Gly Val Cys Ser 20 13820PRTArtificial
SequenceFlavivirus envelope protein 138Cys Arg Val Lys Met Glu Lys Leu
Gln Leu Lys Gly Thr Thr Tyr Gly1 5 10
15 Val Cys Ser Lys 20 13920PRTArtificial
SequenceFlavivirus envelope protein 139Arg Val Lys Met Glu Lys Leu Gln
Leu Lys Gly Thr Thr Tyr Gly Val1 5 10
15 Cys Ser Lys Ala 20 14020PRTArtificial
SequenceFlavivirus envelope protein 140Val Lys Met Glu Lys Leu Gln Leu
Lys Gly Thr Thr Tyr Gly Val Cys1 5 10
15 Ser Lys Ala Phe 20 14120PRTArtificial
SequenceFlavivirus envelope protein 141Lys Met Glu Lys Leu Gln Leu Lys
Gly Thr Thr Tyr Gly Val Cys Ser1 5 10
15 Lys Ala Phe Lys 20 14220PRTArtificial
SequenceFlavivirus envelope protein 142Met Glu Lys Leu Gln Leu Lys Gly
Thr Thr Tyr Gly Val Cys Ser Lys1 5 10
15 Ala Phe Lys Phe 20 14320PRTArtificial
SequenceFlavivirus envelope protein 143Glu Lys Leu Gln Leu Lys Gly Thr
Thr Tyr Gly Val Cys Ser Lys Ala1 5 10
15 Phe Lys Phe Leu 20 14420PRTArtificial
SequenceFlavivirus envelope protein 144Lys Leu Gln Leu Lys Gly Thr Thr
Tyr Gly Val Cys Ser Lys Ala Phe1 5 10
15 Lys Phe Leu Gly 20 14520PRTArtificial
SequenceFlavivirus envelope protein 145Leu Gln Leu Lys Gly Thr Thr Tyr
Gly Val Cys Ser Lys Ala Phe Lys1 5 10
15 Phe Leu Gly Thr 20 14620PRTArtificial
SequenceFlavivirus envelope protein 146Gln Leu Lys Gly Thr Thr Tyr Gly
Val Cys Ser Lys Ala Phe Lys Phe1 5 10
15 Leu Gly Thr Pro 20 14720PRTArtificial
SequenceFlavivirus envelope protein 147Leu Lys Gly Thr Thr Tyr Gly Val
Cys Ser Lys Ala Phe Lys Phe Leu1 5 10
15 Gly Thr Pro Ala 20 14820PRTArtificial
SequenceFlavivirus envelope protein 148Lys Gly Thr Thr Tyr Gly Val Cys
Ser Lys Ala Phe Lys Phe Leu Gly1 5 10
15 Thr Pro Ala Asp 20 14920PRTArtificial
SequenceFlavivirus envelope protein 149Gly Thr Thr Tyr Gly Val Cys Ser
Lys Ala Phe Lys Phe Leu Gly Thr1 5 10
15 Pro Ala Asp Thr 20 15020PRTArtificial
SequenceFlavivirus envelope protein 150Thr Thr Tyr Gly Val Cys Ser Lys
Ala Phe Lys Phe Leu Gly Thr Pro1 5 10
15 Ala Asp Thr Gly 20 15120PRTArtificial
SequenceFlavivirus envelope protein 151Thr Tyr Gly Val Cys Ser Lys Ala
Phe Lys Phe Leu Gly Thr Pro Ala1 5 10
15 Asp Thr Gly His 20 1522760DNAArtificial
SequenceSTF2.OVA 152atggcacaag taatcaacac taacagtctg tcgctgctga
cccagaataa cctgaacaaa 60tcccagtccg cactgggcac cgctatcgag cgtctgtctt
ctggtctgcg tatcaacagc 120gcgaaagacg atgcggcagg tcaggcgatt gctaaccgtt
tcaccgcgaa catcaaaggt 180ctgactcagg cttcccgtaa cgctaacgac ggtatctcca
ttgcgcagac cactgaaggc 240gcgctgaacg aaatcaacaa caacctgcag cgtgtgcgtg
aactggcggt tcagtctgct 300aacagcacca actcccagtc tgacctcgac tccatccagg
ctgaaatcac ccagcgcctg 360aacgaaatcg accgtgtatc cggccagact cagttcaacg
gcgtgaaagt cctggcgcag 420gacaacaccc tgaccatcca ggttggcgcc aacgacggtg
aaactatcga tatcgatctg 480aagcagatca actctcagac cctgggtctg gactcactga
acgtgcagaa agcgtatgat 540gtgaaagata cagcagtaac aacgaaagct tatgccaata
atggtactac actggatgta 600tcgggtcttg atgatgcagc tattaaagcg gctacgggtg
gtacgaatgg tacggcttct 660gtaaccggtg gtgcggttaa atttgacgca gataataaca
agtactttgt tactattggt 720ggctttactg gtgctgatgc cgccaaaaat ggcgattatg
aagttaacgt tgctactgac 780ggtacagtaa cccttgcggc tggcgcaact aaaaccacaa
tgcctgctgg tgcgacaact 840aaaacagaag tacaggagtt aaaagataca ccggcagttg
tttcagcaga tgctaaaaat 900gccttaattg ctggcggcgt tgacgctacc gatgctaatg
gcgctgagtt ggtcaaaatg 960tcttataccg ataaaaatgg taagacaatt gaaggcggtt
atgcgcttaa agctggcgat 1020aagtattacg ccgcagatta cgatgaagcg acaggagcaa
ttaaagctaa aaccacaagt 1080tatactgctg ctgacggcac taccaaaaca gcggctaacc
aactgggtgg cgtagacggt 1140aaaaccgaag tcgttactat cgacggtaaa acctacaatg
ccagcaaagc cgctggtcat 1200gatttcaaag cacaaccaga gctggcggaa gcagccgcta
aaaccaccga aaacccgctg 1260cagaaaattg atgccgcgct ggcgcaggtg gatgcgctgc
gctctgatct gggtgcggta 1320caaaaccgtt tcaactctgc tatcaccaac ctgggcaata
ccgtaaacaa tctgtctgaa 1380gcgcgtagcc gtatcgaaga ttccgactac gcgaccgaag
tttccaacat gtctcgcgcg 1440cagattttgc agcaggccgg tacttccgtt ctggcgcagg
ctaaccaggt cccgcagaac 1500gtgctgtctc tgttacgtct cgagggctcc atcggcgcag
caagcatgga attttgtttt 1560gatgtattca aggagctcaa agtccaccat gccaatgaga
acatcttcta ctgccccatt 1620gccatcatgt cagctctagc catggtatac ctgggtgcaa
aagacagcac caggacacaa 1680ataaataagg ttgttcgctt tgataaactt ccaggattcg
gagacagtat tgaagctcag 1740tgtggcacat ctgtaaacgt tcactcttca cttagagaca
tcctcaacca aatcaccaaa 1800ccaaatgatg tttattcgtt cagccttgcc agtagacttt
atgctgaaga gagataccca 1860atcctgccag aatacttgca gtgtgtgaag gaactgtata
gaggaggctt ggaacctatc 1920aactttcaaa cagctgcaga tcaagccaga gagctcatca
attcctgggt agaaagtcag 1980acaaatggaa ttatcagaaa tgtccttcag ccaagctccg
tggattctca aactgcaatg 2040gttctggtta atgccattgt cttcaaagga ctgtgggaga
aagcatttaa ggatgaagac 2100acacaagcaa tgcctttcag agtgactgag caagaaagca
aacctgtgca gatgatgtac 2160cagattggtt tatttagagt ggcatcaatg gcttctgaga
aaatgaagat cctggagctt 2220ccatttgcca gtgggacaat gagcatgttg gtgctgttgc
ctgatgaagt ctcaggcctt 2280gagcagcttg agagtataat caactttgaa aaactgactg
aatggaccag ttctaatgtt 2340atggaagaga ggaagatcaa agtgtactta cctcgcatga
agatggagga aaaatacaac 2400ctcacatctg tcttaatggc tatgggcatt actgacgtgt
ttagctcttc agccaatctg 2460tctggcatct cctcagcaga gagcctgaag atatctcaag
ctgtccatgc agcacatgca 2520gaaatcaatg aagcaggcag agaggtggta gggtcagcag
aggctggagt ggatgctgca 2580agcgtctctg aagaatttag ggctgaccat ccattcctct
tctgtatcaa gcacatcgca 2640accaacgccg ttctcttctt tggcagatgt gtttcccctt
cgaagcttga aggtaagcct 2700atccctaacc ctctcctcgg tctcgattct acgcgtaccg
gtcatcatca ccatcaccat 2760153920PRTArtificial SequenceSTF2.OVA 153Met
Ala Gln Val Ile Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn1
5 10 15 Asn Leu Asn Lys Ser Gln
Ser Ala Leu Gly Thr Ala Ile Glu Arg Leu 20 25
30 Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp
Asp Ala Ala Gly Gln 35 40 45
Ala Ile Ala Asn Arg Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala
50 55 60 Ser Arg Asn
Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly65 70
75 80 Ala Leu Asn Glu Ile Asn Asn Asn
Leu Gln Arg Val Arg Glu Leu Ala 85 90
95 Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu
Asp Ser Ile 100 105 110
Gln Ala Glu Ile Thr Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly
115 120 125 Gln Thr Gln Phe
Asn Gly Val Lys Val Leu Ala Gln Asp Asn Thr Leu 130
135 140 Thr Ile Gln Val Gly Ala Asn Asp
Gly Glu Thr Ile Asp Ile Asp Leu145 150
155 160 Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Ser
Leu Asn Val Gln 165 170
175 Lys Ala Tyr Asp Val Lys Asp Thr Ala Val Thr Thr Lys Ala Tyr Ala
180 185 190 Asn Asn Gly
Thr Thr Leu Asp Val Ser Gly Leu Asp Asp Ala Ala Ile 195
200 205 Lys Ala Ala Thr Gly Gly Thr Asn
Gly Thr Ala Ser Val Thr Gly Gly 210 215
220 Ala Val Lys Phe Asp Ala Asp Asn Asn Lys Tyr Phe Val
Thr Ile Gly225 230 235
240 Gly Phe Thr Gly Ala Asp Ala Ala Lys Asn Gly Asp Tyr Glu Val Asn
245 250 255 Val Ala Thr Asp
Gly Thr Val Thr Leu Ala Ala Gly Ala Thr Lys Thr 260
265 270 Thr Met Pro Ala Gly Ala Thr Thr Lys
Thr Glu Val Gln Glu Leu Lys 275 280
285 Asp Thr Pro Ala Val Val Ser Ala Asp Ala Lys Asn Ala Leu
Ile Ala 290 295 300
Gly Gly Val Asp Ala Thr Asp Ala Asn Gly Ala Glu Leu Val Lys Met305
310 315 320 Ser Tyr Thr Asp Lys
Asn Gly Lys Thr Ile Glu Gly Gly Tyr Ala Leu 325
330 335 Lys Ala Gly Asp Lys Tyr Tyr Ala Ala Asp
Tyr Asp Glu Ala Thr Gly 340 345
350 Ala Ile Lys Ala Lys Thr Thr Ser Tyr Thr Ala Ala Asp Gly Thr
Thr 355 360 365 Lys
Thr Ala Ala Asn Gln Leu Gly Gly Val Asp Gly Lys Thr Glu Val 370
375 380 Val Thr Ile Asp Gly Lys
Thr Tyr Asn Ala Ser Lys Ala Ala Gly His385 390
395 400 Asp Phe Lys Ala Gln Pro Glu Leu Ala Glu Ala
Ala Ala Lys Thr Thr 405 410
415 Glu Asn Pro Leu Gln Lys Ile Asp Ala Ala Leu Ala Gln Val Asp Ala
420 425 430 Leu Arg Ser
Asp Leu Gly Ala Val Gln Asn Arg Phe Asn Ser Ala Ile 435
440 445 Thr Asn Leu Gly Asn Thr Val Asn
Asn Leu Ser Glu Ala Arg Ser Arg 450 455
460 Ile Glu Asp Ser Asp Tyr Ala Thr Glu Val Ser Asn Met
Ser Arg Ala465 470 475
480 Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln
485 490 495 Val Pro Gln Asn
Val Leu Ser Leu Leu Arg Leu Glu Gly Ser Ile Gly 500
505 510 Ala Ala Ser Met Glu Phe Cys Phe Asp
Val Phe Lys Glu Leu Lys Val 515 520
525 His His Ala Asn Glu Asn Ile Phe Tyr Cys Pro Ile Ala Ile
Met Ser 530 535 540
Ala Leu Ala Met Val Tyr Leu Gly Ala Lys Asp Ser Thr Arg Thr Gln545
550 555 560 Ile Asn Lys Val Val
Arg Phe Asp Lys Leu Pro Gly Phe Gly Asp Ser 565
570 575 Ile Glu Ala Gln Cys Gly Thr Ser Val Asn
Val His Ser Ser Leu Arg 580 585
590 Asp Ile Leu Asn Gln Ile Thr Lys Pro Asn Asp Val Tyr Ser Phe
Ser 595 600 605 Leu
Ala Ser Arg Leu Tyr Ala Glu Glu Arg Tyr Pro Ile Leu Pro Glu 610
615 620 Tyr Leu Gln Cys Val Lys
Glu Leu Tyr Arg Gly Gly Leu Glu Pro Ile625 630
635 640 Asn Phe Gln Thr Ala Ala Asp Gln Ala Arg Glu
Leu Ile Asn Ser Trp 645 650
655 Val Glu Ser Gln Thr Asn Gly Ile Ile Arg Asn Val Leu Gln Pro Ser
660 665 670 Ser Val Asp
Ser Gln Thr Ala Met Val Leu Val Asn Ala Ile Val Phe 675
680 685 Lys Gly Leu Trp Glu Lys Ala Phe
Lys Asp Glu Asp Thr Gln Ala Met 690 695
700 Pro Phe Arg Val Thr Glu Gln Glu Ser Lys Pro Val Gln
Met Met Tyr705 710 715
720 Gln Ile Gly Leu Phe Arg Val Ala Ser Met Ala Ser Glu Lys Met Lys
725 730 735 Ile Leu Glu Leu
Pro Phe Ala Ser Gly Thr Met Ser Met Leu Val Leu 740
745 750 Leu Pro Asp Glu Val Ser Gly Leu Glu
Gln Leu Glu Ser Ile Ile Asn 755 760
765 Phe Glu Lys Leu Thr Glu Trp Thr Ser Ser Asn Val Met Glu
Glu Arg 770 775 780
Lys Ile Lys Val Tyr Leu Pro Arg Met Lys Met Glu Glu Lys Tyr Asn785
790 795 800 Leu Thr Ser Val Leu
Met Ala Met Gly Ile Thr Asp Val Phe Ser Ser 805
810 815 Ser Ala Asn Leu Ser Gly Ile Ser Ser Ala
Glu Ser Leu Lys Ile Ser 820 825
830 Gln Ala Val His Ala Ala His Ala Glu Ile Asn Glu Ala Gly Arg
Glu 835 840 845 Val
Val Gly Ser Ala Glu Ala Gly Val Asp Ala Ala Ser Val Ser Glu 850
855 860 Glu Phe Arg Ala Asp His
Pro Phe Leu Phe Cys Ile Lys His Ile Ala865 870
875 880 Thr Asn Ala Val Leu Phe Phe Gly Arg Cys Val
Ser Pro Ser Lys Leu 885 890
895 Glu Gly Lys Pro Ile Pro Asn Pro Leu Leu Gly Leu Asp Ser Thr Arg
900 905 910 Thr Gly His
His His His His His 915 920 154385PRTArtificial
SequenceOVA 154Gly Ser Ile Gly Ala Ala Ser Met Glu Phe Cys Phe Asp Val
Phe Lys1 5 10 15
Glu Leu Lys Val His His Ala Asn Glu Asn Ile Phe Tyr Cys Pro Ile
20 25 30 Ala Ile Met Ser Ala
Leu Ala Met Val Tyr Leu Gly Ala Lys Asp Ser 35 40
45 Thr Arg Thr Gln Ile Asn Lys Val Val Arg
Phe Asp Lys Leu Pro Gly 50 55 60
Phe Gly Asp Ser Ile Glu Ala Gln Cys Gly Thr Ser Val Asn Val
His65 70 75 80 Ser
Ser Leu Arg Asp Ile Leu Asn Gln Ile Thr Lys Pro Asn Asp Val
85 90 95 Tyr Ser Phe Ser Leu Ala
Ser Arg Leu Tyr Ala Glu Glu Arg Tyr Pro 100
105 110 Ile Leu Pro Glu Tyr Leu Gln Cys Val Lys
Glu Leu Tyr Arg Gly Gly 115 120
125 Leu Glu Pro Ile Asn Phe Gln Thr Ala Ala Asp Gln Ala Arg
Glu Leu 130 135 140
Ile Asn Ser Trp Val Glu Ser Gln Thr Asn Gly Ile Ile Arg Asn Val145
150 155 160 Leu Gln Pro Ser Ser
Val Asp Ser Gln Thr Ala Met Val Leu Val Asn 165
170 175 Ala Ile Val Phe Lys Gly Leu Trp Glu Lys
Ala Phe Lys Asp Glu Asp 180 185
190 Thr Gln Ala Met Pro Phe Arg Val Thr Glu Gln Glu Ser Lys Pro
Val 195 200 205 Gln
Met Met Tyr Gln Ile Gly Leu Phe Arg Val Ala Ser Met Ala Ser 210
215 220 Glu Lys Met Lys Ile Leu
Glu Leu Pro Phe Ala Ser Gly Thr Met Ser225 230
235 240 Met Leu Val Leu Leu Pro Asp Glu Val Ser Gly
Leu Glu Gln Leu Glu 245 250
255 Ser Ile Ile Asn Phe Glu Lys Leu Thr Glu Trp Thr Ser Ser Asn Val
260 265 270 Met Glu Glu
Arg Lys Ile Lys Val Tyr Leu Pro Arg Met Lys Met Glu 275
280 285 Glu Lys Tyr Asn Leu Thr Ser Val
Leu Met Ala Met Gly Ile Thr Asp 290 295
300 Val Phe Ser Ser Ser Ala Asn Leu Ser Gly Ile Ser Ser
Ala Glu Ser305 310 315
320 Leu Lys Ile Ser Gln Ala Val His Ala Ala His Ala Glu Ile Asn Glu
325 330 335 Ala Gly Arg Glu
Val Val Gly Ser Ala Glu Ala Gly Val Asp Ala Ala 340
345 350 Ser Val Ser Glu Glu Phe Arg Ala Asp
His Pro Phe Leu Phe Cys Ile 355 360
365 Lys His Ile Ala Thr Asn Ala Val Leu Phe Phe Gly Arg Cys
Val Ser 370 375 380
Pro385 1551156DNAArtificial SequenceOVA 155gggctccatc ggcgcagcaa
gcatggaatt ttgttttgat gtattcaagg agctcaaagt 60ccaccatgcc aatgagaaca
tcttctactg ccccattgcc atcatgtcag ctctagccat 120ggtatacctg ggtgcaaaag
acagcaccag gacacaaata aataaggttg ttcgctttga 180taaacttcca ggattcggag
acagtattga agctcagtgt ggcacatctg taaacgttca 240ctcttcactt agagacatcc
tcaaccaaat caccaaacca aatgatgttt attcgttcag 300ccttgccagt agactttatg
ctgaagagag atacccaatc ctgccagaat acttgcagtg 360tgtgaaggaa ctgtatagag
gaggcttgga acctatcaac tttcaaacag ctgcagatca 420agccagagag ctcatcaatt
cctgggtaga aagtcagaca aatggaatta tcagaaatgt 480ccttcagcca agctccgtgg
attctcaaac tgcaatggtt ctggttaatg ccattgtctt 540caaaggactg tgggagaaag
catttaagga tgaagacaca caagcaatgc ctttcagagt 600gactgagcaa gaaagcaaac
ctgtgcagat gatgtaccag attggtttat ttagagtggc 660atcaatggct tctgagaaaa
tgaagatcct ggagcttcca tttgccagtg ggacaatgag 720catgttggtg ctgttgcctg
atgaagtctc aggccttgag cagcttgaga gtataatcaa 780ctttgaaaaa ctgactgaat
ggaccagttc taatgttatg gaagagagga agatcaaagt 840gtacttacct cgcatgaaga
tggaggaaaa atacaacctc acatctgtct taatggctat 900gggcattact gacgtgttta
gctcttcagc caatctgtct ggcatctcct cagcagagag 960cctgaagata tctcaagctg
tccatgcagc acatgcagaa atcaatgaag caggcagaga 1020ggtggtaggg tcagcagagg
ctggagtgga tgctgcaagc gtctctgaag aatttagggc 1080tgaccatcca ttcctcttct
gtatcaagca catcgcaacc aacgccgttc tcttctttgg 1140cagatgtgtt tcccct
115615618DNAArtificial
SequencePrimer 156catctcagtg caactaaa
1815718DNAArtificial SequencePrimer 157tagaaggcac agtcgagg
181582736DNAArtificial
SequenceSTF2.E 158atggcacaag taatcaacac taacagtctg tcgctgctga cccagaataa
cctgaacaaa 60tcccagtccg cactgggcac cgctatcgag cgtctgtctt ctggtctgcg
tatcaacagc 120gcgaaagacg atgcggcagg tcaggcgatt gctaaccgtt tcaccgcgaa
catcaaaggt 180ctgactcagg cttcccgtaa cgctaacgac ggtatctcca ttgcgcagac
cactgaaggc 240gcgctgaacg aaatcaacaa caacctgcag cgtgtgcgtg aactggcggt
tcagtctgct 300aacagcacca actcccagtc tgacctcgac tccatccagg ctgaaatcac
ccagcgcctg 360aacgaaatcg accgtgtatc cggccagact cagttcaacg gcgtgaaagt
cctggcgcag 420gacaacaccc tgaccatcca ggttggcgcc aacgacggtg aaactatcga
tatcgatctg 480aagcagatca actctcagac cctgggtctg gactcactga acgtgcagaa
agcgtatgat 540gtgaaagata cagcagtaac aacgaaagct tatgccaata atggtactac
actggatgta 600tcgggtcttg atgatgcagc tattaaagcg gctacgggtg gtacgaatgg
tacggcttct 660gtaaccggtg gtgcggttaa atttgacgca gataataaca agtactttgt
tactattggt 720ggctttactg gtgctgatgc cgccaaaaat ggcgattatg aagttaacgt
tgctactgac 780ggtacagtaa cccttgcggc tggcgcaact aaaaccacaa tgcctgctgg
tgcgacaact 840aaaacagaag tacaggagtt aaaagataca ccggcagttg tttcagcaga
tgctaaaaat 900gccttaattg ctggcggcgt tgacgctacc gatgctaatg gcgctgagtt
ggtcaaaatg 960tcttataccg ataaaaatgg taagacaatt gaaggcggtt atgcgcttaa
agctggcgat 1020aagtattacg ccgcagatta cgatgaagcg acaggagcaa ttaaagctaa
aaccacaagt 1080tatactgctg ctgacggcac taccaaaaca gcggctaacc aactgggtgg
cgtagacggt 1140aaaaccgaag tcgttactat cgacggtaaa acctacaatg ccagcaaagc
cgctggtcat 1200gatttcaaag cacaaccaga gctggcggaa gcagccgcta aaaccaccga
aaacccgctg 1260cagaaaattg atgccgcgct ggcgcaggtg gatgcgctgc gctctgatct
gggtgcggta 1320caaaaccgtt tcaactctgc tatcaccaac ctgggcaata ccgtaaacaa
tctgtctgaa 1380gcgcgtagcc gtatcgaaga ttccgactac gcgaccgaag tttccaacat
gtctcgcgcg 1440cagattttgc agcaggccgg tacttccgtt ctggcgcagg ctaaccaggt
cccgcagaac 1500gtgctgtctc tgttacgttt caactgcctt ggaatgagca acagagactt
cttggaagga 1560gtgtctggag caacatgggt ggatttggtt ctcgaaggcg acagctgcgt
gactatcatg 1620tctaaggaca agcctaccat cgatgtgaag atgatgaata tggaggcggc
caacctggca 1680gaggtccgca gttattgcta tttggctacc gtcagcgatc tctccaccaa
agctgcgtgc 1740ccgaccatgg gagaagctca caatgacaaa cgtgctgacc cagcttttgt
gtgcagacaa 1800ggagtggtgg acaggggctg gggcaacggc tgcggactat ttggcaaagg
aagcattgac 1860acatgcgcca aatttgcctg ctctaccaag gcaataggaa gaaccatctt
gaaagagaat 1920atcaagtacg aagtggccat ttttgtccat ggaccaacta ctgtggagtc
gcacggaaac 1980tactccacac aggttggagc cactcaggca gggagattca gcatcactcc
tgcagcgcct 2040tcatacacac taaagcttgg agaatatgga gaggtgacag tggactgtga
accacggtca 2100gggattgaca ccaatgcata ctacgtgatg actgttggaa caaagacgtt
cttggtccat 2160cgtgagtggt tcatggacct caacctccct tggagcagtg ctggaagtac
tgtgtggagg 2220aacagagaga cgttaatgga gtttgaggaa ccacacgcca cgaagcagtc
tgtgatagca 2280ttgggctcac aagagggagc tctgcatcaa gctttggctg gagccattcc
tgtggaattt 2340tcaagcaaca ctgtcaagtt gacgtcgggt catttgaagt gtagagtgaa
gatggaaaaa 2400ttgcagttga agggaacaac ctatggcgtc tgttcaaagg ctttcaagtt
tcttgggact 2460cccgcagaca caggtcacgg cactgtggtg ttggaattgc agtacactgg
cacggatgga 2520ccttgcaaag ttcctatctc gtcagtggct tcattgaacg acctaacgcc
agtgggcaga 2580ttggtcactg tcaacccttt tgtttcagtg gccacggcca acgctaaggt
cctgattgaa 2640ttggaaccac cctttggaga ctcatacata gtggtgggca gaggagaaca
acagatcaat 2700caccattggc acaagtctgg aagcagcatt ggcaaa
2736159912PRTArtificial SequenceSTF2.E 159Met Ala Gln Val Ile
Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn1 5
10 15 Asn Leu Asn Lys Ser Gln Ser Ala Leu Gly
Thr Ala Ile Glu Arg Leu 20 25
30 Ser Ser Gly Leu Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly
Gln 35 40 45 Ala
Ile Ala Asn Arg Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala 50
55 60 Ser Arg Asn Ala Asn Asp
Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly65 70
75 80 Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg
Val Arg Glu Leu Ala 85 90
95 Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile
100 105 110 Gln Ala Glu
Ile Thr Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly 115
120 125 Gln Thr Gln Phe Asn Gly Val Lys
Val Leu Ala Gln Asp Asn Thr Leu 130 135
140 Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Asp
Ile Asp Leu145 150 155
160 Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Ser Leu Asn Val Gln
165 170 175 Lys Ala Tyr Asp
Val Lys Asp Thr Ala Val Thr Thr Lys Ala Tyr Ala 180
185 190 Asn Asn Gly Thr Thr Leu Asp Val Ser
Gly Leu Asp Asp Ala Ala Ile 195 200
205 Lys Ala Ala Thr Gly Gly Thr Asn Gly Thr Ala Ser Val Thr
Gly Gly 210 215 220
Ala Val Lys Phe Asp Ala Asp Asn Asn Lys Tyr Phe Val Thr Ile Gly225
230 235 240 Gly Phe Thr Gly Ala
Asp Ala Ala Lys Asn Gly Asp Tyr Glu Val Asn 245
250 255 Val Ala Thr Asp Gly Thr Val Thr Leu Ala
Ala Gly Ala Thr Lys Thr 260 265
270 Thr Met Pro Ala Gly Ala Thr Thr Lys Thr Glu Val Gln Glu Leu
Lys 275 280 285 Asp
Thr Pro Ala Val Val Ser Ala Asp Ala Lys Asn Ala Leu Ile Ala 290
295 300 Gly Gly Val Asp Ala Thr
Asp Ala Asn Gly Ala Glu Leu Val Lys Met305 310
315 320 Ser Tyr Thr Asp Lys Asn Gly Lys Thr Ile Glu
Gly Gly Tyr Ala Leu 325 330
335 Lys Ala Gly Asp Lys Tyr Tyr Ala Ala Asp Tyr Asp Glu Ala Thr Gly
340 345 350 Ala Ile Lys
Ala Lys Thr Thr Ser Tyr Thr Ala Ala Asp Gly Thr Thr 355
360 365 Lys Thr Ala Ala Asn Gln Leu Gly
Gly Val Asp Gly Lys Thr Glu Val 370 375
380 Val Thr Ile Asp Gly Lys Thr Tyr Asn Ala Ser Lys Ala
Ala Gly His385 390 395
400 Asp Phe Lys Ala Gln Pro Glu Leu Ala Glu Ala Ala Ala Lys Thr Thr
405 410 415 Glu Asn Pro Leu
Gln Lys Ile Asp Ala Ala Leu Ala Gln Val Asp Ala 420
425 430 Leu Arg Ser Asp Leu Gly Ala Val Gln
Asn Arg Phe Asn Ser Ala Ile 435 440
445 Thr Asn Leu Gly Asn Thr Val Asn Asn Leu Ser Glu Ala Arg
Ser Arg 450 455 460
Ile Glu Asp Ser Asp Tyr Ala Thr Glu Val Ser Asn Met Ser Arg Ala465
470 475 480 Gln Ile Leu Gln Gln
Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln 485
490 495 Val Pro Gln Asn Val Leu Ser Leu Leu Arg
Phe Asn Cys Leu Gly Met 500 505
510 Ser Asn Arg Asp Phe Leu Glu Gly Val Ser Gly Ala Thr Trp Val
Asp 515 520 525 Leu
Val Leu Glu Gly Asp Ser Cys Val Thr Ile Met Ser Lys Asp Lys 530
535 540 Pro Thr Ile Asp Val Lys
Met Met Asn Met Glu Ala Ala Asn Leu Ala545 550
555 560 Glu Val Arg Ser Tyr Cys Tyr Leu Ala Thr Val
Ser Asp Leu Ser Thr 565 570
575 Lys Ala Ala Cys Pro Thr Met Gly Glu Ala His Asn Asp Lys Arg Ala
580 585 590 Asp Pro Ala
Phe Val Cys Arg Gln Gly Val Val Asp Arg Gly Trp Gly 595
600 605 Asn Gly Cys Gly Leu Phe Gly Lys
Gly Ser Ile Asp Thr Cys Ala Lys 610 615
620 Phe Ala Cys Ser Thr Lys Ala Ile Gly Arg Thr Ile Leu
Lys Glu Asn625 630 635
640 Ile Lys Tyr Glu Val Ala Ile Phe Val His Gly Pro Thr Thr Val Glu
645 650 655 Ser His Gly Asn
Tyr Ser Thr Gln Val Gly Ala Thr Gln Ala Gly Arg 660
665 670 Phe Ser Ile Thr Pro Ala Ala Pro Ser
Tyr Thr Leu Lys Leu Gly Glu 675 680
685 Tyr Gly Glu Val Thr Val Asp Cys Glu Pro Arg Ser Gly Ile
Asp Thr 690 695 700
Asn Ala Tyr Tyr Val Met Thr Val Gly Thr Lys Thr Phe Leu Val His705
710 715 720 Arg Glu Trp Phe Met
Asp Leu Asn Leu Pro Trp Ser Ser Ala Gly Ser 725
730 735 Thr Val Trp Arg Asn Arg Glu Thr Leu Met
Glu Phe Glu Glu Pro His 740 745
750 Ala Thr Lys Gln Ser Val Ile Ala Leu Gly Ser Gln Glu Gly Ala
Leu 755 760 765 His
Gln Ala Leu Ala Gly Ala Ile Pro Val Glu Phe Ser Ser Asn Thr 770
775 780 Val Lys Leu Thr Ser Gly
His Leu Lys Cys Arg Val Lys Met Glu Lys785 790
795 800 Leu Gln Leu Lys Gly Thr Thr Tyr Gly Val Cys
Ser Lys Ala Phe Lys 805 810
815 Phe Leu Gly Thr Pro Ala Asp Thr Gly His Gly Thr Val Val Leu Glu
820 825 830 Leu Gln Tyr
Thr Gly Thr Asp Gly Pro Cys Lys Val Pro Ile Ser Ser 835
840 845 Val Ala Ser Leu Asn Asp Leu Thr
Pro Val Gly Arg Leu Val Thr Val 850 855
860 Asn Pro Phe Val Ser Val Ala Thr Ala Asn Ala Lys Val
Leu Ile Glu865 870 875
880 Leu Glu Pro Pro Phe Gly Asp Ser Tyr Ile Val Val Gly Arg Gly Glu
885 890 895 Gln Gln Ile Asn
His His Trp His Lys Ser Gly Ser Ser Ile Gly Lys 900
905 910 160495PRTArtificial SequenceDengue 1
160Met Arg Cys Val Gly Ile Gly Asn Arg Asp Phe Val Glu Gly Leu Ser1
5 10 15 Gly Ala Thr Trp
Val Asp Val Val Leu Glu His Gly Ser Cys Val Thr 20
25 30 Thr Met Ala Lys Asn Lys Pro Thr Leu
Asp Ile Glu Leu Leu Lys Thr 35 40
45 Glu Val Thr Asn Pro Ala Val Leu Arg Lys Leu Cys Ile Glu
Ala Lys 50 55 60
Ile Ser Asn Thr Thr Thr Asp Ser Arg Cys Pro Thr Gln Gly Glu Ala65
70 75 80 Thr Leu Val Glu Glu
Gln Asp Ala Asn Phe Val Cys Arg Arg Thr Phe 85
90 95 Val Asp Arg Gly Trp Gly Asn Gly Cys Gly
Leu Phe Gly Lys Gly Ser 100 105
110 Leu Ile Thr Cys Ala Lys Phe Lys Cys Val Thr Lys Leu Glu Gly
Lys 115 120 125 Ile
Ala Gln Tyr Glu Asn Leu Lys Tyr Ser Val Ile Val Thr Val His 130
135 140 Thr Gly Asp Gln His Gln
Val Gly Asn Glu Thr Thr Glu His Gly Thr145 150
155 160 Thr Ala Thr Ile Thr Pro Gln Ala Pro Thr Ser
Glu Ile Gln Leu Thr 165 170
175 Asp Tyr Gly Thr Leu Thr Leu Asp Cys Ser Pro Arg Thr Gly Leu Asp
180 185 190 Phe Asn Glu
Met Val Leu Leu Thr Met Lys Lys Lys Ser Trp Leu Val 195
200 205 His Lys Gln Trp Phe Leu Asp Leu
Pro Leu Pro Trp Thr Ser Gly Ala 210 215
220 Leu Thr Ser Gln Glu Thr Trp Asn Arg Gln Asp Leu Leu
Val Thr Phe225 230 235
240 Lys Thr Ala His Ala Lys Lys Gln Glu Val Val Val Leu Gly Ser Gln
245 250 255 Glu Gly Ala Met
His Thr Ala Leu Thr Gly Ala Thr Glu Ile Gln Thr 260
265 270 Ser Gly Thr Thr Thr Ile Phe Ala Gly
His Leu Lys Cys Arg Leu Lys 275 280
285 Met Asp Lys Leu Thr Leu Lys Gly Met Ser Tyr Val Met Cys
Thr Gly 290 295 300
Ser Phe Lys Leu Glu Lys Glu Val Ala Glu Thr Gln His Gly Thr Val305
310 315 320 Leu Val Gln Val Lys
Tyr Glu Gly Thr Asp Ala Pro Cys Lys Ile Pro 325
330 335 Phe Ser Thr Gln Asp Glu Lys Gly Ala Thr
Gln Asn Gly Arg Leu Ile 340 345
350 Thr Ala Asn Pro Ile Val Thr Asp Lys Glu Lys Pro Val Asn Ile
Glu 355 360 365 Ala
Glu Pro Pro Phe Gly Glu Ser Tyr Ile Val Val Gly Ala Gly Glu 370
375 380 Lys Ala Leu Lys Leu Ser
Trp Phe Lys Lys Gly Ser Ser Ile Gly Lys385 390
395 400 Met Phe Glu Ala Thr Ala Arg Gly Ala Arg Arg
Met Ala Ile Leu Gly 405 410
415 Asp Thr Ala Trp Asp Phe Gly Ser Ile Gly Gly Val Phe Thr Ser Met
420 425 430 Gly Lys Leu
Val His Gln Val Phe Gly Thr Ala Tyr Gly Val Leu Phe 435
440 445 Ser Gly Val Ser Trp Thr Met Lys
Ile Gly Ile Gly Ile Leu Leu Thr 450 455
460 Trp Leu Gly Leu Asn Ser Arg Asn Thr Ser Leu Ser Val
Met Cys Ile465 470 475
480 Ala Val Gly Met Val Thr Leu Tyr Leu Gly Val Met Val Gln Ala
485 490 495 1611485DNAArtificial
SequenceDengue 1 161atgcgatgcg tgggaatagg caacagagac ttcgtggaag
gactgtcagg agcaacatgg 60gtggatgtgg tactggagca tggaagttgc gtcaccacca
tggcaaaaaa caaaccaaca 120ctggacattg aactcttgaa gacggaggtc acaaaccctg
cagttctgcg taaattgtgc 180attgaagcta aaatatcaaa caccaccacc gattcgagat
gtccaacaca aggagaagcc 240acactggtgg aagaacaaga cgcgaacttt gtgtgccgac
gaacgttcgt ggacagaggc 300tggggcaatg gctgtgggct attcggaaaa ggtagtctaa
taacgtgtgc caagtttaag 360tgtgtgacaa aactagaagg aaagatagct caatatgaaa
acctaaaata ttcagtgata 420gtcaccgtcc acactggaga tcagcaccag gtgggaaatg
agactacaga acatggaaca 480actgcaacca taacacctca agctcctacg tcggaaatac
agctgaccga ctacggaacc 540cttacattag attgttcacc taggacaggg ctagatttta
acgagatggt gttgctgaca 600atgaaaaaga aatcatggct tgtccacaaa cagtggtttc
tagacttacc actgccttgg 660acctctgggg ctttaacatc ccaagagact tggaacagac
aagatttact ggtcacattt 720aagacagctc atgcaaagaa gcaggaagta gtcgtactag
gatcacaaga aggagcaatg 780cacactgcgc tgactggagc gacagaaatc caaacgtcag
gaacgacaac aattttcgca 840ggacacctaa aatgcagact aaaaatggac aaactaactt
taaaagggat gtcatatgtg 900atgtgcacag gctcattcaa gttagagaaa gaagtggctg
agacccagca tggaactgtt 960ctggtgcagg ttaaatatga aggaacagac gcaccatgca
agattccctt ttcgacccaa 1020gatgagaaag gagcaaccca gaatgggaga ttaataacag
ccaaccccat agtcactgac 1080aaagaaaaac cagtcaatat tgaggcagaa ccaccctttg
gtgagagcta catcgtggta 1140ggagcaggtg aaaaagcttt gaaactaagc tggttcaaga
aaggaagcag catagggaaa 1200atgtttgaag caactgcccg aggagcacga aggatggcca
ttctgggaga caccgcatgg 1260gacttcggtt ctataggagg agtgttcacg tctatgggaa
aactggtaca ccaggttttt 1320ggaactgcat atggagtttt gtttagcgga gtttcttgga
ccatgaaaat aggaataggg 1380attctgctga catggctagg attaaattca aggaacacgt
ccctttcggt gatgtgcatc 1440gcagttggca tggtcacact gtacctagga gtcatggttc
aggca 1485162495PRTArtificial SequenceDengue 2 162Met
Arg Cys Ile Gly Met Ser Asn Arg Asp Phe Val Glu Gly Val Ser1
5 10 15 Gly Gly Ser Trp Val Asp
Ile Val Leu Glu His Gly Ser Cys Val Thr 20 25
30 Thr Met Ala Lys Asn Lys Pro Thr Leu Asp Phe
Glu Leu Ile Lys Thr 35 40 45
Glu Ala Lys Gln Pro Ala Thr Leu Arg Lys Tyr Cys Ile Glu Ala Lys
50 55 60 Leu Thr Asn
Thr Thr Thr Glu Ser Arg Cys Pro Thr Gln Gly Glu Pro65 70
75 80 Ser Leu Asn Glu Glu Gln Asp Lys
Arg Phe Val Cys Lys His Ser Met 85 90
95 Val Asp Arg Gly Trp Gly Asn Gly Cys Gly Leu Phe Gly
Lys Gly Gly 100 105 110
Ile Val Thr Cys Ala Met Phe Arg Cys Lys Lys Asn Met Glu Gly Lys
115 120 125 Val Val Gln Pro
Glu Asn Leu Glu Tyr Thr Ile Val Ile Thr Pro His 130
135 140 Ser Gly Glu Glu His Ala Val Gly
Asn Asp Thr Gly Lys His Gly Lys145 150
155 160 Glu Ile Lys Ile Thr Pro Gln Ser Ser Thr Thr Glu
Ala Glu Leu Thr 165 170
175 Gly Tyr Gly Thr Val Thr Met Glu Cys Ser Pro Arg Thr Gly Leu Asp
180 185 190 Phe Asn Glu
Met Val Leu Leu Gln Met Glu Asn Lys Ala Trp Leu Val 195
200 205 His Arg Gln Trp Phe Leu Asp Leu
Pro Leu Pro Trp Leu Pro Gly Ala 210 215
220 Asp Thr Gln Gly Ser Asn Trp Ile Gln Lys Glu Thr Leu
Val Thr Phe225 230 235
240 Lys Asn Pro His Ala Lys Lys Gln Asp Val Val Val Leu Gly Ser Gln
245 250 255 Glu Gly Ala Met
His Thr Ala Leu Thr Gly Ala Thr Glu Ile Gln Met 260
265 270 Ser Ser Gly Asn Leu Leu Phe Thr Gly
His Leu Lys Cys Arg Leu Arg 275 280
285 Met Asp Lys Leu Gln Leu Lys Gly Met Ser Tyr Ser Met Cys
Thr Gly 290 295 300
Lys Phe Lys Val Val Lys Glu Ile Ala Glu Thr Gln His Gly Thr Ile305
310 315 320 Val Ile Arg Val Gln
Tyr Glu Gly Asp Gly Ser Pro Cys Lys Ile Pro 325
330 335 Phe Glu Ile Met Asp Leu Glu Lys Arg His
Val Leu Gly Arg Leu Ile 340 345
350 Thr Val Asn Pro Ile Val Thr Glu Lys Asp Ser Pro Val Asn Ile
Glu 355 360 365 Ala
Glu Pro Pro Phe Gly Asp Ser Tyr Ile Ile Ile Gly Val Glu Pro 370
375 380 Gly Gln Leu Lys Leu Asn
Trp Phe Lys Lys Gly Ser Ser Ile Gly Gln385 390
395 400 Met Phe Glu Thr Thr Met Arg Gly Ala Lys Arg
Met Ala Ile Leu Gly 405 410
415 Asp Thr Ala Trp Asp Phe Gly Ser Leu Gly Gly Val Phe Thr Ser Ile
420 425 430 Gly Lys Ala
Leu His Gln Val Phe Gly Ala Ile Tyr Gly Ala Ala Phe 435
440 445 Ser Gly Val Ser Trp Thr Met Lys
Ile Leu Ile Gly Val Ile Ile Thr 450 455
460 Trp Ile Gly Met Asn Ser Arg Ser Thr Ser Leu Ser Val
Thr Leu Val465 470 475
480 Leu Val Gly Ile Val Thr Leu Tyr Leu Gly Val Met Val Gln Ala
485 490 495 1631485DNAArtificial
SequenceDengue 2 163atgcgttgca taggaatgtc aaatagagac tttgtggaag
gggtttcagg aggaagctgg 60gttgacatag tcttagaaca tggaagctgt gtgacgacga
tggcaaaaaa caaaccaaca 120ttggattttg aactgataaa aacagaagcc aaacagcctg
ccaccctaag gaagtactgt 180atagaggcaa agctaaccaa cacaacaaca gaatctcgct
gcccaacaca aggggaaccc 240agcctaaatg aagagcagga caaaaggttc gtctgcaaac
actccatggt agacagagga 300tggggaaatg gatgtggact atttggaaag ggaggcattg
tgacctgtgc tatgttcaga 360tgcaaaaaga acatggaagg aaaagttgtg caaccagaaa
acttggaata caccattgtg 420ataacacctc actcagggga agagcatgca gtcggaaatg
acacaggaaa acatggcaag 480gaaatcaaaa taacaccaca gagttccacc acagaagcag
aattgacagg ttatggcact 540gtcacaatgg agtgctctcc aagaacgggc ctcgacttca
atgagatggt gttgctgcag 600atggaaaata aagcttggct ggtgcacagg caatggttcc
tagacctgcc gttaccatgg 660ttgcccggag cggacacaca agggtcaaat tggatacaga
aagagacatt ggtcactttc 720aaaaatcccc atgcgaagaa acaggatgtt gttgttttag
gatcccaaga aggggccatg 780cacacagcac ttacaggggc cacagaaatc caaatgtcat
caggaaactt actcttcaca 840ggacatctca agtgcaggct gagaatggac aagctacagc
tcaaaggaat gtcatactct 900atgtgcacag gaaagtttaa agttgtgaag gaaatagcag
aaacacaaca tggaacaata 960gttatcagag tgcaatatga aggggacggc tctccatgca
agatcccttt tgagataatg 1020gatttggaaa aaagacatgt cttaggtcgc ctgattacag
tcaacccaat tgtgacagaa 1080aaagatagcc cagtcaacat agaagcagaa cctccattcg
gagacagcta catcatcata 1140ggagtagagc cgggacaact gaagctcaac tggtttaaga
aaggaagttc tatcggccaa 1200atgtttgaga caacaatgag gggggcgaag agaatggcca
ttttaggtga cacagcctgg 1260gattttggat ccttgggagg agtgtttaca tctataggaa
aggctctcca ccaagtcttt 1320ggagcaatct atggagctgc cttcagtggg gtttcatgga
ctatgaaaat cctcatagga 1380gtcattatca catggatagg aatgaattca cgcagcacct
cactgtctgt gacactagta 1440ttggtgggaa ttgtgacact gtatttggga gtcatggtgc
aggcc 1485164493PRTArtificial SequenceDengue 3 164Met
Arg Cys Val Gly Val Gly Asn Arg Asp Phe Val Glu Gly Leu Ser1
5 10 15 Gly Ala Thr Trp Val Asp
Val Val Leu Glu His Gly Gly Cys Val Thr 20 25
30 Thr Met Ala Lys Asn Lys Pro Thr Leu Asp Ile
Glu Leu Gln Lys Thr 35 40 45
Glu Ala Thr Gln Leu Ala Thr Leu Arg Lys Leu Cys Ile Glu Gly Lys
50 55 60 Ile Thr Asn
Ile Thr Thr Asp Ser Arg Cys Pro Thr Gln Gly Glu Ala65 70
75 80 Ile Leu Pro Glu Glu Gln Asp Gln
Asn Tyr Val Cys Lys His Thr Tyr 85 90
95 Val Asp Arg Gly Trp Gly Asn Gly Cys Gly Leu Phe Gly
Lys Gly Ser 100 105 110
Leu Val Thr Cys Ala Lys Phe Gln Cys Leu Glu Pro Ile Glu Gly Lys
115 120 125 Val Val Gln His
Glu Asn Leu Lys Tyr Thr Val Ile Ile Thr Val His 130
135 140 Thr Gly Asp Gln His Gln Val Gly
Asn Asp Thr Gln Gly Val Thr Val145 150
155 160 Glu Ile Thr Pro Gln Ala Ser Thr Val Glu Ala Ile
Leu Pro Glu Tyr 165 170
175 Gly Thr Leu Gly Leu Glu Cys Ser Pro Arg Thr Gly Leu Asp Phe Asn
180 185 190 Glu Met Ile
Leu Leu Thr Met Lys Asn Lys Ala Trp Met Val His Arg 195
200 205 Gln Trp Phe Phe Asp Leu Pro Leu
Pro Trp Thr Ser Gly Ala Thr Thr 210 215
220 Glu Thr Pro Thr Trp Asn Arg Lys Glu Leu Leu Val Thr
Phe Lys Asn225 230 235
240 Ala His Ala Lys Lys Gln Glu Val Val Val Leu Gly Ser Gln Glu Gly
245 250 255 Ala Met His Thr
Ala Leu Thr Gly Ala Thr Glu Ile Gln Asn Ser Gly 260
265 270 Gly Thr Ser Ile Phe Ala Gly His Leu
Lys Cys Arg Leu Lys Met Asp 275 280
285 Lys Leu Glu Leu Lys Gly Met Ser Tyr Ala Met Cys Leu Asn
Thr Phe 290 295 300
Val Leu Lys Lys Glu Val Ser Glu Thr Gln His Gly Thr Ile Leu Ile305
310 315 320 Lys Val Glu Tyr Lys
Gly Glu Asp Ala Pro Cys Lys Ile Pro Phe Ser 325
330 335 Thr Glu Asp Gly Gln Gly Lys Ala His Asn
Gly Arg Leu Ile Thr Ala 340 345
350 Asn Pro Val Val Thr Lys Lys Glu Glu Pro Val Asn Ile Glu Ala
Glu 355 360 365 Pro
Pro Phe Gly Glu Ser Asn Ile Val Ile Gly Ile Gly Asp Lys Ala 370
375 380 Leu Lys Ile Asn Trp Tyr
Lys Lys Gly Ser Ser Ile Gly Lys Met Phe385 390
395 400 Glu Ala Thr Ala Arg Gly Ala Arg Arg Met Ala
Ile Leu Gly Asp Thr 405 410
415 Ala Trp Asp Phe Gly Ser Val Gly Gly Val Leu Asn Ser Leu Gly Lys
420 425 430 Met Val His
Gln Ile Phe Gly Ser Ala Tyr Thr Ala Leu Phe Ser Gly 435
440 445 Val Ser Trp Ile Met Lys Ile Gly
Ile Gly Val Leu Leu Thr Trp Ile 450 455
460 Gly Leu Asn Ser Lys Asn Thr Ser Met Ser Phe Ser Cys
Ile Ala Ile465 470 475
480 Gly Ile Ile Thr Leu Tyr Leu Gly Ala Val Val Gln Ala
485 490 1651479DNAArtificial SequenceDengue 3
165atgagatgcg tgggagtagg aaacagagat tttgtggaag gtctgtcggg agctacgtgg
60gttgatgtgg tgctcgagca cggagggtgt gtgaccacca tggctaagaa caagcctacg
120ctggacatag agctccagaa gaccgaggcc acccaactgg cgaccctaag aaagttatgc
180attgagggaa aaattaccaa cataacaact gactcaaggt gtcctaccca gggggaagcg
240attttacctg aggagcagga ccagaactac gtatgtaagc acacatacgt ggatagaggt
300tggggaaacg gttgtggttt gtttggaaaa ggaagcttgg tgacatgcgc gaaatttcaa
360tgtctagaac caatagaggg aaaagtggtg caacatgaga acctcaaata cactgtcatc
420atcacagtgc acacaggaga ccaacaccag gtgggaaatg acacgcaggg agtcacggtt
480gagataacac cccaggcatc aaccgttgaa gctatcttgc ctgaatatgg aacccttggg
540ctagaatgtt caccacggac aggtttggat ttcaacgaaa tgattttatt gacaatgaag
600aacaaagcat ggatggtaca taggcaatgg ttctttgacc tacccctacc atggacatca
660ggagctacaa cagagacacc aacttggaac aggaaagagc tccttgtgac attcaagaat
720gcacatgcaa aaaagcaaga agtagttgtc cttggatcgc aagagggagc aatgcacaca
780gcgctgacag gagctacaga gattcaaaac tcaggaggta caagcatttt tgcggggcac
840ttgaaatgta gacttaagat ggacaaattg gaactcaagg ggatgagcta tgcaatgtgc
900ttgaatacct ttgtgttgaa gaaagaagtc tctgaaacgc agcatgggac aatactcatc
960aaggttgagt acaaagggga agatgcacct tgcaagattc ctttctccac agaggatgga
1020caagggaaag ctcacaatgg tagactgatc acagccaacc cagtggtgac caagaaggag
1080gagcctgtca acattgaggc tgaacctcct tttggggaaa gtaacatagt gattgggatt
1140ggagacaaag ccttgaaaat taactggtac aagaagggaa gctcgattgg aaagatgttc
1200gaggctactg ccagaggtgc aaggcgcatg gccatcttgg gagacacagc ctgggatttt
1260ggttcagtgg gtggtgttct gaattcatta gggaaaatgg tacaccaaat attcggaagt
1320gcttacacag ccctgtttag tggagtctca tggataatga aaattggaat aggtgtcctc
1380ttaacctgga tagggttgaa ttcaaaaaac acttccatgt cattttcatg cattgcgata
1440ggaattatta cactctatct gggagccgtg gtacaagct
1479166491PRTArtificial SequenceDengue 4 166Met Arg Cys Val Gly Val Gly
Asn Arg Asp Phe Val Glu Gly Val Ser1 5 10
15 Gly Gly Ala Trp Val Asp Leu Val Leu Glu His Gly
Gly Cys Val Thr 20 25 30
Thr Met Ala Gln Gly Lys Pro Thr Leu Asp Phe Glu Leu Thr Lys Thr
35 40 45 Thr Ala Lys Glu
Val Ala Leu Leu Arg Thr Tyr Cys Ile Glu Ala Ser 50 55
60 Ile Ser Asn Ile Thr Thr Ala Thr Arg
Cys Pro Thr Gln Gly Glu Pro65 70 75
80 Tyr Leu Lys Glu Glu Gln Asp Gln Gln Tyr Ile Cys Arg Arg
Asp Val 85 90 95
Val Asp Arg Gly Trp Gly Asn Gly Cys Gly Leu Phe Gly Lys Gly Gly
100 105 110 Val Val Thr Cys Ala
Lys Phe Ser Cys Ser Gly Lys Ile Thr Gly Asn 115
120 125 Leu Val Arg Ile Glu Asn Leu Glu Tyr
Thr Val Val Val Thr Val His 130 135
140 Asn Gly Asp Thr His Ala Val Gly Asn Asp Thr Ser Asn
His Gly Val145 150 155
160 Thr Ala Met Ile Thr Pro Arg Ser Pro Ser Val Glu Val Lys Leu Pro
165 170 175 Asp Tyr Gly Glu
Leu Thr Leu Asp Cys Glu Pro Arg Ser Gly Ile Asp 180
185 190 Phe Asn Glu Met Ile Leu Met Lys Met
Lys Lys Lys Thr Trp Leu Val 195 200
205 His Lys Gln Trp Phe Leu Asp Leu Pro Leu Pro Trp Thr Ala
Gly Ala 210 215 220
Asp Thr Ser Glu Val His Trp Asn Tyr Lys Glu Arg Met Val Thr Phe225
230 235 240 Lys Val Pro His Ala
Lys Arg Gln Asp Val Thr Val Leu Gly Ser Gln 245
250 255 Glu Gly Ala Met His Ser Ala Leu Ala Gly
Ala Thr Glu Val Asp Ser 260 265
270 Gly Asp Gly Asn His Met Phe Ala Gly His Leu Lys Cys Glu Val
Arg 275 280 285 Met
Glu Lys Leu Arg Ile Lys Gly Met Ser Tyr Thr Met Cys Ser Gly 290
295 300 Lys Phe Ser Ile Asp Lys
Glu Met Ala Glu Thr Gln His Gly Thr Thr305 310
315 320 Val Val Lys Val Lys Tyr Glu Gly Ala Gly Ala
Pro Cys Lys Val Pro 325 330
335 Ile Glu Ile Arg Asp Val Asn Lys Glu Lys Val Val Gly Arg Ile Ile
340 345 350 Ser Ser Thr
Pro Leu Ala Glu Asn Thr Asn Ser Val Thr Asn Ile Glu 355
360 365 Leu Glu Pro Pro Phe Gly Asp Ser
Tyr Ile Val Ile Gly Val Gly Asn 370 375
380 Ser Ala Leu Thr Leu His Trp Phe Arg Lys Gly Ser Ser
Ile Gly Lys385 390 395
400 Met Phe Glu Ser Thr Tyr Arg Gly Ala Lys Arg Met Ala Ile Leu Gly
405 410 415 Glu Thr Ala Trp
Asp Phe Gly Ser Val Gly Gly Leu Phe Thr Ser Leu 420
425 430 Gly Lys Ala Val His Gln Val Phe Gly
Ser Val Tyr Thr Thr Met Phe 435 440
445 Gly Gly Val Ser Trp Met Ile Arg Ile Leu Ile Gly Phe Leu
Val Leu 450 455 460
Trp Ile Gly Thr Asn Ser Arg Asn Thr Ser Met Ala Met Thr Cys Ile465
470 475 480 Ala Val Gly Gly Ile
Thr Leu Phe Leu Gly Phe 485 490
1671473DNAArtificial SequenceDengue 4 167atgcgatgcg taggagtagg aaacagagac
tttgtggaag gagtctcagg tggagcatgg 60gtcgacctgg tgctagaaca tggaggatgc
gtcacaacca tggcccaggg aaaaccaacc 120ttggattttg aactgaccaa gacaacagcc
aaggaagtgg ctctgttaag aacctattgc 180attgaagcct caatatcaaa cataactacg
gcaacaagat gtccaacgca aggagagcct 240tatctgaaag aggaacagga ccaacagtac
atttgccgga gagatgtggt agacagaggg 300tggggcaatg gctgtggctt gtttggaaaa
ggaggagttg tgacatgtgc gaagttttca 360tgttcgggga agataacagg caatttggtc
cgaattgaga accttgaata cacagtggtg 420gtaacagtcc acaatggaga cacccatgca
gtaggaaatg acacatccaa tcatggagtt 480acagccatga taacccccag gtcaccatcg
gtggaagtca aattgccgga ctatggagaa 540ctaacactcg attgtgaacc caggtctgga
attgacttta atgagatgat tctgatgaaa 600atgaaaaaga aaacatggct cgtgcataag
caatggtttt tggatctgcc tcttccatgg 660acagcaggag cagacacatc agaggttcac
tggaattaca aagagagaat ggtgacattt 720aaggttcctc atgccaagag acaggatgtg
acagtgctgg gatctcagga aggagccatg 780cattctgccc tcgctggagc cacagaagtg
gactccggtg atggaaatca catgtttgca 840ggacatctca agtgcgaagt ccgtatggag
aaattgagaa tcaagggaat gtcatacacg 900atgtgttcag gaaagttttc aattgacaaa
gagatggcag aaacacagca tgggacaaca 960gtggtgaaag tcaagtatga aggtgctgga
gctccgtgta aagtccccat agagataaga 1020gatgtaaaca aggaaaaagt ggttgggcgt
atcatctcat ccaccccttt ggctgagaat 1080accaacagtg taaccaacat agaattagaa
cccccctttg gggacagcta catagtgata 1140ggtgttggaa acagcgcatt aacactccat
tggttcagga aagggagttc cattggcaag 1200atgtttgagt ccacatacag aggtgcaaaa
cgaatggcca ttctaggtga aacagcttgg 1260gattttggtt ccgttggtgg attgttcaca
tcattgggaa aggctgtgca ccaggttttt 1320ggaagtgtgt atacaaccat gtttggagga
gtctcatgga tgattagaat cctaattggg 1380ttcttagtgt tgtggattgg cacgaactca
aggaacactt caatggctat gacgtgcata 1440gctgttggag gaatcactct gtttctgggc
ttc 147316820PRTArtificial SequenceWest
Nile virus 168Leu Thr Ser Gly His Leu Lys Cys Arg Val Lys Met Glu Lys Leu
Gln1 5 10 15 Leu
Lys Gly Thr 20 16920PRTArtificial SequenceWest Nile virus
169Leu Thr Ser Gly His Leu Lys Cys Arg Val Lys Met Glu Lys Leu Gln1
5 10 15 Leu Lys Gly Thr
20 1701217DNAArtificial SequenceJapanese encephalitis
170tttaattgtc tgggaatggg caatcgtgac ttcatagaag gagccagtgg agccgcttgg
60gtgacttggt gctagaagga gacagctgct tgacaatcat ggcaaacgac aaaccaacat
120tggacgtccg catgattaac atcgaagcta gccaacttgc tgaggtcaga agttactgct
180atcatgcttc agtcactgac atctcgacgg tggctcggtg ccccacgact ggagaagccc
240acaacgagaa gcgagctgat agtagctatg tgtgcaaaca aggcttcact gaccgtgggt
300ggggcaacgg atgtggattt ttcgggaagg gaagcattga cacatgtgca aaattctcct
360gcaccagtaa agcgattggg agaacaatcc agccagaaaa catcaaatac aaagttggca
420tttttgtgca tggaaccacc acttcggaaa accatgggaa ttattcagcg caagttgggg
480cgtcccaggc ggcaaagttt acagtaacac ccaatgctcc ttcggtagcc ctcaaacttg
540gtgactacgg agaagtcaca ctggactgtg agccaaggag tggactgaac actgaagcgt
600tttacgtcat gaccgtgggg tcaaagtcat ttctggtcca tagggagtgg tttcatgacc
660tcgctctccc ctggacgtcc ccttcgagca cagcgtggag aaacagagaa ctcctcatgg
720aatttgaagg ggcgcacgcc acaaaacagt ccgttgttgc tcttgggtca caggaaggag
780gcctccatca tgcgttggca ggagccatcg tggtggagta ctcaagctca gtgatgttaa
840catcaggcca cctgaaatgt aggctgaaaa tggacaaact ggctctgaaa ggcacaacct
900atggcatgtg tacagaaaaa ttctcgttcg cgaaaaatcc ggtggacact ggtcacggaa
960cagttgtcat tgaactctcc tactctggga gtgatggccc ctgcaaaatt ccgattgttt
1020ccgttgcgag cctcaatgac atgacccccg ttgggcggct ggtgacagtg aaccccttcg
1080tcgcgacttc cagtgccaac tcaaaggtgc tggtcgagat ggaacccccc ttcggagact
1140cctacatcgt agttggaagg ggagacaagc agatcaacca ccattggcac aaagctggaa
1200gcacgctggg caaggcc
1217171406PRTArtificial SequenceJapanese encephalitis 171Phe Asn Cys Leu
Gly Met Gly Asn Arg Asp Phe Ile Glu Gly Ala Ser1 5
10 15 Gly Ala Ala Trp Val Asp Leu Val Leu
Glu Gly Asp Ser Cys Leu Thr 20 25
30 Ile Met Ala Asn Asp Lys Pro Thr Leu Asp Val Arg Met Ile
Asn Ile 35 40 45
Glu Ala Ser Gln Leu Ala Glu Val Arg Ser Tyr Cys Tyr His Ala Ser 50
55 60 Val Thr Asp Ile Ser
Thr Val Ala Arg Cys Pro Thr Thr Gly Glu Ala65 70
75 80 His Asn Glu Lys Arg Ala Asp Ser Ser Tyr
Val Cys Lys Gln Gly Phe 85 90
95 Thr Asp Arg Gly Trp Gly Asn Gly Cys Gly Phe Phe Gly Lys Gly
Ser 100 105 110 Ile
Asp Thr Cys Ala Lys Phe Ser Cys Thr Ser Lys Ala Ile Gly Arg 115
120 125 Thr Ile Gln Pro Glu Asn
Ile Lys Tyr Lys Val Gly Ile Phe Val His 130 135
140 Gly Thr Thr Thr Ser Glu Asn His Gly Asn Tyr
Ser Ala Gln Val Gly145 150 155
160 Ala Ser Gln Ala Ala Lys Phe Thr Val Thr Pro Asn Ala Pro Ser Val
165 170 175 Ala Leu Lys
Leu Gly Asp Tyr Gly Glu Val Thr Leu Asp Cys Glu Pro 180
185 190 Arg Ser Gly Leu Asn Thr Glu Ala
Phe Tyr Val Met Thr Val Gly Ser 195 200
205 Lys Ser Phe Leu Val His Arg Glu Trp Phe His Asp Leu
Ala Leu Pro 210 215 220
Trp Thr Ser Pro Ser Ser Thr Ala Trp Arg Asn Arg Glu Leu Leu Met225
230 235 240 Glu Phe Glu Gly Ala
His Ala Thr Lys Gln Ser Val Val Ala Leu Gly 245
250 255 Ser Gln Glu Gly Gly Leu His His Ala Leu
Ala Gly Ala Ile Val Val 260 265
270 Glu Tyr Ser Ser Ser Val Met Leu Thr Ser Gly His Leu Lys Cys
Arg 275 280 285 Leu
Lys Met Asp Lys Leu Ala Leu Lys Gly Thr Thr Tyr Gly Met Cys 290
295 300 Thr Glu Lys Phe Ser Phe
Ala Lys Asn Pro Val Asp Thr Gly His Gly305 310
315 320 Thr Val Val Ile Glu Leu Ser Tyr Ser Gly Ser
Asp Gly Pro Cys Lys 325 330
335 Ile Pro Ile Val Ser Val Ala Ser Leu Asn Asp Met Thr Pro Val Gly
340 345 350 Arg Leu Val
Thr Val Asn Pro Phe Val Ala Thr Ser Ser Ala Asn Ser 355
360 365 Lys Val Leu Val Glu Met Glu Pro
Pro Phe Gly Asp Ser Tyr Ile Val 370 375
380 Val Gly Arg Gly Asp Lys Gln Ile Asn His His Trp His
Lys Ala Gly385 390 395
400 Ser Thr Leu Gly Lys Ala 405 1725PRTArtificial
SequenceWest Nile virus 172Met Glu Lys Leu Gln1 5
1736PRTArtificial SequenceWest Nile virus 173Met Asp Lys Leu Ala Leu1
5 174496PRTArtificial SequenceTick-borne encephalitis
174Ser Arg Cys Thr His Leu Glu Asn Arg Asp Phe Val Thr Gly Thr Gln1
5 10 15 Gly Thr Thr Arg
Val Thr Leu Val Leu Glu Leu Gly Gly Cys Val Thr 20
25 30 Ile Thr Ala Glu Gly Lys Pro Ser Met
Asp Val Trp Leu Asp Ser Ile 35 40
45 Tyr Gln Glu Asn Pro Ala Lys Thr Arg Glu Tyr Cys Leu His
Ala Lys 50 55 60
Leu Ser Asp Thr Lys Val Ala Ala Arg Cys Pro Thr Met Gly Pro Ala65
70 75 80 Thr Leu Thr Glu Glu
His Gln Ser Gly Thr Val Cys Lys Arg Asp Gln 85
90 95 Ser Asp Arg Gly Trp Gly Asn His Cys Gly
Leu Phe Gly Lys Gly Ser 100 105
110 Ile Val Thr Cys Val Lys Val Ala Cys Glu Ala Lys Lys Lys Ala
Ile 115 120 125 Gly
His Val Tyr Asp Ala Asn Lys Ile Val Tyr Thr Val Lys Val Glu 130
135 140 Pro His Thr Gly Asp Tyr
Val Ala Ala Asn Glu Thr His Ser Gly Arg145 150
155 160 Lys Thr Ala Ser Phe Thr Val Ser Ser Glu Lys
Thr Ile Leu Thr Met 165 170
175 Gly Asp Tyr Gly Asp Val Pro Leu Leu Cys Arg Val Ala Ser Gly Val
180 185 190 Asp Leu Ala
Gln Thr Val Ile Leu Glu Leu Asp Lys Thr Leu Glu His 195
200 205 Leu Pro Thr Ala Trp Gln Val His
Arg Asp Trp Phe Asn Asp Leu Ala 210 215
220 Leu Pro Trp Lys His Glu Gly Ala Gln Gln Trp Asn Asn
Ala Glu Arg225 230 235
240 Leu Val Glu Phe Gly Ala Pro His Ala Val Lys Met Asp Val Tyr Asn
245 250 255 Leu Gly Asp Gln
Thr Gly Val Leu Leu Lys Ser Leu Ala Gly Val Pro 260
265 270 Val Ala His Ile Asp Gly Thr Lys Tyr
His Leu Lys Ser Gly His Val 275 280
285 Thr Cys Glu Val Gly Leu Glu Lys Leu Lys Met Lys Gly Leu
Thr Tyr 290 295 300
Thr Met Cys Asp Lys Thr Lys Phe Ala Trp Lys Arg Thr Pro Thr Asp305
310 315 320 Ser Gly His Asp Thr
Val Val Met Glu Val Thr Phe Ser Gly Thr Lys 325
330 335 Pro Cys Arg Ile Pro Val Arg Ala Val Ala
His Gly Ser Pro Asp Val 340 345
350 Asn Val Ala Met Leu Ile Thr Pro Asn Pro Thr Ile Glu Asn Asn
Gly 355 360 365 Gly
Gly Phe Ile Glu Met Gln Leu Pro Pro Gly Asp Asn Ile Ile Tyr 370
375 380 Val Gly Glu Leu Ser His
Gln Trp Phe Gln Lys Gly Ser Ser Ile Gly385 390
395 400 Arg Val Phe Gln Lys Thr Arg Lys Gly Ile Glu
Arg Leu Thr Val Ile 405 410
415 Gly Glu His Ala Trp Asp Phe Gly Ser Thr Gly Gly Phe Leu Thr Ser
420 425 430 Val Gly Lys
Ala Leu His Thr Val Leu Gly Gly Ala Phe Asn Ser Ile 435
440 445 Phe Gly Gly Val Gly Phe Leu Pro
Lys Leu Leu Leu Gly Val Ala Leu 450 455
460 Ala Trp Leu Gly Leu Asn Met Arg Asn Pro Thr Met Ser
Met Ser Phe465 470 475
480 Leu Leu Ala Gly Gly Leu Val Leu Ala Met Thr Leu Gly Val Gly Ala
485 490 495
1751488DNAArtificial SequenceTick-borne encephalitis 175tcgcggtgca
cacatttgga gaacagggac tttgtcactg gtactcaggg aaccacgaga 60gtgactctgg
tgttggagct ggggggatgt gtcacgatca ctgctgaggg gaagccctca 120atggatgtgt
ggctcgattc catctatcag gagaaccctg ccaagacacg cgagtactgt 180ctgcatgcca
agctgtcgga caccaaagtt gcggccagat gcccaacaat ggggcctgcc 240actctgactg
aggagcatca gagtggtacg gtgtgcaaga gagaccagag tgaccgaggc 300tggggcaatc
actgcggatt gtttggaaag ggcagtattg tgacctgtgt caaggtggct 360tgtgaggcaa
agaagaaggc cattggacat gtgtatgatg ccaacaagat cgtgtacacc 420gttaaggttg
agccacacac gggggactat gttgccgcca atgaaaccca cagtgggagg 480aagacggcat
ccttcacggt ctcctcagaa aagaccatct tgactatggg ggactatgga 540gatgtgccct
tgttgtgcag agtcgccagt ggcgttgact tggctcagac tgtcattctt 600gagcttgaca
agactctgga acaccttcca acagcctggc aggtccatcg tgactggttc 660aatgatctgg
ctctaccgtg gaaacacgaa ggagcgcaac aatggaacaa tgctgagcga 720ctggttgaat
ttggagctcc gcatgccgtt aaaatggacg tgtataacct tggagatcaa 780actggggtgt
tgttgaagtc acttgctggg gttcctgtgg cgcacattga tggaacaaag 840taccacctaa
aaagcggcca tgtaacatgc gaggttggac tagaaaagct caaaatgaag 900ggtctcacat
acacaatgtg tgacaaaacg aagttcgcat ggaagcggac tccaacagac 960agcggacatg
acacagtggt catggaggtc acgttctctg gaacaaaacc ttgcaggatc 1020ccagtgcggg
cagtggcaca cggctctcca gatgtaaatg tggccatgct gataacacca 1080aaccccacca
ttgagaacaa tggaggtggc ttcatagaga tgcagctacc cccaggggat 1140aacatcatct
atgttgggga actaagccat cagtggttcc agaaggggag cagcatcgga 1200agggtgtttc
aaaagaccag gaagggcatc gagagactga cagtgatagg agaacacgcc 1260tgggacttcg
gttccactgg aggtttcttg acttcggtag gcaaagcgct gcacacagtc 1320ctcggcggag
ccttcaacag catctttggg ggagtggggt ttctgcccaa gctcctgttg 1380ggtgtggcct
tagcctggtt gggcctgaac atgaggaacc ccaccatgtc catgagtttc 1440ctcttggctg
ggggactggt cctggctatg acacttggag tgggtgct
1488176110PRTArtificial SequenceDomain III of West Nile virus 176Leu Lys
Gly Thr Thr Tyr Gly Val Cys Ser Lys Ala Phe Lys Phe Leu1 5
10 15 Gly Thr Pro Ala Asp Thr Gly
His Gly Thr Val Val Leu Glu Leu Gln 20 25
30 Tyr Thr Gly Thr Asp Gly Pro Cys Lys Val Pro Ile
Ser Ser Val Ala 35 40 45
Ser Leu Asn Asp Leu Thr Pro Val Gly Arg Leu Val Thr Val Asn Pro
50 55 60 Phe Val Ser
Val Ala Thr Ala Asn Ala Lys Val Leu Ile Glu Leu Glu65 70
75 80 Pro Pro Phe Gly Asp Ser Tyr Ile
Val Val Gly Arg Gly Glu Gln Gln 85 90
95 Ile Asn His His Trp His Lys Ser Gly Ser Ser Ile Gly
Lys 100 105 110
177110PRTArtificial SequenceDomain III of Japanese encephalitis virus
177Lys Gly Thr Thr Tyr Gly Met Cys Thr Glu Lys Phe Ser Phe Ala Lys1
5 10 15 Asn Pro Val Asp
Thr Gly His Gly Thr Val Val Ile Glu Leu Ser Tyr 20
25 30 Ser Gly Ser Asp Gly Pro Cys Lys Ile
Pro Ile Val Ser Val Ala Ser 35 40
45 Leu Asn Asp Met Thr Pro Val Gly Arg Leu Val Thr Val Asn
Pro Phe 50 55 60
Val Ala Thr Ser Ser Ala Asn Ser Lys Val Leu Val Glu Met Glu Pro65
70 75 80 Pro Phe Gly Asp Ser
Tyr Ile Val Val Gly Arg Gly Asp Lys Gln Ile 85
90 95 Asn His His Trp His Lys Ala Gly Ser Thr
Leu Gly Lys Ala 100 105 110
178345DNAArtificial SequenceWest Nile EIII+ 178atggaaaaat tgcagttgaa
gggaacaacc tatggcgtct gttcaaaggc tttcaagttt 60cttgggactc ccgcagacac
aggtcacggc actgtggtgt tggaattgca gtacactggc 120acggatggac cttgcaaagt
tcctatctcg tcagtggctt cattgaacga cctaacgcca 180gtgggcagat tggtcactgt
caaccctttt gtttcagtgg ccacggccaa cgctaaggtc 240ctgattgaat tggaaccacc
ctttggagac tcatacatag tggtgggcag aggagaacaa 300cagatcaatc accattggca
caagtctgga agcagcattg gcaaa 34517923PRTArtificial
SequenceP. aeruginosa 179Met Asn Asn Val Leu Lys Phe Ser Ala Leu Ala Leu
Ala Ala Val Leu1 5 10 15
Ala Thr Gly Cys Ser Ser His 20
18072DNAArtificial SequenceP. aeruginosa 180atgaaagcta ctaaactggt
actgggcgcg gtaatcctgg gttctactct gctggcaggt 60tgctccagca ac
7218124PRTArtificial
SequenceE. coli 181Met Lys Ala Thr Lys Leu Val Leu Gly Ala Val Ile Leu
Gly Ser Thr1 5 10 15
Leu Leu Ala Gly Cys Ser Ser Asn 20
18272DNAArtificial SequenceE. coli 182atgaaagcta ctaaactggt actgggcgcg
gtaatcctgg gttctactct gctggcaggt 60tgctccagca ac
7218311PRTArtificial SequenceLinker
183His Gly Ala Pro Val Asp Pro Ala Ser Pro Trp1 5
10 1848PRTArtificial SequenceTLR4 ligand 184Gly Gly Lys Ser
Gly Arg Thr Gly1 5 1859PRTArtificial
SequenceTLR4 ligand 185Lys Gly Tyr Asp Trp Leu Val Val Gly1
5 18610PRTArtificial SequenceTLR4 ligand 186Glu Asp Met
Val Tyr Arg Ile Gly Val Pro1 5 10
1876PRTArtificial SequenceTLR4 ligand 187Val Lys Leu Ser Gly Ser1
5 1888PRTArtificial SequenceTLR4 ligand 188Gly Met Leu Ser Leu
Ala Leu Phe1 5 1897PRTArtificial SequenceTLR4
ligand 189Cys Val Val Gly Ser Val Arg1 5
1908PRTArtificial SequenceTLR4 ligand 190Ile Val Arg Gly Cys Leu Gly Trp1
5 1918PRTArtificial SequenceTLR4 ligand 191Ala
Ala Glu Glu Arg Thr Leu Gly1 5
1929PRTArtificial SequenceTLR4 ligand 192Trp Ala Arg Val Val Gly Trp Leu
Arg1 5 1939PRTArtificial SequenceTLR4
ligand 193Ser Glu Gly Tyr Arg Leu Phe Gly Gly1 5
19410PRTArtificial SequenceTLR4 ligand 194Leu Val Gly Gly Val Val
Arg Arg Gly Ser1 5 10 19510PRTArtificial
SequenceTLR4 ligand 195Gly Arg Val Asn Asp Leu Trp Leu Ala Ala1
5 10 19610PRTArtificial SequenceTLR4 ligand 196Ser
Gly Trp Met Leu Trp Arg Glu Gly Ser1 5 10
19710PRTArtificial SequenceTLR4 ligand 197Glu Arg Met Glu Asp Arg Gly
Gly Asp Leu1 5 10 1989PRTArtificial
SequenceTLR4 ligand 198Lys Leu Cys Cys Phe Thr Glu Cys Met1
5 19910PRTArtificial SequenceTLR4 ligand 199Ala Val Gly
Ser Met Glu Arg Gly Arg Gly1 5 10
2009PRTArtificial SequenceTLR4 ligand 200Arg Asp Trp Val Gly Gly Asp Leu
Val1 5 20110PRTArtificial SequenceTLR4
ligand 201Phe Phe Glu Val Ala Lys Ile Ser Gln Gln1 5
10 2025PRTArtificial SequenceTLR4 ligand 202Trp Trp Tyr Trp
Cys1 5 2037PRTArtificial SequenceTLR4 ligand 203Met His
Leu Cys Ser His Ala1 5 2047PRTArtificial
SequenceTLR4 ligand 204Trp Leu Phe Arg Arg Ile Gly1 5
2057PRTArtificial SequenceTLR4 ligand 205Tyr Trp Phe Trp Arg Ile Gly1
5 2067PRTArtificial SequenceTLR4 ligand 206Met His
Leu Tyr Cys Ile Ala1 5 2078PRTArtificial
SequenceTLR4 ligand 207Trp Pro Leu Phe Pro Trp Ile Val1 5
2087PRTArtificial SequenceTLR4 ligand 208Asp Met Arg Ser His
Ala Arg1 5 2097PRTArtificial SequenceTLR4 ligand
209Met His Leu Cys Thr His Ala1 5
2106PRTArtificial SequenceTLR4 ligand 210Asn Leu Phe Pro Phe Tyr1
5 2117PRTArtificial SequenceTLR4 ligand 211Met His Leu Cys Thr
Arg Ala1 5 2127PRTArtificial SequenceTLR4 ligand
212Arg His Leu Trp Tyr His Ala1 5
2137PRTArtificial SequenceTLR4 ligand 213Trp Pro Phe Ser Ala Tyr Trp1
5 2146PRTArtificial SequenceTLR4 ligand 214Trp Tyr Leu
Arg Gly Ser1 5 2157PRTArtificial SequenceTLR4 ligand
215Gly Lys Gly Thr Asp Leu Gly1 5
2166PRTArtificial SequenceTLR4 ligand 216Ile Phe Val Arg Met Arg1
5 2177PRTArtificial SequenceTLR4 ligand 217Trp Leu Phe Arg Pro
Val Phe1 5 2187PRTArtificial SequenceTLR4 ligand
218Phe Leu Gly Trp Leu Met Gly1 5
2197PRTArtificial SequenceTLR4 ligand 219Met His Leu Trp His His Ala1
5 2207PRTArtificial SequenceTLR4 ligand 220Trp Trp Phe
Pro Trp Lys Ala1 5 2217PRTArtificial SequenceTLR4
ligand 221Trp Tyr Leu Pro Trp Leu Gly1 5
2227PRTArtificial SequenceTLR4 ligand 222Trp Pro Phe Pro Arg Thr Phe1
5 2237PRTArtificial SequenceTLR4 ligand 223Trp Pro Phe
Pro Ala Tyr Trp1 5 2247PRTArtificial SequenceTLR4
ligand 224Phe Leu Gly Leu Arg Trp Leu1 5
22510PRTArtificial SequenceTLR4 ligand 225Ser Arg Thr Asp Val Gly Val Leu
Glu Val1 5 10 22610PRTArtificial
SequenceTLR4 ligand 226Arg Glu Lys Val Ser Arg Gly Asp Lys Gly1
5 10 22710PRTArtificial SequenceTLR4 ligand 227Asp
Trp Asp Ala Val Glu Ser Glu Tyr Met1 5 10
22810PRTArtificial SequenceTLR4 ligand 228Val Ser Ser Ala Gln Glu Val
Arg Val Pro1 5 10 22910PRTArtificial
SequenceTLR4 ligand 229Leu Thr Tyr Gly Gly Leu Glu Ala Leu Gly1
5 10 23010PRTArtificial SequenceTLR4 ligand 230Val
Glu Glu Tyr Ser Ser Ser Gly Val Ser1 5 10
23110PRTArtificial SequenceTLR4 ligand 231Val Cys Glu Val Ser Asp Ser
Val Met Ala1 5 10 2325PRTArtificial
SequenceTLR2 ligand 232Asn Pro Pro Thr Thr1 5
2335PRTArtificial SequenceTLR2 ligand 233Met Arg Arg Ile Leu1
5 2344PRTArtificial SequenceTLR2 ligand 234Met Ile Ser Ser1
2355PRTArtificial SequenceTLR2 ligand 235Arg Gly Gly Ser Lys1
5 2364PRTArtificial SequenceTLR2 ligand 236Arg Gly Gly Phe1
2375PRTArtificial SequenceTLR2 ligand 237Asn Arg Thr Val Phe1
5 2385PRTArtificial SequenceTLR2 ligand 238Asn Arg Phe Gly Leu1
5 2395PRTArtificial SequenceTLR2 ligand 239Ser Arg His Gly
Arg1 5 2405PRTArtificial SequenceTLR2 ligand 240Ile Met
Arg His Pro1 5 2415PRTArtificial SequenceTLR2 ligand
241Glu Val Cys Ala Pro1 5 2425PRTArtificial SequenceTLR2
ligand 242Ala Cys Gly Val Tyr1 5 2435PRTArtificial
SequenceTLR2 ligand 243Cys Gly Pro Lys Leu1 5
2445PRTArtificial SequenceTLR2 ligand 244Ala Gly Cys Phe Ser1
5 2455PRTArtificial SequenceTLR2 ligand 245Ser Gly Gly Leu Phe1
5 2465PRTArtificial SequenceTLR2 ligand 246Ala Val Arg Leu Ser1
5 2475PRTArtificial SequenceTLR2 ligand 247Gly Gly Lys Leu
Ser1 5 2485PRTArtificial SequenceTLR2 ligand 248Val Ser
Glu Gly Val1 5 2495PRTArtificial SequenceTLR2 ligand
249Lys Cys Gln Ser Phe1 5 2505PRTArtificial SequenceTLR2
ligand 250Phe Cys Gly Leu Gly1 5 2515PRTArtificial
SequenceTLR2 ligand 251Pro Glu Ser Gly Val1 5
2525PRTArtificial SequenceTLR2 ligand 252Asp Pro Asp Ser Gly1
5 2535PRTArtificial SequenceTLR2 ligand 253Ile Gly Arg Phe Arg1
5 2545PRTArtificial SequenceTLR2 ligand 254Met Gly Thr Leu Pro1
5 2555PRTArtificial SequenceTLR2 ligand 255Ala Asp Thr His
Gln1 5 2565PRTArtificial SequenceTLR2 ligand 256His Leu
Leu Pro Gly1 5 2575PRTArtificial SequenceTLR2 ligand
257Gly Pro Leu Leu His1 5 2585PRTArtificial SequenceTLR2
ligand 258Asn Tyr Arg Arg Trp1 5 2595PRTArtificial
SequenceTLR2 ligand 259Leu Arg Gln Gly Arg1 5
2605PRTArtificial SequenceTLR2 ligand 260Ile Met Trp Phe Pro1
5 2615PRTArtificial SequenceTLR2 ligand 261Arg Val Val Ala Pro1
5 2625PRTArtificial SequenceTLR2 ligand 262Ile His Val Val Pro1
5 2635PRTArtificial SequenceTLR2 ligand 263Met Phe Gly Val
Pro1 5 2645PRTArtificial SequenceTLR2 ligand 264Cys Val
Trp Leu Gln1 5 2655PRTArtificial SequenceTLR2 ligand
265Ile Tyr Lys Leu Ala1 5 2664PRTArtificial SequenceTLR2
ligand 266Lys Gly Trp Phe1 2675PRTArtificial SequenceTLR2
ligand 267Lys Tyr Met Pro His1 5 2685PRTArtificial
SequenceTLR2 ligand 268Val Gly Lys Asn Asp1 5
2695PRTArtificial SequenceTLR2 ligand 269Thr His Lys Pro Lys1
5 2705PRTArtificial SequenceTLR2 ligand 270Ser His Ile Ala Leu1
5 2715PRTArtificial SequenceTLR2 ligand 271Ala Trp Ala Gly Thr1
5 27220PRTArtificial SequenceTLR2 ligand 272Lys Gly Gly Val
Gly Pro Val Arg Arg Ser Ser Arg Leu Arg Arg Thr1 5
10 15 Thr Gln Pro Gly 20
27323PRTArtificial SequenceTLR2 ligand 273Gly Arg Arg Gly Leu Cys Arg Gly
Cys Arg Thr Arg Gly Arg Ile Lys1 5 10
15 Gln Leu Gln Ser Ala His Lys 20
27422PRTArtificial SequenceTLR2 ligand 274Arg Trp Gly Tyr His Leu Arg
Asp Arg Lys Tyr Lys Gly Val Arg Ser1 5 10
15 His Lys Gly Val Pro Arg 20
275535PRTArtificial SequenceCross-reactive Mutant (CRM) of diptheria
toxin 275Gly Ala Asp Asp Val Val Asp Ser Ser Lys Ser Phe Val Met Glu Asn1
5 10 15 Phe Ser Ser
Tyr His Gly Thr Lys Pro Gly Tyr Val Asp Ser Ile Gln 20
25 30 Lys Gly Ile Gln Lys Pro Lys Ser
Gly Thr Gln Gly Asn Tyr Asp Asp 35 40
45 Asp Trp Lys Gly Phe Tyr Ser Thr Asp Asn Lys Tyr Asp
Ala Ala Gly 50 55 60
Tyr Ser Val Asp Asn Glu Asn Pro Leu Ser Gly Lys Ala Gly Gly Val65
70 75 80 Val Lys Val Thr Tyr
Pro Gly Leu Thr Lys Val Leu Ala Leu Lys Val 85
90 95 Asp Asn Ala Glu Thr Ile Lys Lys Glu Leu
Gly Leu Ser Leu Thr Glu 100 105
110 Pro Leu Met Glu Gln Val Gly Thr Glu Glu Phe Ile Lys Arg Phe
Gly 115 120 125 Asp
Gly Ala Ser Arg Val Val Leu Ser Leu Pro Phe Ala Glu Gly Ser 130
135 140 Ser Ser Val Glu Tyr Ile
Asn Asn Trp Glu Gln Ala Lys Ala Leu Ser145 150
155 160 Val Glu Leu Glu Ile Asn Phe Glu Thr Arg Gly
Lys Arg Gly Gln Asp 165 170
175 Ala Met Tyr Glu Tyr Met Ala Gln Ala Cys Ala Gly Asn Arg Val Arg
180 185 190 Arg Ser Val
Gly Ser Ser Leu Ser Cys Ile Asn Leu Asp Trp Asp Val 195
200 205 Ile Arg Asp Lys Thr Lys Thr Lys
Ile Glu Ser Leu Lys Glu His Gly 210 215
220 Pro Ile Lys Asn Lys Met Ser Glu Ser Pro Asn Lys Thr
Val Ser Glu225 230 235
240 Glu Lys Ala Lys Gln Tyr Leu Glu Glu Phe His Gln Thr Ala Leu Glu
245 250 255 His Pro Glu Leu
Ser Glu Leu Lys Thr Val Thr Gly Thr Asn Pro Val 260
265 270 Phe Ala Gly Ala Asn Tyr Ala Ala Trp
Ala Val Asn Val Ala Gln Val 275 280
285 Ile Asp Ser Glu Thr Ala Asp Asn Leu Glu Lys Thr Thr Ala
Ala Leu 290 295 300
Ser Ile Leu Pro Gly Ile Gly Ser Val Met Gly Ile Ala Asp Gly Ala305
310 315 320 Val His His Asn Thr
Glu Glu Ile Val Ala Gln Ser Ile Ala Leu Ser 325
330 335 Ser Leu Met Val Ala Gln Ala Ile Pro Leu
Val Gly Glu Leu Val Asp 340 345
350 Ile Gly Phe Ala Ala Tyr Asn Phe Val Glu Ser Ile Ile Asn Leu
Phe 355 360 365 Gln
Val Val His Asn Ser Tyr Asn Arg Pro Ala Tyr Ser Pro Gly His 370
375 380 Lys Thr Gln Pro Phe Leu
His Asp Gly Tyr Ala Val Ser Trp Asn Thr385 390
395 400 Val Glu Asp Ser Ile Ile Arg Thr Gly Phe Gln
Gly Glu Ser Gly His 405 410
415 Asp Ile Lys Ile Thr Ala Glu Asn Thr Pro Leu Pro Ile Ala Gly Val
420 425 430 Leu Leu Pro
Thr Ile Pro Gly Lys Leu Asp Val Asn Lys Ser Lys Thr 435
440 445 His Ile Ser Val Asn Gly Arg Lys
Ile Arg Met Arg Cys Arg Ala Ile 450 455
460 Asp Gly Asp Val Thr Phe Cys Arg Pro Lys Ser Pro Val
Tyr Val Gly465 470 475
480 Asn Gly Val His Ala Asn Leu His Val Ala Phe His Arg Ser Ser Ser
485 490 495 Glu Lys Ile His
Ser Asn Glu Ile Ser Ser Asp Ser Ile Gly Val Leu 500
505 510 Gly Tyr Gln Lys Thr Val Asp His Thr
Lys Val Asn Ser Lys Leu Ser 515 520
525 Leu Phe Phe Glu Ile Lys Ser 530 535
276164PRTArtificial SequenceCoat protein of Tobacco mosaic virus (TMV)
276Met Met Ala Tyr Ser Ile Pro Thr Pro Ser Gln Leu Val Tyr Phe Thr1
5 10 15 Glu Asn Tyr Ala
Asp Tyr Ile Pro Phe Val Asn Arg Leu Ile Asn Ala 20
25 30 Arg Ser Asn Ser Phe Gln Thr Gln Ser
Gly Arg Asp Glu Leu Arg Glu 35 40
45 Ile Leu Ile Lys Ser Gln Val Ser Val Val Ser Pro Ile Ser
Arg Phe 50 55 60
Pro Ala Glu Pro Ala Tyr Tyr Ile Tyr Leu Arg Asp Pro Ser Ile Ser65
70 75 80 Thr Val Tyr Thr Ala
Leu Leu Gln Ser Thr Asp Thr Arg Asn Arg Val 85
90 95 Ile Glu Val Glu Asn Ser Thr Asn Val Thr
Thr Ala Glu Gln Leu Asn 100 105
110 Ala Val Arg Arg Thr Asp Asp Ala Ser Thr Ala Ile His Asn Asn
Leu 115 120 125 Glu
Gln Leu Leu Ser Leu Leu Thr Asn Gly Thr Gly Val Phe Asn Arg 130
135 140 Thr Ser Phe Glu Ser Ala
Ser Gly Leu Thr Trp Leu Val Thr Thr Thr145 150
155 160 Pro Arg Thr Ala277221PRTArtificial
SequenceCoat protein of alfalfa mosaic virus 277Met Ser Ser Ser Gln Lys
Lys Ala Gly Gly Lys Ala Gly Lys Pro Thr1 5
10 15 Lys Arg Ser Gln Asn Tyr Ala Ala Leu Arg Lys
Ala Gln Leu Pro Lys 20 25 30
Pro Pro Ala Leu Lys Val Pro Val Ala Lys Pro Thr Asn Thr Ile Leu
35 40 45 Pro Gln Thr
Gly Cys Val Trp Gln Ser Leu Gly Thr Pro Leu Ser Leu 50
55 60 Ser Ser Ser Asn Gly Leu Gly Ala
Arg Phe Leu Tyr Ser Phe Leu Lys65 70 75
80 Asp Phe Ala Ala Pro Arg Ile Leu Glu Glu Asp Leu Ile
Phe Arg Met 85 90 95
Val Phe Ser Ile Thr Pro Ser His Ala Gly Ser Phe Cys Leu Thr Asp
100 105 110 Asp Val Thr Thr Glu
Asp Gly Arg Ala Val Ala His Gly Asn Pro Met 115
120 125 Gln Glu Phe Pro His Gly Ala Phe His
Ala Asn Glu Lys Phe Gly Phe 130 135
140 Glu Leu Val Phe Thr Ala Pro Thr His Ala Gly Met Gln
Asn Gln Asn145 150 155
160 Phe Lys His Ser Tyr Ala Val Ala Leu Cys Leu Asp Phe Asp Ala Leu
165 170 175 Pro Glu Gly Ser
Arg Asn Pro Ser Tyr Arg Phe Asn Glu Val Trp Val 180
185 190 Glu Arg Lys Ala Phe Pro Arg Ala Gly
Pro Leu Arg Ser Leu Ile Thr 195 200
205 Val Gly Leu Phe Asp Asp Ala Asp Asp Leu Asp Arg Gln
210 215 220 278237PRTArtificial
SequenceCoat protein of Potato virus X 278Met Thr Thr Pro Ala Asn Thr Thr
Gln Ala Thr Gly Ser Thr Thr Ser1 5 10
15 Thr Thr Thr Lys Thr Ala Gly Ala Thr Pro Ala Thr Thr
Ser Gly Leu 20 25 30
Phe Thr Ile Pro Asp Gly Glu Phe Phe Ser Thr Ala Arg Ala Ile Val
35 40 45 Ala Ser Asn Ala
Val Ala Thr Asn Glu Asp Leu Ser Lys Ile Glu Ala 50 55
60 Ile Trp Lys Asp Met Lys Val Pro Thr
Asp Thr Met Ala Gln Ala Ala65 70 75
80 Trp Asp Leu Val Arg His Cys Ala Asp Val Gly Ser Ser Ala
Gln Thr 85 90 95
Glu Met Ile Asp Thr Gly Pro Tyr Ser Asn Gly Ile Ser Arg Ala Arg
100 105 110 Leu Ala Ala Ala Ile
Lys Glu Val Cys Thr Leu Arg Gln Phe Cys Met 115
120 125 Lys Tyr Ala Pro Val Val Trp Asn Trp
Met Leu Thr Asn Asn Ser Pro 130 135
140 Pro Ala Asn Trp Gln Ala Gln Gly Phe Lys Pro Glu His
Lys Phe Ala145 150 155
160 Ala Phe Asp Phe Phe Asn Gly Val Thr Asn Pro Ala Ala Ile Met Pro
165 170 175 Lys Glu Gly Leu
Ile Arg Pro Pro Ser Glu Ala Glu Met Asn Ala Ala 180
185 190 Gln Thr Ala Ala Phe Val Lys Ile Thr
Lys Ala Arg Ala Gln Ser Asn 195 200
205 Asp Phe Ala Ser Leu Asp Ala Ala Val Thr Arg Gly Arg Ile
Thr Gly 210 215 220
Thr Thr Thr Ala Glu Ala Val Val Thr Leu Pro Pro Pro225
230 235 279395PRTArtificial Sequenceclass I outer
membrane protein of Neisseria meningitides 279Met Arg Lys Lys Leu
Thr Ala Leu Val Leu Ser Ala Leu Pro Leu Ala1 5
10 15 Ala Val Ala Asp Val Ser Leu Tyr Gly Glu
Ile Lys Ala Gly Val Glu 20 25
30 Gly Arg Asn Tyr Gln Leu Gln Leu Thr Glu Ala Gln Ala Ala Asn
Gly 35 40 45 Gly
Ala Ser Gly Gln Val Lys Val Thr Lys Val Thr Lys Ala Lys Ser 50
55 60 Arg Ile Arg Thr Lys Ile
Ser Asp Phe Gly Ser Phe Ile Gly Phe Lys65 70
75 80 Gly Ser Glu Asp Leu Gly Glu Gly Leu Lys Ala
Val Trp Gln Leu Glu 85 90
95 Gln Asp Val Ser Val Ala Gly Gly Gly Ala Thr Gln Trp Gly Asn Arg
100 105 110 Glu Ser Phe
Ile Gly Leu Ala Gly Glu Phe Gly Thr Leu Arg Ala Gly 115
120 125 Arg Val Ala Asn Gln Phe Asp Asp
Ala Ser Gln Ala Ile Asp Pro Trp 130 135
140 Asp Ser Asn Asn Asp Val Ala Ser Gln Leu Gly Ile Phe
Lys Arg His145 150 155
160 Asp Asp Met Pro Val Ser Val Arg Tyr Asp Ser Pro Glu Phe Ser Gly
165 170 175 Phe Ser Gly Ser
Val Gln Phe Val Pro Ala Gln Asn Ser Lys Ser Ala 180
185 190 Tyr Lys Pro Ala Tyr Trp Thr Thr Val
Asn Thr Gly Ser Ala Thr Thr 195 200
205 Thr Thr Phe Val Pro Ala Val Val Gly Lys Pro Gly Ser Asp
Val Tyr 210 215 220
Tyr Ala Gly Leu Asn Tyr Lys Asn Gly Gly Phe Ala Gly Asn Tyr Ala225
230 235 240 Phe Lys Tyr Ala Arg
His Ala Asn Val Gly Arg Asp Ala Phe Glu Leu 245
250 255 Phe Leu Leu Gly Ser Gly Ser Asp Gln Ala
Lys Gly Thr Asp Pro Leu 260 265
270 Lys Asn His Gln Val His Arg Leu Thr Gly Gly Tyr Glu Glu Gly
Gly 275 280 285 Leu
Asn Leu Ala Leu Ala Ala Gln Leu Asp Leu Ser Glu Asn Gly Asp 290
295 300 Lys Thr Lys Asn Ser Thr
Thr Glu Ile Ala Ala Thr Ala Ser Tyr Arg305 310
315 320 Phe Gly Asn Ala Val Pro Arg Ile Ser Tyr Ala
His Gly Phe Asp Phe 325 330
335 Ile Glu Arg Gly Lys Lys Gly Glu Asn Thr Ser Tyr Asp Gln Ile Ile
340 345 350 Ala Gly Val
Asp Tyr Asp Phe Ser Lys Arg Thr Ser Ala Ile Val Ser 355
360 365 Gly Ala Trp Leu Lys Arg Asn Thr
Gly Ile Gly Asn Tyr Thr Gln Ile 370 375
380 Asn Ala Ala Ser Val Gly Leu Arg His Lys Phe385
390 395 280347PRTArtificial SequenceMajor
fimbrial subunit protein type I 280Met Val Leu Lys Thr Ser Asn Ser Asn
Arg Ala Phe Gly Val Gly Asp1 5 10
15 Asp Glu Ser Lys Val Ala Lys Leu Thr Val Met Val Tyr Asn
Gly Glu 20 25 30
Gln Gln Glu Ala Ile Lys Ser Ala Glu Asn Ala Thr Lys Val Glu Asp 35
40 45 Ile Lys Cys Ser Ala
Gly Gln Arg Thr Leu Val Val Met Ala Asn Thr 50 55
60 Gly Ala Met Glu Leu Val Gly Lys Thr Leu
Ala Glu Val Lys Ala Leu65 70 75
80 Thr Thr Glu Leu Thr Ala Glu Asn Gln Glu Ala Ala Gly Leu Ile
Met 85 90 95 Thr
Ala Glu Pro Lys Thr Ile Val Leu Lys Ala Gly Lys Asn Tyr Ile
100 105 110 Gly Tyr Ser Gly Thr
Gly Glu Gly Asn His Ile Glu Asn Asp Pro Leu 115
120 125 Lys Ile Lys Arg Val His Ala Arg Met
Ala Phe Thr Glu Ile Lys Val 130 135
140 Gln Met Ser Ala Ala Tyr Asp Asn Ile Tyr Thr Phe Val
Pro Glu Lys145 150 155
160 Ile Tyr Gly Leu Ile Ala Lys Lys Gln Ser Asn Leu Phe Gly Ala Thr
165 170 175 Leu Val Asn Ala
Asp Ala Asn Tyr Leu Thr Gly Ser Leu Thr Thr Phe 180
185 190 Asn Gly Ala Tyr Thr Pro Ala Asn Tyr
Ala Asn Val Pro Trp Leu Ser 195 200
205 Arg Asn Tyr Val Ala Pro Ala Ala Asp Ala Pro Gln Gly Phe
Tyr Val 210 215 220
Leu Glu Asn Asp Tyr Ser Ala Asn Gly Gly Thr Ile His Pro Thr Ile225
230 235 240 Leu Cys Val Tyr Gly
Lys Leu Gln Lys Asn Gly Ala Asp Leu Ala Gly 245
250 255 Ala Asp Leu Ala Ala Ala Gln Ala Ala Asn
Trp Val Asp Ala Glu Gly 260 265
270 Lys Thr Tyr Tyr Pro Val Leu Val Asn Phe Asn Ser Asn Asn Tyr
Thr 275 280 285 Tyr
Asp Ser Asn Tyr Thr Pro Lys Asn Lys Ile Glu Arg Asn His Lys 290
295 300 Tyr Asp Ile Lys Leu Thr
Ile Thr Gly Pro Gly Thr Asn Asn Pro Glu305 310
315 320 Asn Pro Ile Thr Glu Ser Ala His Leu Asn Val
Gln Cys Thr Val Ala 325 330
335 Glu Trp Val Leu Val Gly Gln Asn Ala Thr Trp 340
345 281428PRTArtificial SequenceMycoplasma fermentans
macrophage activating lipopeptide 281Met Lys Lys Ser Lys Lys Ile Leu
Leu Gly Leu Ser Pro Ile Ala Ala1 5 10
15 Val Leu Pro Ala Val Ala Val Ser Cys Gly Asn Asn Asp
Glu Ser Asn 20 25 30
Ile Ser Phe Lys Glu Lys Asp Ile Ser Lys Tyr Thr Thr Thr Asn Ala
35 40 45 Asn Gly Lys Gln
Val Val Lys Asn Ala Glu Leu Leu Lys Leu Lys Pro 50 55
60 Val Leu Ile Thr Asp Glu Gly Lys Ile
Asp Asp Lys Ser Phe Asn Gln65 70 75
80 Ser Ala Phe Glu Ala Leu Lys Ala Ile Asn Lys Gln Thr Gly
Ile Glu 85 90 95
Ile Asn Ser Val Glu Pro Ser Ser Asn Phe Glu Ser Ala Tyr Asn Ser
100 105 110 Ala Leu Ser Ala Gly
His Lys Ile Trp Val Leu Asn Gly Phe Lys His 115
120 125 Gln Gln Ser Ile Lys Gln Tyr Ile Asp
Ala His Arg Glu Glu Leu Glu 130 135
140 Arg Asn Gln Ile Lys Ile Ile Gly Ile Asp Phe Asp Ile
Glu Thr Glu145 150 155
160 Tyr Lys Trp Phe Tyr Ser Leu Gln Phe Asn Ile Lys Glu Ser Ala Phe
165 170 175 Thr Thr Gly Tyr
Ala Ile Ala Ser Trp Leu Ser Glu Gln Asp Glu Ser 180
185 190 Lys Arg Val Val Ala Ser Phe Gly Val
Gly Ala Phe Pro Gly Val Thr 195 200
205 Thr Phe Asn Glu Gly Phe Ala Lys Gly Ile Leu Tyr Tyr Asn
Gln Lys 210 215 220
His Lys Ser Ser Lys Ile Tyr His Thr Ser Pro Val Lys Leu Asp Ser225
230 235 240 Gly Phe Thr Ala Gly
Glu Lys Met Asn Thr Val Ile Asn Asn Val Leu 245
250 255 Ser Ser Thr Pro Ala Asp Val Lys Tyr Asn
Pro His Val Ile Leu Ser 260 265
270 Val Ala Gly Pro Ala Thr Phe Glu Thr Val Arg Leu Ala Asn Lys
Gly 275 280 285 Gln
Tyr Val Ile Gly Val Asp Ser Asp Gln Gly Met Ile Gln Asp Lys 290
295 300 Asp Arg Ile Leu Thr Ser
Val Leu Lys His Ile Lys Gln Ala Val Tyr305 310
315 320 Glu Thr Leu Leu Asp Leu Ile Leu Glu Lys Glu
Glu Gly Tyr Lys Pro 325 330
335 Tyr Val Val Lys Asp Lys Lys Ala Asp Lys Lys Trp Ser His Phe Gly
340 345 350 Thr Gln Lys
Glu Lys Trp Ile Gly Val Ala Glu Asn His Phe Ser Asn 355
360 365 Thr Glu Glu Gln Ala Lys Ile Asn
Asn Lys Ile Lys Glu Ala Ile Lys 370 375
380 Met Phe Lys Glu Leu Pro Glu Asp Phe Val Lys Tyr Ile
Asn Ser Asp385 390 395
400 Lys Ala Leu Lys Asp Gly Asn Lys Ile Asp Asn Val Ser Glu Arg Leu
405 410 415 Glu Ala Ile Ile
Ser Ala Ile Asn Lys Ala Ala Lys 420 425
282143PRTArtificial Sequencep19 protein of Mycobacterium
tuberculosis 282Ala Thr Thr Leu Pro Val Gln Arg His Pro Arg Ser Leu Phe
Pro Glu1 5 10 15
Phe Ser Glu Leu Phe Ala Ala Phe Pro Ser Phe Ala Gly Leu Arg Pro
20 25 30 Thr Phe Asp Thr Arg
Leu Met Arg Leu Glu Asp Glu Met Lys Glu Gly 35 40
45 Arg Tyr Glu Val Arg Ala Glu Leu Pro Gly
Val Asp Pro Asp Lys Asp 50 55 60
Val Asp Ile Met Val Arg Asp Gly Gln Leu Thr Ile Lys Ala Glu
Arg65 70 75 80 Thr
Glu Gln Lys Asp Phe Asp Gly Arg Ser Glu Phe Ala Tyr Gly Ser
85 90 95 Phe Val Arg Thr Val Ser
Leu Pro Val Gly Ala Asp Glu Asp Asp Ile 100
105 110 Lys Ala Thr Tyr Asp Lys Gly Ile Leu Thr
Val Ser Val Ala Val Ser 115 120
125 Glu Gly Lys Pro Thr Glu Lys His Ile Gln Ile Arg Ser Thr
Asn 130 135 140
User Contributions:
Comment about this patent or add new information about this topic: