CARBOHYDRATE-CONTAINING PAN CANCER MARKER

Abstract

The effective epitope of CA215, a known cancer marker and antigen, has been demonstrated to include a carbohydrate moiety of defined composition and to be non-reactive with anti-human IgG, IgA and IgM, although CA215 is an immunoglobulin heavy chain-like molecule. The defined epitope may be used to prepare immunogenic compositions for treatment and prevention of cancers in humans and may be optimized as to protocol and formulation in animal model systems. Improved protocols for diagnosis and treatment are also described.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application is a divisional of U.S. Ser. No. 12/599,284 having an international filing date of 14 May 2008, which is the national phase of PCT application PCT/CA2008/000932 having an international filing date of 14 May 2008, which claims priority to U.S. Provisional Application Ser. No. 60/917,906 filed 14 May 2007 and U.S. Provisional Application Ser. No. 61/044,028 filed 10 Apr. 2008. The contents of these documents are incorporated herein by reference.

REFERENCE TO SEQUENCE LISTING SUBMITTED VIA EFS-WEB

[0002] The entire content of the following electronic submission of the sequence listing via the USPTO EFS-WEB server, as authorized and set forth in MPEP §1730 II.B.2(a)(C), is incorporated herein by reference in its entirety for all purposes. The sequence listing is identified on the electronically filed text file as follows:

TABLE-US-00001 File Name Date of Creation Size (bytes) 616342000110Seqlist.txt Mar. 9, 2012 53,053 bytes

TECHNICAL FIELD

[0003] The invention relates to the field of protein markers that can distinguish cancer cells or tissues from normal cells or tissues and are found on many tumors in human subjects. More specifically, the invention relates to the carbohydrate-containing epitope of the known cancer marker CA215 and to methods of using this epitope.

BACKGROUND ART

[0004] U.S. Pat. No. 5,650,291 ('291) incorporated herein by reference describes the isolation of a tumor-associated antigen, CA215, which is present on an ovarian tumor cell line, and is also displayed on many tumors in humans. Monoclonal antibodies were prepared to this antigen, including the monoclonal antibody RP215. The hybridoma cell line that produces this antibody was deposited at the American Type Culture Collection under the terms of the Budapest Treaty on 5 Apr. 1989 as ATCC HB10095. The current address of ATCC is P.O. Box 1549, Manassas, Va. 20108. The '291 patent describes CA215 as having a minimum molecular weight of 60 kD on SDS gels when identified with RP215. However, aggregates with molecular weights ranging from 100 kD to 2,000 kD were also shown to be present. CA215 was purified by immunoaffinity chromatographic procedures and could be purified either from an extract of cultured ovarian tumor cells (OC-3-VGH) or from the shed culture medium of these cells. The CA215 antigen is characterized as a "membrane associated" soluble antigen which can be detected by RP215 in sera of patients with ovarian or cervical cancer. The antigen could not be detected in any normal tissue. This antigen and the monoclonal antibody that recognizes it were also described in an article by Lee, C. Y. G., et al., Cancer Immunol. Immunother. (1992) 35:19-26. CA215 was denominated Cox-1 in that article.

[0005] In a later paper, authored by the same group, Lee, G., et al., J. Clin. Ligand Assay (2006) 29:47-51, it was reported that treatment with periodate at neutral pH virtually eliminated the immunoreactivity of CA215 in a sandwich assay employing RP215. This led the authors to the conclusion that the epitope of CA215 reactive with RP215 may comprise carbohydrate.

[0006] It appears that the epitope of CA215 recognized by RP215 is present on approximately 60% of all cancers. Further information on its distribution is found in Lee, G., et al., J. Clin. Ligand Assay (2006) supra.

[0007] The '291 patent further describes a method to determine the location of tumors bearing the antigen CA215 by utilizing the antibodies immunoreactive against it to label cells that produce this antigen. Labeling the monoclonal antibodies with various radioisotopes was described as well as conjugating toxins to these antibodies and administration of the antibodies or immunotoxins for therapeutic use.

[0008] The present invention further refines the work described in these publications by demonstrating that the carbohydrate portion of the epitope is located at the variable region of immunoglobulin heavy chain-like molecules, thus making possible compositions which comprise only the relevant portions of CA215 for inclusion in vaccines or for generating and purifying antibodies useful in imaging of targeted cancer cells. This work also demonstrates that there are two forms of CA215--one membrane-bound and another that is secreted.

DISCLOSURE OF THE INVENTION

[0009] The invention is directed to compositions that consist essentially of the epitope region of CA215. This epitope region comprises a carbohydrate and optionally at least a portion of an immunoglobulin heavy-chain like variable region amino acid sequence. This epitope is specifically immunoreactive with RP215 monoclonal antibody, but is not significantly immunoreactive with anti-human IgG.

[0010] In other aspects, the invention relates to the use of the minimal epitope or antiidiotype antibodies that mimic it as active ingredients in therapeutic and prophylactic methods to treat cancer. The epitope and antiidiotype antibodies can also be used as reagents for affinity purification of and for identification of additional monoclonal antibodies useful as diagnostic or therapeutic reagents for cancers.

[0011] In another aspect, the invention relates to improvements in immunoassays for CA215 using an alternative monoclonal antibody directed against this antigen or an antibody that is immunoreactive with IgG as a component in a new sandwich assay.

[0012] In other aspects, the invention relates to improved monoclonal antibodies which are modified forms of RP215, including humanized forms. Humanized forms of RP215 are useful in therapeutic methods, and can be conjugated to additional antineoplastic moieties to improve targeting of such moieties.

[0013] In additional aspects, the invention relates to protocols that take advantage of the dual secreted/membrane-bound nature of the CA215 antigen. In such protocols, diagnosis in body fluids by detection of the secreted form is effected, optionally using the improved assay system of the present invention followed by localization and treatment of solid tumors using the invention antibodies in humanized form optionally coupled to cytotoxic agents for treatment or radioisotopes for localization and/or treatment.

BRIEF DESCRIPTION OF THE DRAWINGS

[0014] FIGS. 1-5 are full ESI-MS spectra of released N-linked glycans from human IgG, RP215 mAb, and three samples of CA215 respectively.

[0015] FIG. 6 shows the effect of washing on the presence of CA215 in membrane-bound form on OC-3-VGH cells.

[0016] FIG. 7 shows the secretion pattern of the OC-3-VGH cell line compared to a hybridoma cell line with respect to the secreted form of CA215.

MODES OF CARRYING OUT THE INVENTION

[0017] The present invention identifies the epitope on CA215 that is immunoreactive with monoclonal antibody RP215 as comprising the carbohydrate portion of this antigen and establishes the identity of the protein portion as a heavy chain immunoglobulin-like molecule, including the immunoglobulins of classes IgG, IgA and IgM. Although some light chain immunoglobulin-like moieties appear to be associated with CA215, they are not present in a 1:1 ratio to heavy chain as in ordinary immunoglobulins and do not bear the carbohydrate-containing epitope associated with the heavy chain-like portion. CA215 exists as undefined aggregates on the cancer cell surface.

[0018] The identification of the epitope recognized by RP215 comprising a carbohydrate not present on immunoglobulins in general and associated with the variable region of a heavy chain immunoglobulin-like molecule permits the production of more sophisticated immunogenic compositions which in turn are useful to inhibit the growth of tumor cells that display CA215 at their surfaces and to generate additional antibodies useful as detection reagents or immunotoxins. As demonstrated in the examples below, using the effective epitope of CA215, which, as stated above, is present on approximately 60% of human cancers, more effective immunogenic compositions can be formulated for cancer prevention and treatment.

[0019] Thus, rather than employ the entire CA215 antigen as a vaccine to slow the progression of cancer already established or to prevent the appearance of detectable amounts of cancer cells that express this antigen, only the portion of CA215 that bears the epitope relevant to detection and treatment need be employed.

[0020] As demonstrated below, the epitope consists essentially of a portion of the antigen which does not immunoreact with anti-human IgG, anti-human IgA, or anti-human IgM. The carbohydrate epitope has a composition distinct from that of these human immunoglobulins and distinct from that of the monoclonal antibody RP215 that immunoreacts with it. The composition of the carbohydrate epitope is approximately 1-3% fucose, 9-15% N-acetyl galactosamine, 27-30% N-acetyl glucosamine, 6-15% glucose, and 47-51% mannose. These are approximate figures, ± at least 1-2% in the latter four cases. The carbohydrate epitope is free of N-acetyl neuraminic acid and N-glycol neuraminic acid.

[0021] The epitope may also comprise at least a small portion of the variable region immunoglobulin heavy chain-like protein to which the carbohydrate is bonded.

[0022] Thus, the purified antigen CA215 has been identified as an immunoglobulin heavy chain-like molecule wherein the epitope portion immunoreactive with RP215 includes the carbohydrate associated with this amino acid sequence. By "immunoglobulin heavy chain-like molecule" is meant a molecule that includes an amino acid sequence that is able to confer immunoreactivity with anti-immunoglobulin antibodies. Thus, in the present case, CA215 is immunoreactive with anti-IgG, anti-IgA, and anti-IgM. The epitope immunoreactive with RP215, however, is not immunoreactive with anti-IgG, anti-IgA or anti-IgM. The amino acid sequence of the protein portion of CA215, thus, is sufficiently homologous with an immunoglobulin heavy chain that immunoreactivity is exhibited with respect to anti-heavy chain immunoglobulin antibodies. CA215 is also immunoreactive with antibodies that recognize immunoglobulin light chain. Thus, more generally, CA215 might be described simply as an immunoglobulin-like molecule.

[0023] The identified epitopes of the invention may be formulated into vaccines for administering to subjects for the treatment and prevention of cancer. Animal model subjects, such as mice, rats, rabbits, guinea pigs, and the like, may be administered such vaccines to optimize the formulation and protocols. Human subjects may be treated with additional therapies such as radiation and chemotherapy along with the immunogenic compositions of the invention.

[0024] Immunohistochemical staining studies of normal and cancerous tissues have demonstrated that the epitope identified herein is present on a number of types of human cancers, with varying levels of staining intensity. The epitope shows very intense staining on human cancers of the ovary, cervix, endometrium, colon, stomach, intestine, esophagus, breast, and lung. As noted herein, the tumor tissues from any particular subject can be evaluated using immunostaining for the presence and level of this epitope, thus providing information useful in the design of suitable vaccines, whether composed of the epitope itself or an antiidiotype antibody that mimics it as further described below.

[0025] In addition, to the use of the epitopes of the invention to generate antibodies endogenously in cancer-bearing subjects, the epitopes may also be used to generate additional antibodies useful in detection and themselves useful in treatment. As used herein, "antibodies" includes complete immunoglobulins as well as immunospecific fragments thereof, such as Fab, Fab₂' and F_v fragments. The antibodies may be monoclonal, prepared by standard and well known techniques and under these circumstances may be manipulated recombinantly to obtain humanized forms, chimeric forms in which the variable region associated with one species is coupled to a constant region associated with another or may be single-chain antibodies. Techniques for manipulation of monoclonal antibodies using the tools of recombinant production are well established. The epitopes of the invention may also be used as purification and identification tools for suitable antibodies.

[0026] In any of the immunogenic compositions, whether for the purpose of preparing monoclonal or polyclonal antibodies for diagnostic use or as a vaccine formulation, suitable adjuvants may be included in the composition, such as Freund's incomplete adjuvant, alum, and a multiplicity of other adjuvants well known in the art. In addition, the epitope may be coupled to additional moieties such as KLH or tetanus toxoid in order to enhance its immunogenicity. Thus, fusion proteins of the epitopes of the invention with additional heterologous protein are included in the scope of the invention.

[0027] The antibodies generated in response to the defined epitopes of the present invention can be labeled with radioisotopes, fluorophores, and in the case of in vitro assays, enzymes, and used to detect the presence of cancer cells. They may also be coupled to toxins for use in therapy.

[0028] In addition to the use of the defined epitope of the invention to prepare immunogenic formulations, antiidiotype antibodies which mimic this epitope may be isolated from subjects immunized with RP215 or immunogens that recognize the same epitope as does RP215. Antiidiotype monoclonal antibodies are obtained by immunizing mice or other suitable subjects with purified RP215 mAb or its Fab fragments (or with its humanized form) to elicit an antiidiotypic response against epitopes in the variable region. For example, BALB/C mice may be used. Conventional preparation of monoclonal antibodies by cell fusion and screening using RP215 or its Fab fragments or other moieties that recognize the epitope of the invention will identify monoclonal antibodies that are antiidiotypes. These antiidiotype mAb's then can serve as immunogens to elicit antibodies in subjects to target cancer cells. Thus, the antiidiotype antibodies can be substituted for the CA215 epitope as cancer therapy and in other applications.

[0029] Suitable formulations for the defined epitope of the invention are those conventional for immunogenic compositions and are found, for example, in Remington's Pharmaceutical Sciences, latest edition, Mack Publishing Co., Easton, Pa., incorporated herein by reference. Protocols for administration are dependent on the nature of the condition, the judgment of the attending physician, and the severity of the malignancy. Optimization of such protocols on a group or individual basis is well within ordinary skill.

[0030] The identification of the CA215 epitope as residing on an immunoglobulin-like moiety has led to improvements in immunoassays for this antigen. Previously, monoclonal RP215 has been used as both members of the "sandwich" employed in standard immunoassays using a variety of labels for detection, including enzymes, radioisotopes and fluorescent molecules. This was possible because CA215 commonly exists in polymeric form and multiple copies of the same epitope are available. An improved form of the assay, however, employs, as one member of the sandwich, antibodies immunoreactive with human immunoglobulin, preferably IgG, so that monomeric forms of CA215 may also be detected.

[0031] Improvements are also contemplated in the structure of RP215 through manipulation of the nucleotide sequence encoding the variable region. Thus, RP215 may be humanized or otherwise modified to improve its immunospecificity. The humanized form of this antibody is particularly useful in therapeutic applications. Such humanized forms may be complete immunoglobulins, or may include only variable regions, such as Fab or Fab₂' portions or may be single chain F_v antibodies produced recombinantly. Any immunospecific portion of RP215 may be modified so as not to raise an immune response in human subjects.

[0032] Such antibodies or fragments or modified forms may be coupled to additional biologically active moieties, such as antineoplastic agents including immunoglobulins or fragments thereof immunoreactive with undesirable growth factors. In these conjugates, the RP215 serves as a targeting agent, as well as an anti-tumor factor per se. Thus, these forms of RP215 may be coupled to antineoplastic agents, such as paclitaxel, rapamycin or fumagillin or to moieties that are inhibitors of growth factors or their receptors, such as anti-GNRH receptor, anti-EGF, anti-EGFR, anti-VEGF, anti-VEGFR, and the like.

[0033] As used herein, "antineoplastic agent" includes small molecules, such as those set forth above, as well as antibodies or fragments thereof directed against growth factors or the receptors for such growth factors. Thus "anti-growth factor" or "anti-growth factor receptor" refers to immunoglobulins or fragments thereof that are immunoreactive with these moieties.

[0034] In the improved protocols of the present invention, an initial step is diagnosis of the presence of malignancies characterized by epithelial cells by virtue of the presence of CA215 antigen in body fluids. Such fluids include sera, plasma, blood, urine, saliva, and the like. The detection can be performed using RP215 or the modified forms thereof described above. The modified assay of the invention may also be used.

[0035] Once a diagnosis is made, the location of the tumor may be ascertained by obtaining an image by injection, in the case of humans, of the humanized form of RP215 coupled to an imageable label, such as a radioisotope, fluorescent dye, or luminescent system. Fluorescent proteins may be employed as fusion proteins or otherwise linked to the antibodies. In addition, the antibodies may be used as targeting agents for cytotoxic agents for the treatment of these solid tumors.

[0036] The following examples are offered to illustrate but not to limit the invention.

EXAMPLE 1

Characterization of CA215 as an Immunoglobulin-Like Molecule in Both Secreted and Membrane-Bound Forms with an Epitope Comprising a Carbohydrate

[0037] In this example, the immunoglobulin-like nature of CA215 was confirmed and it was demonstrated that this cancer-associated antigen is produced simultaneously in both secreted and membrane-bound forms with differing molecular weights. In addition, the epitope of CA215 which is immunoreactive with RP215 comprises a carbohydrate moiety.

[0038] CA215 was purified from the shed medium of cultured OC-3-VGH cancer cells using the methods described in U.S. Pat. No. 5,650,291 cited and incorporated by reference above.

[0039] NH₂-terminal amino acid sequence analysis of purified CA215 gave a sequence identical to that of normal human IgG (VELVESGA) (SEQ ID NO:1).

[0040] The immunoglobulin nature of CA215 was confirmed by Western blot assays. CA215 proteins were separated by, and transferred to, nitrocellulose membrane strips from SDS-PAGE of either OC-3-VGH cancer cell extract, shed medium, or affinity-purified CA215.

[0041] After direct incubation with enzyme-labeled RP215 or with alkaline phosphatase (ALP) labeled anti-human IgG, the nitrocellulose strips were incubated with substrates (Bio-Rad Labs) for color detection of protein bands. Indirect binding assays with nitrocellulose membrane strips were also performed using unlabeled RP215 or unlabeled anti-human Ig as primary antibody and enzyme labeled goat anti-mouse IgG or rabbit anti-goat IgG as second antibodies. The results of these extensive studies are summarized in Table 1.

TABLE-US-00002 TABLE 1 Western blot assays using various antibody probes to reveal molecular weight(s) of detected protein bands on nitrocellulose strips which were derived from those of cancer cell extract, cultured shed medium or purified CA215. Source of Molecular wt of Relative Primary nitrocellulose protein band(s) Staining Antibody Secondary Antibody strips detected (kDa) Intensity RP215-HRP^a -- OC-3-VGH 55 + cancer cell Anti-human -- purified CA215 60 ++ IgG (Mab) 25 + RP215 (Mab) goat anti-mouse IgG-ALP^a OC-3-VGH 53-70 +++ cancer cell (broad) goat anti-mouse IgG-ALP cultured shed 50-54 + medium goat anti-mouse IgG-ALP purified CA215 50-52 ++ goat anti-mouse IgG-ALP purified CA215 after 50-60 ++ pepsin treatment 24 + Anti-human goat anti-mouse IgG-ALP OC-3-VGH 55-70 +++ IgG (Mab) cancer cell 28 ++ goat anti-mouse IgG-ALP purified CA215 52-60 ++ Anti-human goat anti-mouse IgG-ALP OC-3-VGH 57-70 ++ IgA (Mab) cancer cell (broad) Anti-human goat anti-mouse IgG-ALP OC-3-VGH 53-70 ++ IgM (Mab) cancer cell (broad) Anti-human goat anti-mouse IgG-ALP OC-3-VGH 46-53 ++ Ig light κ cancer cell (weak) chain (Mab) 20-27 + Anti-human goat anti-mouse IgG-ALP OC-3-VGH 56 ++ light λ chain cancer cell (weak) (Mab) 23-32 + ^aHRP-horseradish peroxidase ALP-alkaline phosphatase

[0042] Both direct and indirect Western Blot assays using RP215 for detection give the same protein band patterns regardless of whether the protein was cellular extract, shed medium or affinity purified CA215. A strong, broad protein band was observed at molecular weight of 60 kDa and a minor protein band was also detected at 90 kDa.

[0043] Anti-human IgG monoclonal antibody (γ-chain-specific) also gave broad protein band(s) of 60 kDa either in a direct assay with ALP-labeled goat anti-human IgG, or in an indirect assay using this antibody as a secondary marker. Anti-human IgG lambda and kappa light chain monoclonal antibodies, also recognize protein band(s) of lower molecular weight (25-30 kDa), although with a much lower staining intensity. Anti-human IgA and IgM monoclonal antibodies recognize the protein bands with similar molecular size of 60 kDa similar to those recognized by RP215 monoclonal antibody.

[0044] As shown, the relative concentration of cancer cell-derived IgG is significantly higher than that of human IgA or human IgM (≦5-10% of IgG). Western blot of affinity purified CA215 before and after pepsin digestion showed that after pepsin digestion, the remaining Fab fragment(s) of CA215 can be detected at low molecular range (˜30 kDa) by RP215 monoclonal antibody.

[0045] More direct evidence that CA215 in cancer cells cross-reacts with human IgG, human IgA or human IgM, and that unique epitope(s) recognized by RP215 exist in these cancer cell-derived immunoglobulin-like molecules was obtained as follows: Monoclonal anti-human IgG (Cox-100)*, anti-human IgA and anti-human IgM were coated separately on microwells according to standard procedures. Shed medium from OC-3-VGH cells was added to the wells and RP215-HRP was used as the detecting antibody. The sandwich immunoassays were performed in one-step at room temperature overnight with 1/200 RP215-HRP+10 ug/ml normal mouse IgG. * Cox-100 is a monoclonal antibody obtained by immunizing mice with purified CA215, harvesting the spleens, performing cell fusion and screening using standard techniques for preparation of monoclonal antibody. Cox-100 reacts with CA215, and crossreacts with human IgG.

[0046] The results of this assay in Table 2 demonstrate the presence of human immunoglobulin-like molecules in cultured shed media of OC3-VGH cancer cells with various antibodies to human immunoglobulin molecules. ODs is the OD value of sample and ODn is the OD value of negative control (culture medium).

TABLE-US-00003 TABLE 2 Coating Abs/Ag Capturing Ab ODs₆₅₀/ODn₆₅₀ Cox 100 RP215-HRP 13.6 (anti-hIgG Mab) Anti-hIgA Mab RP215-HRP 1.7 Anti-hIgM Mab RP215-HRP 2.2

[0047] Additional data were obtained to demonstrate direct binding between various anti-immunoglobulin antibodies to CA215 present in OC-3-VGH cancer cells as shown in Table 3A. In this case the experiment was conducted as a secondary two-step ELISA with primary antibodies incubated with sample overnight at room temperature, followed by goat antibody Anti-Mouse IgG-ALP, for 1 hour at 37° C. ODs is the OD value of sample and ODn is the OD value of corresponding normal mouse IgG concentration.

Table 3

TABLE-US-00004 [0048] TABLE 3A Capturing Ab ODs₄₀₅/ODn₄₀₅ 1.25 ug/ml 9.1 Anti-hIgG₂ mAb 2.50 ug/ml 1.4 Anti-hIgG₃ mAb 1.125 ug/ml 12.9 Cox-100 1.125 ug/ml 11.6 RP-215 5.00 ug/ml 1.5 Anti-hKappa Mab 5.00 ug/ml 2.8 Anti-hLamda Mab

[0049] Further evidence that CA215 is an immunoglobulin-like molecule mimicking the heavy chain of IgG was obtained using homology analysis. Table 3B shows the results obtained by MALDI-TOF MS system analysis.

TABLE-US-00005 TABLE 3B Amino Acid Sequence Homology Analysis of Tryptic Peptides of CA215 determined by MALDI-TOF MS SEQ ID Peptide Fragments NO: Sequence Homology (%) 1. K.DVLTITLTPK.V 2 immunoglobulin heavy chain variable region (66%) 2. K.APQVYTIPPK.E 3 immunoglobulin gamma heavy chain 3 (87%) 3. R.VNSAAFPAPIEK.T 4 immunoglobulin gamma heavy chain 3 (88%) 4. K.APQVYTIPPKEQMAK.D 5 Ig gamma-3 chain C region (Heavy chain disease protein) (62%) 5. R.SVSELPIMHQDWLNGK.E 6 immunoglobulin heavy chain (72%) 6. K.NTQPIMDTDGSYFVYSK.L 7 immunoglobulin gamma-1 heavy chain constant region (61%) 7. K.SSGTSYPDVLK.C 8 immunoglobulin heavy chain variable region (64%) 8. K.VCNYVSWIK.Q 9 immunoglobulin heavy chain (75%) 9. RTLYLQMNSLR 10 immunoglobulin heavy chain variable region (100%) 10. SLVVAAVAPDNRNPAFTTM 11 immunoglobulin heavy chain variable region (70%) GWLFLK 11. GDRVTITWR 12 immunoglobulin heavy chain variable region (88%) 12. GLSDSVRSCR 13 immunoglobulin heavy chain variable region (75%) 13. TAKGSTGMEILLSTLENTK 14 immunoglobulin heavy chain variable region VH (61%) 14. KVTCVVVDISKD 15 immunoglobulin heavy chain (88%) 15. GPLCGCCPGRSSQK 16 immunoglobulin variable region (43%) 16. AELGGLLSPR 17 immunoglobulin heavy-chain subgroup VIII V-D-J region (85%) 17. DGSISILGSDDATTCHIVVLR 18 immunoglobulin heavy chain variable region (100% - 7/7) 18. RTLYLQMNSLR 19 immunoglobulin heavy chain variable region (100%) 19. KCELNCQAMGYR 20 immunoglobulin gamma chain, V region (85%) 20. LSGSCRSTDSLHPCPPTALPR 21 immunoglobulin heavy chain variable region (33%) 21. APTVVLMMTK 22 immunoglobulin heavy chain variable region (85% - 5/6) 22. ATSRGCITIIGGGDTATCCAK 23 immunoglobulin heavy chain variable region (69% - 9/13) 23. MSTRYHQAASDSYLELIK 24 immunoglobulin heavy chain variable region (87% - 7/8) 24. SLPGSPKDSSHLLSPLR 25 Ig heavy chain (VH4) V region (VDJ) 25. GGNSGGSSSICYVLLGFIGTS 26 immunoglobulin heavy chain VJH1 region (77%) K 26. AEDTAVYYCAKTLTIR 27 immunoglobulin heavy chain variable region (100%) 27. GLECIGYMYSSGSSFYNPSL 28 immunoglobulin heavy chain variable region (100%) KSR 28. MAYLQQTLAGPSGTR 29 immunoglobulin heavy chain variable region (88% - 8/9) 29. KGHQDSCPFELTACPNEGCT 30 Ig heavy chain variable region (75% - 6/8) SQVPR 30. GLEWVSAVSGSGTTTYYAD 31 immunoglobulin heavy chain variable region (91%) SVK 31. LSSVTAADTNVYYCAR 32 immunoglobulin heavy chain VHDJ region (93%) 32. AETLVFSTHAVISMR 33 immunoglobulin heavy chain variable region (70% - 7/10)

[0050] Thus, sequences contained in CA215 are homologous to sequences in human immunoglobulin heavy chain.

[0051] In Table 3C, partial amino acid sequences of CA215 were mapped with the known sequences of human immunoglobulin heavy chains of several other cancer cells or tissues reported previously. It is now clearly established that CA215 is not a single well-defined molecule, but a mixture of numerous human immunoglobulin heavy chain molecules (e.g., IgG, IgA, IgM and numerous variations in the V regions). A unique character in these immunoglobulin mixtures is the existence of specific carbohydrate-associated epitope that can be commonly recognized by RP215 monoclonal antibody.

TABLE-US-00006 TABLE 3C Comparisons of Partial Amino Acid Sequences of CA215 Deduced from MALDI-TOF MS with Those of Known Human Ig Heavy Chain from Cancer Cells SEQ ID SEQ ID FR1 NO: CDR1 NO: T47D (IgG) EVQLVESGGGLVQPGGSLRLSCAASRFSSR 34 TSGMR 35 ZR75-1 (IgM) EVQLVQSGAEVKKPGESLKISCKGSGYSFT 36 SYWIG 37 ZR75-1 (IgG) EVQLLESGGGLVQPGGSLRLSCTASGFNFN 38 TYAMT 39 SKBR3 (IgG) QVQLQESGPGLVKPSQTLSLTCTVSGGSVS 40 SGYYYWS 41 SKBR3 (IgA) EVQLVESGGGLVQPGGSLTLSCAVSGLSFS 42 SSGMN 43 MDA-MB-231 (IgM) EVQLVESGGGLVQPGGSLRLSCAASGFTFS 44 SYWMD 45 LUNG CANCER EVQLEESGAEVKKPGESLKISCEASGYTFG 46 TYWIG 47 CA215 KSSGTSYPDVLKCKVCN----- 48 YVSW 49 (SLVVAAVAPDNRNPAFT?) 50 (TMG?) (ATSRGCITIIGGGDTATCCAK?) 51 (MAYLQQTLAGPSGTR?) 52 SEQ ID SEQ ID FR2 NO: CDR2 NO: T47D (IgG) WVRQAPGKELEVA 53 PFWNGGSQKYCADSVT 54 ZR75-1 (IgM) WVRQMPGKGLEWMG 55 I IYPGDSDTRYSPSFQG 56 ZR75-1 (IGG) WVRQAPGKGLEWVS 57 T IAADGTWTSNADFVRG 58 SKBR3 (IgG) RIRQHPGKGLEWIG 59 YIYYNGSTYENPSLKS 60 SKBR3 (IgA) WVRQASGKGLEWVG 61 RIGSKAASDTTSYAASVRG 62 MDA-MB-231(IgM) WVRQVPGKGLVWVS 63 RISPDGRTTTYADSVEG 64 LUNG CANCER WVRQMPGKGLEWMG 65 IIYPGDSDTTYSPSFRG 66 CA215 IKQ--------GLEWVS 67 AVSGSGTTTYYADSVK 68 (WLFLK?) 69 YMYSSGSSFYNPSLKSR?)G 71 (GLECIG 70 SEQ SEQ ID ID FR3 NO: CDR3 NO: T47D (IgG) GRFTFSETFLRPCSLCKCTVNLRARPS I PAP 72 GITVPHPRLCPRN 73 ZR75-1 (IgM) QVTISADKSISTAYLQWSSLKASDTAMYYCAR 74 QEIVAFS 75 ZR75-1 (IgG) RLTISRDNSRNTLYLQMNSLRAEDTAIYFCAK 76 DWYDY 77 SKBR3 (IgG) RASISVDTSKNQFSLKLSSVTAADTAVYYCAR 78 DIKHTYGPN 79 SKBR3 (IgA) RFFISRDDSKKTVYLQMNSLKTEDTAVYYCSR 80 QGCGGDCHIPKM 81 MDA-MB- RFTISRDNAKNTLYLQMNSLRAEDTAVYYCAG 82 GYLSSH 83 231 (IgM) LUNG QVTLSVDKFINTAYLQWDSLKASDTAIYYCAR 84 WDVMIGFYTA 85 CANCER CA215 DRVTITWR RTLYLQMNSLRAEDTAVYYCAK 86 TLTIR 87 (LSSVTAADTNVYYCAR?) 88 (MAYLQQTLAGPSGTR?) 89 JH SEQ ID CH SEQ ID NO: NO: T47D (IgG) YFDSGQGTLVTVSS 90 ASTKGPSVFPL 91 ZR75-1 (IgM) YYYMDVWGKGTTVTVSS 92 GSASPQPFSPS 93 ZR75-1 (IgG) WGQGTLVTALL 94 TVSTGLHQGPIGLPP 95 SKBR3 (IgG) YNCYMDVWGKGTTVTVSS 96 GLHQGPIGLPP 97 SKBR3 (IgA) YYYYGMDVWGQGTTVTVSS 98 ASPTSPKVF 99 MDA-MB-231 DYWGRGTLVTVSS 100 GECIRPNPFPP 101 (IgM) LUNG DYWGQGTQVTVS 102 SASTKGPSVFPLAPSSKSTSGGT 103 CANCER AVLGCLV KDYFPEPVTV 104 CA215 TAKGSTGMEILL STLENTK (?) 105 CA215 (constant region) -----GNSGGSSSICYVLLGFIGTSKLSGSCRSTDSLHPCPPTALPRAELGGLLSPRKDVLTITLTPKVTCVVV- DISKDRSVSELPIMHQDWLNGKERVNSAAFPAPIEKTKAPQVYTIPPKEQMAKD--------KGHQDSCPFELT- ACPNEGCTSQVPRKNIQPIMDTDGSYFVYSKL (SEQ ID NO: 106) Note: The following sequences cannot be mapped due to microheterogeneity: 1. GPLCGCCPGRSSQK (SEQ ID NO: 107); 2. APTVVLMMTK (SEQ ID NO:108); 3. 3MSTRYHQAASDSYLELIK (SEQ ID NO:109); 4. SLPGSPKDSSHLLSPLR (SEQ ID NO: 110).

[0052] In Table 3D, comparisons of amino acid sequences of CA215 in the constant region deduced from MALDI-TOF MS and RT-PCR are presented together with that of anti-human colon carcinoma heavy chain from the GenBank.

TABLE-US-00007 TABLE 3D Comparisons of amino Acid Sequences in the Constant Region among those of CA215 deduced from RT-PCR and MALDI-TOF MS as well as those from Anti-human Colon Carcinoma Heavy Chain (AHCCHC gbIAAB28159.1|) (SEQ ID NOS: 111-113) AHCCHC PKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQF CA215 by MALDI-TOF MS KDVLTITLTPKVTCVVVDISKD..................................... LSTLE CA215 by RT-PCR .......................................... VEVHNAKTKPREEQF AHCCHC NSTFRSVSE LP I MHQDWLNGKEFKCRVNSAAFPAPIEKTISK TKG--------- CA215 by MALDI-TOF MS N -TKRSVSE LP I MHQDWENGKE..... RVNSAAFPAPIEKT........... CA215 by RT-PCR NSTYRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGGTRGC AHCCHC -------------------------------------------------------RPKAPQVYT IPPPKEQMAKDKV CA215 by MALDI-TOF MS ........................................................KAPQVYT IPP -KEQMAKDKV CA215 by RT-PCR EGHMDRGQLGPPSALGVTAVPTSVPTGQPREPQVYTLPPSREEMTKNQV AHCCHC SLTCMI TDEFPEDITVEWQWNGQPAENYKNIQPIMDTDGSYFVYSKL CA215 by MALDI-TOF MS --- TCVVVD- ISKD... ........................KNTQPIMDTDGSYFVYSKL CA215 by RT-PCR SLTCLVKGFYPSDIAVEWE SNGQPENNYK TT

[0053] The carbohydrate portion of CA215 was analyzed following verification of results demonstrating the ability of periodate to destroy the immunoreactivity of this antigen in a sandwich assay, thus establishing the presence of carbohydrate in the epitope. Verification was performed as follows:

[0054] PBS-washed OC-3-VGH cancer cells (conc. 1×10⁶ cells/ml) were incubated with 100 mM NaIO₄ for 30 minutes, the cells were washed with PBS containing 0.5% BSA, and then dried on microwells at 1×10⁴ cells/well. The cell-coated microwells were then blocked with 0.5% BSA in PBS and direct binding enzyme immunoassays using RP215 labeled with horseradish peroxidase (RP215-HRP) were performed at 37° C. for one hour followed by extensive washes and color development with TMB substrate. For comparison wells coated with cancer cells without NaIO₄ treatments served as control. The binding between RP215-HRP and cancer cell-coated wells treated with periodate was drastically reduced. In addition, the presence of 10 to 100 μg/ml goat anti-human IgG reduced the binding to RP215-HRP to the wells coated with cancer cells in a dose-dependent manner, indicating that goat anti-human IgG competes with RP215-HRP to bind the complete CA215 antigen. The results of this study are summarized in Table 4.

TABLE-US-00008 TABLE 4 Direct binding assays to reveal the effect of NaIO₄ treatment to OC-3-VGH cancer-cells on the binding of RP215-HRP to the cancer cell-coated wells as well as its binding inhibition in the presence of goat anti-human IgG Optical Density at 450 nm Without With Assay Conditions NaIO₄ treatment NaIO₄ treatment RP215-HRP (10 ug/ml) + 2.153 (100%)^a 0.797 (37%) normal mouse IgG (10 ug/ml) RP215-HRP (10 ug/ml) + normal mouse IgG (10 ug/ml) + 0.961 (45%) 0.333 (15%) goat anti-human IgG (20 ug/ml) RP215-HRP (10 ug/ml) + normal mouse IgG (10 ug/ml) + 0.471 (22%) 0.252 (12%) goat anti-human IgG (50 ug/ml) RP215-HRP (10 ug/ml) + normal mouse IgG (10 ug/ml) + 0.163 (8%) 0.158 (7%) goat anti-human IgG (100 ug/ml) ^apercent maximum binding

[0055] The presence of both secreted and membrane-bound forms of CA215 in OC-3-VGH cells was further confirmed as shown in Table 5 below, and in FIGS. 6 and 7. Table 5 shows the results of Western blot when the strips treated with detection reagents either contained immobilized OC-3-VGH whole cells, OC-3-VGH culture medium or purified antigen. As shown, regardless of the detection method, the purified antigen produced a result at only 54-55 kD molecular weight, as did the culture medium. However, the whole cells showed results at molecular weights of both 50-56 and 68-73 kD. In Table 5, N/A represents "not applicable" and ND represents "not done."

TABLE-US-00009 TABLE 5 Western Blot of OC-3-VGH cells, Culture Medium and Purified CA215 with RP215 and Anti-Human IgG Probes Under Reducing Conditions Molecular weight of detected bands from various Western sources of nitrocellulose strips (KDa) Blot Conditions OC-3-VGH OC-3-VGH Purified Primary Secondary whole culture medium CA215 Antibody Antibody cell strips strips strips RP215 GAMIgG- 56/68 55 55 ALP MAHIgG GAMIgG- 55-73 55 54 ALP (broad) MAHIgA- N/A 50 ND ND ALP MAHIgM- N/A 70 ND ND ALP

[0056] FIG. 6 shows the result of consecutive PBS washes on the fraction of binding of RP215 to OC-3-VGH cells. As shown, even after five consecutive washes, no appreciable change in the fraction binding the cells occurs. These results were obtained on isolated OC-3-VGH cells not in culture.

[0057] This is in contrast with the results in FIG. 7 which show that when culture medium is assessed from either OC-3-VGH cells or a comparable standard hybridoma secretion system, similar patterns of secretion are obtained based on absorbance at 450 nm using the HRP detection system.

[0058] Thus, the secreted and membrane-bound forms appear to be produced simultaneously and have differing molecular weights. The secreted form has a molecular weight of approximately 55 kD and the membrane-bound form has a molecular weight of approximately 73 kD.

EXAMPLE 2

Carbohydrate Composition of Affinity-Purified CA215

[0059] The carbohydrate composition of CA215 was analyzed through a contract service by Complex Carbohydrate Research Center (Athens, Ga., USA). For comparison, composition analyses of normal human IgG, and RP215 monoclonal antibody were also performed.

[0060] The results of this comparative carbohydrate composition analysis are summarized in Table 6. The values of glucose were not determined because glucose was identified as a major contaminant and thus not susceptible to accurate measurement.

TABLE-US-00010 TABLE 6 Neutral and Amino Sugar Composition (excluding glucose) Sample ID Types of Amino-/Sugar nmoles/μg Molar % Human IgG- Fucose 0.0077 7.93 Salt free N-acetyl-galactosamine 0.0068 6.99 N-acetyl-glucosamine 0.0394 40.72 Galactose 0.0053 5.46 Glucose ND ND Mannose 0.0376 38.90 N-acetyl-neuraminic acid 0.0000 0.00 N-glycol-neuraminic acid 0.0000 0.00 Total: 0.0967 100.0 RP215 Mab- Fucose 0.0085 5.03 Salt free N-acetyl-galactosamine 0.0000 0.00 N-acetyl-glucosamine 0.0762 45.16 Galactose 0.0076 4.48 Glucose ND ND Mannose 0.0765 45.33 N-acetyl-neuraminic acid 0.0000 0.00 N-glycol-neuraminic acid 0.0000 0.00 Total: 0.1688 100.0 CA215 Fucose 0.0018 1.10 Lot No. 070305 A N-acetyl-galactosamine 0.0154 9.45 N-acetyl-glucosamine 0.0442 27.05 Galactose 0.0229 14.05 Glucose ND ND Mannose 0.0789 48.35 N-acetyl-neuraminic acid 0.0000 0.00 N-glycol-neuraminic acid 0.0000 0.00 Total: 0.1633 100.0 CA215 Fucose 0.0018 2.46 Lot No. 070305 B N-acetyl-galactosamine 0.0095 13.04 N-acetyl-glucosamine 0.0208 28.40 Galactose 0.0042 5.68 Glucose ND ND Mannose 0.0369 50.41 N-acetyl-neuraminic acid 0.0000 0.00 N-glycol-neuraminic acid 0.0000 0.00 Total: 0.0731 100.0

[0061] Normal human IgG and RP215 (mouse IgG) have similar carbohydrate compositions, though human Ig contains N-acetyl galactosamine, which is absent from RP215. CA215 exhibits different sugar content from either normal human or mouse IgG. CA215 contains lower percentage of N-acetylglucosamine (27-28% vs. 40-45%) but a significantly higher amount of mannose (48-50% vs. 38-45%).

EXAMPLE 3

N-Linked and O-Linked Oligosaccharide Profiling

[0062] In addition to overall carbohydrate content, the structures of N-linked glycans associated with human IgG, RP215, and CA215 were determined by electrospray ionization mass spectrometry (ESI-MS).

[0063] In carrying out this determination, the samples were dissolved in 1 mL of nanopure water. Eight hundred microliters of each of human IgG, RP215 mAb, and CA215 sample B, 900 μL of CA215 sample A and all of CA215 sample C were pipetted into screw-cap tubes and lyophilized The dried samples were dissolved with 100 μL ammonium bicarbonate buffer (50 mM, pH 8.4) and followed immediately by reduction with 25 mM dithiothreitol (45 min at 50° C.) and carboxyamidomethylation with 90 mM iodoacetamide (45 mM at room temperature in the dark) prior to trypsin digestion (37° C., overnight). A second enzyme, peptide N-glycosidase F (New England BioLabs) was added to each of the tryptic digests and incubated at 37° C. for 18 hours to release the N-linked glycans. After enzymatic digestions, the samples were passed through a C18 reversed phase cartridge. The N-linked glycans from each sample were eluted with 5% acetic acid and then lyophilized

[0064] The lyophilized N-linked fraction of each sample was dissolved in dimethylsulfoxide and then methylated with NaOH and methyl iodide. The reaction was quenched by addition of water, and per-O-methylated carbohydrates were extracted with dichloromethane. The organic phase was concentrated to dryness and then dissolved with methanol for glycan structural analysis.

[0065] The profiles of N-linked glycans from all five samples were analyzed by electrospray ionization mass spectrometry (ESI-MS) using an LCQ-MS (Thermo Finnigan) quadrupole ion trap. Each sample (˜5 pmol/μL) was infused directly into the instrument at a constant flow rate of 1 μL/min via a syringe pump (Harvard Apparatus) and sprayed at 3.5 kV. A normalized collision energy of 35 and an isolation mass window of 2 Da was applied to obtain MSn.

[0066] The results are shown in Tables 7-10 and FIGS. 1-5. No table is provided for CA215 sample C, as apparently the sample was too small and defined peaks could not be obtained. In Tables 9 and 10, the highlighted areas represent structures that are found in CA215, but not in IgG or RP215.

[0067] In addition, it appears that sialic acids were not detected, again, possibly due to low sample size.

TABLE-US-00011 TABLE 7 Profile of N-linked glycans of human IgG by ESI-MS Observed Mass{M + Na} Charge state Proposed Structure Structure 1032 double GlcNAc₄Man₃Hex₁Fuc₁ ##STR00001## 1134 double GlcNAc₄Man₃Hex₂Fuc₁ ##STR00002## 1228 double GlcNAc₄Man₃Hex₂NeuAc₁ ##STR00003## 1257 double GlcNAc₅Man₃Hex₂Fuc₁ ##STR00004## 1315 double GlcNAc₄Man₃Hex₂Fuc₁NeuAc₁ ##STR00005## 1350 double GlcNAc₅Man₃Hex₂NeuAc₁ ##STR00006## 1408 double GlcNAc₄Man₃Hex₂NeuAc₂ ##STR00007## 1437 double GlcNAc₅Man₃Hex₂Fuc₁NeuAc₁ ##STR00008## 1495 double GlcNAc₄Man₃Hex₂Fuc₁NeuAc₂ ##STR00009## 1618 double GlcNAc₅Man₃Hex₂Fuc₁NeuAc₂ ##STR00010## 1836 single GlcNAc₄Man₃Fuc₁ ##STR00011## 1866 single GlcNAc₄Man₃Hex₁ ##STR00012## 1907 single GlcNAc₅Man₃ ##STR00013## Legend: ##STR00014## ##STR00015## ##STR00016## ##STR00017## ##STR00018##

TABLE-US-00012 TABLE 8 Profile of N-linked glycans of RP 215 Mab by ESI-MS Observed Mass {M + Na} Charge state Proposed Structure Structure 1032 double GlcNAc₄Man₃Hex₁Fuc₁ ##STR00019## 1134 double GlcNAc₄Man₃Hex₂Fuc₁ ##STR00020## 1242 double GlcNAc₄Man₃Hex₂NeuGc₁ ##STR00021## 1314 double GlcNAc₄Man₃Hex₂Fuc₁NeuAc₁ ##STR00022## 1453 double GlcNAc₅Man₃Hex₂Fuc₁NeuGc₁ ##STR00023## 1417 single GlcNAc₃Man₃ ##STR00024## 1663 single GlcNAc₄Man₃ ##STR00025## 1836 single GlcNAc₄Man₃Fuc₁ ##STR00026## 1866 single GlcNAc₄Man₃Hex₁ ##STR00027## Legend: ##STR00028## ##STR00029## ##STR00030## ##STR00031## ##STR00032## ##STR00033##

TABLE-US-00013 TABLE 9 Profile of N-linked glycans of CA215 Sample A by ESI-MS Observed Mass {M + Na} Charge state Proposed Structure Structure 1047 double GlcNAc₄Man₃Hex₂ ##STR00034## 1172 single GlcNAc₂Man₃ ##STR00035## 1228 double GlcNAc₄Man₃Hex₂NeuAc₁ ##STR00036## 1243 double GlcNAc₄Man₃Hex₂NeuGc₁ ##STR00037## 1330 double GlcNAc₄Man₃Hex₂Fuc₁NeuGc₁ ##STR00038## 1452 double GlcNAc₅Man₃Hex₃NeuAc₁ ##STR00039## 1467 double GlcNAc₅Man₃Hex₃NeuGc₁ ##STR00040## 1418 single GlcNAc₃Man₃ ##STR00041## 1621 single GlcNAc₃Man₃Hex₁ ##STR00042## 1663 single GlcNAc₄Man₃ ##STR00043## 1836 single GlcNAc₄Man₃Fuc₁ ##STR00044## 1866 single GlcNAc₄Man₃Hex₁ ##STR00045## 1907 single GlcNAc₅Man₃ ##STR00046## Legend: ##STR00047## ##STR00048## ##STR00049## ##STR00050## ##STR00051## ##STR00052##

TABLE-US-00014 TABLE 10 Profile of N-linked glycans of CA215 Sample B by ESI-MS Observed Mass {M + Na} Charge state Proposed Structure Structure 1047 double GlcNAc₄Man₃Hex₂ ##STR00053## 1134 double GlcNAc₄Man₃Hex₂Fuc₁ ##STR00054## 1169 double GlcNAc₅Man₃Hex₂ ##STR00055## 1228 double GlcNAc₄Man₃Hex₂NeuAc₁ ##STR00056## 1242 double GlcNAc₄Man₃Hex₂NeuGc₁ ##STR00057## 1315 double GlcNAc₄Man₃Hex₂Fuc₁NeuAc₁ ##STR00058## 1330 double GlcNAc₄Man₃Hex₂Fuc₁NeuGc₁ ##STR00059## 1366 double GlcNAc₅Man₃Hex₂NeuGc₁ ##STR00060## 1438 double GlcNAc₄Man₃Hex₂NeuGc₂ ##STR00061## 1525 double GlcNAc₄Man₃Hex₂Fuc₁NeuGc₂ ##STR00062## 1580 single GlcNAc₂Man₅ ##STR00063## 1663 single GlcNAc₄Man₃ ##STR00064## 1785 single GlcNAc₂Man₆ ##STR00065## 1837 single GlcNAc₄Man₃Fuc₁ ##STR00066## 1907 single GlcNAc₅Man₃ ##STR00067## Legend: ##STR00068## ##STR00069## ##STR00070## ##STR00071## ##STR00072## ##STR00073##

[0068] Generally, in both human IgG and RP215, the major ion detected has a glycosylated structure (N/Z 1836). Although this was also detected in the CA215 samples, the signal was not as dominating as in human IgG and RP215. Other fucosylated and sialylated glycans were detected in all samples.

[0069] In addition, the O-linked sugar content of these materials was also determined with the results shown in Table 11.

TABLE-US-00015 TABLE 11 Monosaccharide Composition of O-glycans Analyzed by HPAEC. Molar Sample name Analyte nmoles percentage Human IgG-Sigma Fucose 0.0702 4.1 N-acetyl-galactosamine 0.3360 19.7 N-acetyl-glucosamine 0.7958 46.8 Galactose 0.3717 21.8 Glucose nd nd Mannose nd nd N-acetyl-neuraminic acid 0.1276 7.6 N-glycol-neuraminic acid nd nd Total 1.7013 100.0 RP215 Mab #070801-A Fucose 0.0692 6.2 N-acetyl-galactosamine 0.2004 18.1 N-acetyl-glucosamine 0.3569 32.2 Galactose 0.3475 31.4 Glucose nd nd Mannose nd nd N-acetyl-neuraminic acid 0.0838 7.6 N-glycol-neuraminic acid 0.0501 4.5 Total 1.1079 100.0 CA215 1 #070801-1 Fucose 0.0981 14.8 N-acetyl-galactosamine 0.0961 14.5 N-acetyl-glucosamine 0.1371 20.7 Galactose 0.1473 22.3 Glucose nd nd Mannose nd nd N-acetyl-neuraminic acid 0.1320 20.0 N-glycol-neuraminic acid 0.0508 7.7 Total 0.6614 100.0 CA215 4 #070801-4 Fucose nd nd N-acetyl-galactosamine nd nd N-acetyl-glucosamine nd nd Galactose nd nd Glucose nd nd Mannose nd nd N-acetyl-neuraminic acid 0.3512 100.0 N-glycol-neuraminic acid nd nd Total 0.3512 100.0 CA215 5 #070801-5 Fucose nd nd N-acetyl-galactosamine 0.4961 34.2 N-acetyl-glucosamine 0.3506 24.2 Galactose 0.3539 24.4 Glucose nd nd Mannose nd nd N-acetyl-neuraminic acid 0.2307 15.9 N-glycol-neuraminic acid 0.0198 1.3 Total 1.4511 100.0 nd = not detected.

EXAMPLE 4

Location of the Carbohydrate Epitope

[0070] Using Western blot, it has been demonstrated that the RP215-specific carbohydrate-associated epitope is localized in the Fab region of cancer cell-derived Ig heavy chain of CA215. Amino acid analysis of the CDR1, CDR2 and CDR3 regions of a number of immunoglobulin heavy chains were analyzed to locate the position of the glycosylation site. These comparisons are shown in Table 12.

TABLE-US-00016 TABLE 12 Last 6 SEQ SEQ SEQ SEQ Cell lines amino acid ID ID ID ID or tissues in FR1 NO: CDR1 NO: CDR2 NO: CDR3 NO: T47D SRFSSR 114 TSGMR 115 PFWNGGSQKYCA 116 GITVPBPRLCPRN 117 IgG DSVT ZR75-1 SGYSFT 118 SYWIG 119 IIYPGDSDTRYSPS 120 QBIVAFS 121 IgM FQG ZR75-1 SGFNFN 122 TYAMT 123 TIAADGTWTSNA 124 DWYDY 125 IgG DFVRG SKBR3 SGGSVS 126 SGYYY 127 YIYYNGSTYENPS 128 DIKHTYGPN 129 IgG WS LKS SKBR3 SGLSFS 130 SSGMN 131 RIGSKAASDTTSY 132 QGCGGDCHIPKM 133 IgA AASVRG MDA- SGFTFS 134 SYWMD 135 RISPDGRTTTYAD 136 GYLSSH 137 IgM MB-231 SVEG Lung SGYTFG 138 TYWIG 139 IIYPGDSDTTYSPS 140 WDVMIGFYTA 141 Cancer FRG Dakiki SGFTFS 142 DYGMT 143 GITSSVLTTYYAD 144 AQGFAPPAS 145 SVKG IM-9 SGFRFD 146 DYAMH 147 GISWNSDTIDYAD 148 TKEGGVTDIDPFDI 149 SVKG MC116 SGYRFT 150 GYYMH 151 RINPNSGGINYAQ 152 TREDSGSYEY 153 RFQG Daudi SGYSIT 154 SYYIH 155 KTDNDGRDADYA 156 VRENGQKCFDY 157 QRFQG

[0071] A consistent O-link glycosylation site with serine or threonine was always located proximal to the junction between FR1 and CDR1, thus indicating that the RP215-specific epitope is associated with the presence of a serine or threonine residue in this location. Absence of this O-glycosylation site results in the failure of RP215 to recognize CA215.

EXAMPLE 5

In Vivo Efficacy of RP215

[0072] Although addition of RP215 monoclonal antibody to cell cultures of OC-3-VGH ovarian cancer cells had no effect on growth, these antibodies were successful in inhibiting tumor growth in vivo. Cell culture growth was also not inhibited either by human IgG or goat anti-human IgG in vitro up to a concentration of 200 μg/ml in the cell culture.

[0073] Groups of four nude mice were implanted subcutaneously with 2×10⁶ cells in 0.2 ml per mouse at sites near the breast for a growth period of 2-3 weeks. Treatments were performed after visible apparent growth of tumors. The experimental design is shown in Table 13. The radioactive labeling of the mAb was at a specific radioactivity of 12.5 μCi/mg.

TABLE-US-00017 TABLE 13 Ani- Exp. mal No. Group No. (n) Dosage 1. Negative Control 4 Medium only 2. Positive Control 4 Cyclophosphonamide (60 mg/Kg) 3. Antibody (High Dose) 4 RP215 Mab (10 mg/Kg) (Naked) 4. Antibody (Low Dose) 4 RP215 Mab (2 mg/Kg) (Naked) 5. I¹³¹-labeled Antibody 4 RP215 Mab (10 mg/Kg + (High dose) 125 μCi) 6. I¹³¹-labeled Antibody 4 RP215 Mab (6 mg/Kg + 75 μCi) 7. I¹³¹-labeled Antibody 4 RP215 Mab (2 mg/Kg + 25 μCi)

[0074] The mice were sacrificed on day 16 after treating with antibody, and the size of tumors in each mouse was determined by weight together with the body weight. These results are shown in Table 14.

TABLE-US-00018 TABLE 14 Average Mouse Body Tumor of Tumor Group ID # Weight Weight Weight Percent Negative Control 1 22.23 0.148 0.13075 100 2 22.51 0.133 3 23.16 0.104 4 21.14 0.138 Positive Control 1 21.18 0.098 0.09575 73.2 (Cyclophosphonamide 2 21.42 0.096 60 mg/Kg) 3 23.37 0.098 4 21.18 0.091 Antibody 1 21.43 0.088 0.0865 66.2 (high dose 2 23.05 0.077 10 mg/Kg) 3 22.15 0.095 4 23.56 0.086 Antibody 1 21.76 0.103 0.10225 78.2 (low dose 2 20.57 0.122 2 mg/Kg) 3 21.98 0.080 4 22.64 0.104 I¹³¹-labeled 1 20.26 0.034 0.4575 35 Antibody 2 25.71 0.075 (High dose 3 20.25 0.048 10 mg/Kg) 4 22.60 0.026 I¹³¹-labeled 1 20.47 0.068 0.0705 53.9 Antibody 2 22.91 0.076 (Mid dose 3 23.00 0.049 6 mg/Kg) 4 23.05 0.089 I¹³¹-labeled 1 20.03 0.154 0.11675 89.2 Antibody 2 21.46 0.083 (Low dose 3 22.12 0.108 2 mg/Kg) 4 20.38 0.122

[0075] As shown, antibodies dosed at 10 mg/kg without radioactive label reduced the tumor size more significantly than the positive control which employed 60 mg/kg of cyclophosphonamide. The I¹³¹ labeled antibody at the same dose reduced the tumor size even more.

EXAMPLE 6

Nucleotide Sequences of RP215 Variable Regions

[0076] For purposes of humanizing RP215, and as a target for mutagenesis, to obtain additional antibodies with favorable properties immunoreactive with CA215, the nucleotide sequences encoding the heavy and light chain variable regions of RP215 have been determined and are shown in Table 15, along with the deduced amino acid sequences.

TABLE-US-00019 TABLE 15 Nucleotide and the Deduced Amino Acid Sequences of the variable regions of RP215 Monoclonal Antibody Length Region (bp) Nucleotide Sequence H Chain Variable Region- 19 amino acids Signal Peptide (SEQ ID NO: 158) 1 atgagatggagctgtatcatcctcttcttggtagcaacagctacaggtgtcagctcc 57 M R W S C I I L F L V A T A T G V S S H Chain Variable 1 caggtccaactgcagcagcctggggctgagcttgtgatgcctggg Region (SEQ ID NO:159) Q V Q L Q Q P G A E L V M P G 46 gcttcagtgaagatgtcctgcaaggcttctggctacacattcact A S V K M S C K A S G Y T F T 112 amino acids 91 gactactggatgcactgggtgaagcagaggcctggacaaggcctt D Y W M H W V K Q R P G Q G L 136 gagtggatcggagcgattgatacttctgatagttatactaggtac E W I G A I D T S D S Y T R Y 181 aatcaaaagttcaaggacaaggccacattgactgtagacgaatcc N Q K F K D K A T L T V D E S 226 tccagcacagccttcatgcagctcagcagcctgacatctgaggac S S T A F M Q L S S L T S E D 271 tctgcggtctattactgtgcaagatccatctatgactggggccaa S A V Y Y C A R S I Y D W G Q 316 gggactctggtcactgtctctgca 339 G T L V T V S A L Chain Variable 1 atggaatcacagacccaggtcctcatgtttcttctgctctgggta Region-Signal Peptide M E S Q T Q V L M F L L L W V (SEQ ID NO: 160) 46 tctggtggtgcctgtgca 63 21 amino acids S G G A C A L Chain Variable 1 gacattgtgatgacacagtctccatcctccctggctatgtcagta Region (SEQ ID NO: 161) D I V M T Q S P S S L A M S V 46 ggacagaaggtcactatgagctgcaagtccagtcagagcctttta G Q K V T M S C K S S Q S L L 112 amino acids 91 aatagtagcaatcaaaagagctatttggcctggtaccagcagaaa N S S N Q K S Y L A W Y Q Q K 136 ccaggacagtctcctaaacttctggtatactttgcatccactagg P G Q S P K L L V F A S T T R 181 gaatctggggtccctgatcgcttcataggcagtggatctgggaca E S G V P D R F I G S G S G T 226 gatttcactcttaccatcagcagtgtgcaggctgaagacctggca F T T L T I S S V Q A E D L A 271 gattacttctgtcagcaacattatagcactccgtccacgttcgga D Y F C Q Q H Y S T C S T F G 316 ggggggaccaagctggaaataaaa 339 G G T K L E I K

[0077] Using this information, alternative forms of monoclonal antibodies immunoreactive with CA215 were designed and produced, including humanized forms thereof.

EXAMPLE 7

Humanization of RP215

[0078] Using the information set forth in Example 6, humanized forms of RP215 (hRP215) were prepared.

[0079] In addition, a chimeric RP215 mAb (chRP215) was prepared using the same human constant regions and the murine variable regions set forth above in Example 6.

[0080] RP215, HRP215, and chRP215 were obtained in purified form and compared as follows:

[0081] Each was coated separately at 5 μg/ml overnight in microwells. The microwells were treated with concentrated cell culture shed medium of OC-3-VGH cells (to supply CA215) and then with HRP-labeled RP215 as a detection antibody. The detection antibody was incubated with each well for 60 min at 37° C. After 30 min, TMB substrate was added for 20 min of color development and, after stopping the reaction, the intensity determined at 450 nm in an ELISA reader. In some cases, 10 μg/ml human IgG was added to the wells, but this had no evident effect on the signal intensity. The results are shown in Table 16.

TABLE-US-00020 TABLE 16 Relative Signal Intensity Relative Signal Intensity Coated in Sandwich EIA in Sandwich EIA Antibodies No Human IgG 10 μg/ml Human IgG RP215 100% 100% hRP215 20.6% 21.4% chRP215 14.5% 15.4%

[0082] As shown, hRP215 and chRP215 showed lower binding affinity, but nevertheless, were able to bind CA215 specifically and not affected by human IgG.

[0083] In additional experiments, RP215-coated microwells showed no binding to alkaline phosphatase-labeled goat anti-human IgG or to the Fab or Fc regions of this antibody. However, RP215 showed strong binding to goat anti-mouse IgG.

[0084] HRP215 showed little or no binding to goat anti-mouse IgG but strong binding to goat anti-human IgG. The results were similar for chRP215.

[0085] These results are shown in Table 17.

TABLE-US-00021 TABLE 17 Antibodies coated in Wells Detecting hRP215 chRP215 hIgG Antibodies Relative Relative Relative Used RP215 Intensity Intensity Intensity Goat Anti 100% ~5% ~7% ~3% mouse IgG^a Goat Anti- <0.5% 100% ~10% 70% human IgG^a Goat Anti- <0.5% 150% 45% 100% human IgFc Goat Anti- <1% 70% 10% 40% human IgFab ^aSignal intensity for goat anti-mouse IgG and goat anti-human IgG were adjusted to 100% for comparative purposes

[0086] As shown in Table 17, wells were coated with either RP215, human RP215 (hRP215), chimeric human RP215 (chRP215) or human IgG. In row 1, the results were normalized to 100% for the interaction between RP215 and goat anti-mouse IgG. As shown in the first row, goat anti-mouse IgG bound comparatively poorly to the humanized or chimeric human forms.

[0087] In row 2, when goat anti-human IgG is used as a detector, and humanized RP215 was set at 100%, decreased binding was shown for human IgG, and very reduced binding for the chimeric or murine RP215.

[0088] In row 3, when the detecting antibody was goat anti-human IgFc, strong binding was shown to the humanized RP215 and to human IgG, but reduced binding to chimeric human RP215 and virtually no binding to RP215 itself.

[0089] In row 4, when goat anti-human IgFab was used, strong binding was detected in the humanized RP215 but relatively poor binding of human IgG and very weak binding, as expected, to RP215 and chimeric RP215.

[0090] From this, it was concluded that

[0091] (1) The humanized antibody, hRP215 and chimeric antibody, chRP215 showed comparable low crossreactivity to goat anti-mouse IgG to that of human IgG.

[0092] (2) Both hRP215 and chRP215 showed similar high binding activity to goat anti-human IgFc antibodies to that of human IgG as compared to the very weak binding of RP215, which is of mouse origin. chRP215, in contrast, has very low binding activity to goat anti-human IgFab.

[0093] These results demonstrate that the humanized antibody retains antigen binding specificity to CA215 and has human characteristics to the exclusion of murine characteristics.

EXAMPLE 8

Analysis of Cancer Cell Lines for the Presence of CA215

[0094] The presence of RP215-specific epitope(s) in more than 30 cancer cell lines from ATCC and others has been tested using Western blot assay and sandwich EIA. The following cancer cell lines were shown to be positive for the presence of RP215-related epitope (>90%) in cancer cell extracts and in cell cultured shed media.

[0095] Breast Cancer Cell Lines:

[0096] MCF7 (HTB-22), MDA-MB-231 (HTB-26), MDA-MB-468 (HTB-132), MDA-435, SW-48 (CCL-231), T-47D (HTB-133)

[0097] Cervical Cancer Cell Lines: C-33A (HTB-31), ME-180 (HTB-33)

[0098] Colon Cancer Cell Lines:

[0099] HCT 115 (ABM), HCT 116 (CCL-247), HT29 (HTB-38)

[0100] Liver Cancer Cell Lines:

[0101] Hep3B (HB-8064), HepG2 (HB-8065), Hep-2 (CCL-23)

[0102] Kidney Cancer Cell Lines:

[0103] 293 (UBC)

[0104] Lung Cancer Cell Lines:

[0105] A549 (CCL-185), Calu-6 (HTB-56), H441(HTB-174), MRC-5 (CCL-171), WI-38 (CCL-75)

[0106] Lymphoma

[0107] HEL (ABM)

[0108] Melanoma

[0109] MMAN, MMRU, SK-Mel-3 (HTB-69)

[0110] Neuroblastoma

[0111] SH-SY5Y (CRL-2266), Neuro2A (CCL-131),

[0112] Bone Cancer Cell Line

[0113] U-20S (HTB-96)

[0114] Ovarian Cancer Cell Line

[0115] Skov-3 (HTB-77), OC-3-VGH (Taiwan)

[0116] Prostate Cancer Cell Line

[0117] DU 145 (HTB-81), PC-3 (CRL-1435)

[0118] However the existence of RP215-specific epitope cannot be easily demonstrated in several cancer cell lines. They are: SiHa (HTB-35, cervical), JEG-3 (HTB-36, placenta) and Jurkat (TIB-152, T-cell leukemia).

Sequence CWU 1

16118PRTHomo sapiens 1Val Glu Leu Val Glu Ser Gly Ala1 5212PRTHomo sapiensPEPTIDE(1)...(12)Tryptic peptide fragment of CA215 2Lys Asp Val Leu Thr Ile Thr Leu Thr Pro Lys Val1 5 10312PRTHomo sapiensPEPTIDE(1)...(12)Tryptic peptide fragment of CA215 3Lys Ala Pro Gln Val Tyr Thr Ile Pro Pro Lys Glu1 5 10414PRTHomo sapiensPEPTIDE(1)...(14)Tryptic peptide fragment of CA215 4Arg Val Asn Ser Ala Ala Phe Pro Ala Pro Ile Glu Lys Thr1 5 10517PRTHomo sapiensPEPTIDE(1)...(17)Tryptic peptide fragment of CA215 5Lys Ala Pro Gln Val Tyr Thr Ile Pro Pro Lys Glu Gln Met Ala Lys1 5 10 15Asp618PRTHomo sapiensPEPTIDE(1)...(18)Tryptic peptide fragment of CA215 6Arg Ser Val Ser Glu Leu Pro Ile Met His Gln Asp Trp Leu Asn Gly1 5 10 15Lys Glu719PRTHomo sapiensPEPTIDE(1)...(19)Tryptic peptide fragment of CA215 7Lys Asn Thr Gln Pro Ile Met Asp Thr Asp Gly Ser Tyr Phe Val Tyr1 5 10 15Ser Lys Leu813PRTHomo sapiensPEPTIDE(1)...(13)Tryptic peptide fragment of CA215 8Lys Ser Ser Gly Thr Ser Tyr Pro Asp Val Leu Lys Cys1 5 10911PRTHomo sapiensPEPTIDE(1)...(11)Tryptic peptide fragment of CA215 9Lys Val Cys Asn Tyr Val Ser Trp Ile Lys Gln1 5 101011PRTHomo sapiensPEPTIDE(1)...(11)Tryptic peptide fragment of CA215 10Arg Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg1 5 101125PRTHomo sapiensPEPTIDE(1)...(25)Tryptic peptide fragment of CA215 11Ser Leu Val Val Ala Ala Val Ala Pro Asp Asn Arg Asn Pro Ala Phe1 5 10 15Thr Thr Met Gly Trp Leu Phe Leu Lys 20 25129PRTHomo sapiensPEPTIDE(1)...(9)Tryptic peptide fragment of CA215 12Gly Asp Arg Val Thr Ile Thr Trp Arg1 51310PRTHomo sapiensPEPTIDE(1)...(10)Tryptic peptide fragment of CA215 13Gly Leu Ser Asp Ser Val Arg Ser Cys Arg1 5 101419PRTHomo sapiensPEPTIDE(1)...(19)Tryptic peptide fragment of CA215 14Thr Ala Lys Gly Ser Thr Gly Met Glu Ile Leu Leu Ser Thr Leu Glu1 5 10 15Asn Thr Lys1512PRTHomo sapiensPEPTIDE(1)...(12)Tryptic peptide fragment of CA215 15Lys Val Thr Cys Val Val Val Asp Ile Ser Lys Asp1 5 101614PRTHomo sapiensPEPTIDE(1)...(14)Tryptic peptide fragment of CA215 16Gly Pro Leu Cys Gly Cys Cys Pro Gly Arg Ser Ser Gln Lys1 5 101710PRTHomo sapiensPEPTIDE(1)...(10)Tryptic peptide fragment of CA215 17Ala Glu Leu Gly Gly Leu Leu Ser Pro Arg1 5 101821PRTHomo sapiensPEPTIDE(1)...(21)Tryptic peptide fragment of CA215 18Asp Gly Ser Ile Ser Ile Leu Gly Ser Asp Asp Ala Thr Thr Cys His1 5 10 15Ile Val Val Leu Arg 201911PRTHomo sapiensPEPTIDE(1)...(11)Tryptic peptide fragment of CA215 19Arg Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg1 5 102012PRTHomo sapiensPEPTIDE(1)...(12)Tryptic peptide fragment of CA215 20Lys Cys Glu Leu Asn Cys Gln Ala Met Gly Tyr Arg1 5 102121PRTHomo sapiensPEPTIDE(1)...(21)Tryptic peptide fragment of CA215 21Leu Ser Gly Ser Cys Arg Ser Thr Asp Ser Leu His Pro Cys Pro Pro1 5 10 15Thr Ala Leu Pro Arg 202210PRTHomo sapiensPEPTIDE(1)...(10)Tryptic peptide fragment of CA215 22Ala Pro Thr Val Val Leu Met Met Thr Lys1 5 102321PRTHomo sapiensPEPTIDE(1)...(21)Tryptic peptide fragment of CA215 23Ala Thr Ser Arg Gly Cys Ile Thr Ile Ile Gly Gly Gly Asp Thr Ala1 5 10 15Thr Cys Cys Ala Lys 202418PRTHomo sapiensPEPTIDE(1)...(18)Tryptic peptide fragment of CA215 24Met Ser Thr Arg Tyr His Gln Ala Ala Ser Asp Ser Tyr Leu Glu Leu1 5 10 15Ile Lys2517PRTHomo sapiensPEPTIDE(1)...(17)Tryptic peptide fragment of CA215 25Ser Leu Pro Gly Ser Pro Lys Asp Ser Ser His Leu Leu Ser Pro Leu1 5 10 15Arg2622PRTHomo sapiensPEPTIDE(1)...(22)Tryptic peptide fragment of CA215 26Gly Gly Asn Ser Gly Gly Ser Ser Ser Ile Cys Tyr Val Leu Leu Gly1 5 10 15Phe Ile Gly Thr Ser Lys 202716PRTHomo sapiensPEPTIDE(1)...(16)Tryptic peptide fragment of CA215 27Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Lys Thr Leu Thr Ile Arg1 5 10 152823PRTHomo sapiensPEPTIDE(1)...(23)Tryptic peptide fragment of CA215 28Gly Leu Glu Cys Ile Gly Tyr Met Tyr Ser Ser Gly Ser Ser Phe Tyr1 5 10 15Asn Pro Ser Leu Lys Ser Arg 202915PRTHomo sapiensPEPTIDE(1)...(15)Tryptic peptide fragment of CA215 29Met Ala Tyr Leu Gln Gln Thr Leu Ala Gly Pro Ser Gly Thr Arg1 5 10 153025PRTHomo sapiens 30Lys Gly His Gln Asp Ser Cys Pro Phe Glu Leu Thr Ala Cys Pro Asn1 5 10 15Glu Gly Cys Thr Ser Gln Val Pro Arg 20 253122PRTHomo sapiensPEPTIDE(1)...(22)Tryptic peptide fragment of CA215 31Gly Leu Glu Trp Val Ser Ala Val Ser Gly Ser Gly Thr Thr Thr Tyr1 5 10 15Tyr Ala Asp Ser Val Lys 203216PRTHomo sapiensPEPTIDE(1)...(16)Tryptic peptide fragment of CA215 32Leu Ser Ser Val Thr Ala Ala Asp Thr Asn Val Tyr Tyr Cys Ala Arg1 5 10 153315PRTHomo sapiensPEPTIDE(1)...(15)Tryptic peptide fragment of CA215 33Ala Glu Thr Leu Val Phe Ser Thr His Ala Val Ile Ser Met Arg1 5 10 153430PRTHomo sapiensDOMAIN(1)...(30)FR1 region of T47D(IgG) heavy chain 34Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Arg Phe Ser Ser Arg 20 25 30355PRTHomo sapiensDOMAIN(1)...(5)CDR1 region of T47D(IgG) heavy chain 35Thr Ser Gly Met Arg1 53630PRTHomo sapiensDOMAIN(1)...(30)FR1 region of ZR75-1 (IgM) heavy chain 36Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Glu1 5 10 15Ser Leu Lys Ile Ser Cys Lys Gly Ser Gly Tyr Ser Phe Thr 20 25 30375PRTHomo sapiensDOMAIN(1)...(5)CDR1 region of ZR75-1 (IgM) heavy chain 37Ser Tyr Trp Ile Gly1 53830PRTHomo sapiensDOMAIN(1)...(30)FR1 region of ZR75-1 (IgG) heavy chain 38Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Phe Asn Phe Asn 20 25 30395PRTHomo sapiensDOMAIN(1)...(5)CDR1 region of ZR75-1 (IgG) heavy chain 39Thr Tyr Ala Met Thr1 54030PRTHomo sapiensDOMAIN(1)...(30)FR1 region of SKBR3 (IgG) heavy chain 40Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Gln1 5 10 15Thr Leu Ser Leu Thr Cys Thr Val Ser Gly Gly Ser Val Ser 20 25 30417PRTHomo sapiensDOMAIN(1)...(7)CDR1 region of SKBR3 (IgG) heavy chain 41Ser Gly Tyr Tyr Tyr Trp Ser1 54230PRTHomo sapiensDOMAIN(1)...(30)FR1 region of SKBR3 (IgA) heavy chain 42Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Thr Leu Ser Cys Ala Val Ser Gly Leu Ser Phe Ser 20 25 30435PRTHomo sapiensDOMAIN(1)...(5)CDR1 region of SKBR3 (IgA) heavy chain 43Ser Ser Gly Met Asn1 54430PRTHomo sapiensDOMAIN(1)...(30)FR1 region of MDA-MB-231 (IgM) heavy chain 44Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser 20 25 30455PRTHomo sapiensDOMAIN(1)...(5)CDR1 region of MDA-MB-231 (IgM) heavy chain 45Ser Tyr Trp Met Asp1 54630PRTHomo sapiensDOMAIN(1)...(30)FR1 region of Lung Cancer heavy chain 46Glu Val Gln Leu Glu Glu Ser Gly Ala Glu Val Lys Lys Pro Gly Glu1 5 10 15Ser Leu Lys Ile Ser Cys Glu Ala Ser Gly Tyr Thr Phe Gly 20 25 30475PRTHomo sapiensDOMAIN(1)...(5)CDR1 region of Lung Cancer heavy chain 47Thr Tyr Trp Ile Gly1 54817PRTHomo sapiensDOMAIN(1)...(17)FR1 region of CA215 48Lys Ser Ser Gly Thr Ser Tyr Pro Asp Val Leu Lys Cys Lys Val Cys1 5 10 15Asn494PRTHomo sapiensDOMAIN(1)...(4)CDR1 region of CA215 49Tyr Val Ser Trp15017PRTHomo sapiensDOMAIN(1)...(17)Alternate FR1 comparison region of CA215 50Ser Leu Val Val Ala Ala Val Ala Pro Asp Asn Arg Asn Pro Ala Phe1 5 10 15Thr5121PRTHomo sapiensDOMAIN(1)...(21)Alternate FR1 comparison region of CA215 51Ala Thr Ser Arg Gly Cys Ile Thr Ile Ile Gly Gly Gly Asp Thr Ala1 5 10 15Thr Cys Cys Ala Lys 205215PRTHomo sapiensDOMAIN(1)...(15)Alternate FR1 comparison region of CA215 52Met Ala Tyr Leu Gln Gln Thr Leu Ala Gly Pro Ser Gly Thr Arg1 5 10 155313PRTHomo sapiensDOMAIN(1)...(13)FR2 region of T47D (IgG) heavy chain 53Trp Val Arg Gln Ala Pro Gly Lys Glu Leu Glu Val Ala1 5 105416PRTHomo sapiensDOMAIN(1)...(16)CDR2 region of T47D(IgG) heavy chain 54Pro Phe Trp Asn Gly Gly Ser Gln Lys Tyr Cys Ala Asp Ser Val Thr1 5 10 155514PRTHomo sapiensDOMAIN(1)...(14)FR2 region of ZR75-1(IgM) heavy chain 55Trp Val Arg Gln Met Pro Gly Lys Gly Leu Glu Trp Met Gly1 5 105617PRTHomo sapiensDOMAIN(1)...(17)CDR2 region of ZR75-1(IgM) heavy chain 56Ile Ile Tyr Pro Gly Asp Ser Asp Thr Arg Tyr Ser Pro Ser Phe Gln1 5 10 15Gly5714PRTHomo sapiensDOMAIN(1)...(14)FR2 region of ZR75-1 (IgG) heavy chain 57Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ser1 5 105817PRTHomo sapiensDOMAIN(1)...(16)CDR2 region of ZR75-1 (IgG) heavy chain 58Thr Ile Ala Ala Asp Gly Thr Trp Thr Ser Asn Ala Asp Phe Val Arg1 5 10 15Gly5914PRTHomo sapiensDOMAIN(1)...(14)FR2 region of SKBR3 (IgG) heavy chain 59Arg Ile Arg Gln His Pro Gly Lys Gly Leu Glu Trp Ile Gly1 5 106016PRTHomo sapiensDOMAIN(1)...(16)CDR2 region of SKBR3 (IgG) heavy chain 60Tyr Ile Tyr Tyr Asn Gly Ser Thr Tyr Glu Asn Pro Ser Leu Lys Ser1 5 10 156114PRTHomo sapiensDOMAIN(1)...(14)FR2 region of SKBR3 (IgA) heavy chain 61Trp Val Arg Gln Ala Ser Gly Lys Gly Leu Glu Trp Val Gly1 5 106219PRTHomo sapiensDOMAIN(1)...(19)CDR2 region of SKBR3 (IgA) heavy chain 62Arg Ile Gly Ser Lys Ala Ala Ser Asp Thr Thr Ser Tyr Ala Ala Ser1 5 10 15Val Arg Gly6314PRTHomo sapiensDOMAIN(1)...(14)FR2 region of MDA-MB-231 (IgM) heavy chain 63Trp Val Arg Gln Val Pro Gly Lys Gly Leu Val Trp Val Ser1 5 106417PRTHomo sapiensDOMAIN(1)...(17)CDR2 region of MDA-MB-231 (IgM) heavy chain 64Arg Ile Ser Pro Asp Gly Arg Thr Thr Thr Tyr Ala Asp Ser Val Glu1 5 10 15Gly6514PRTHomo sapiensDOMAIN(1)...(14)FR2 region of Lung Cancer heavy chain 65Trp Val Arg Gln Met Pro Gly Lys Gly Leu Glu Trp Met Gly1 5 106617PRTHomo sapiensDOMAIN(1)...(17)FR2 region of Lung Cancer heavy chain 66Ile Ile Tyr Pro Gly Asp Ser Asp Thr Thr Tyr Ser Pro Ser Phe Arg1 5 10 15Gly679PRTHomo sapiensDOMAIN(1)...(9)FR2 region of CA215 67Ile Lys Gln Gly Leu Glu Trp Val Ser1 56816PRTHomo sapiensDOMAIN(1)...(16)CDR2 region of CA215 68Ala Val Ser Gly Ser Gly Thr Thr Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10 15695PRTHomo sapiensDOMAIN(1)...(5)Alternate FR2 comparison region of CA215 69Trp Leu Phe Leu Lys1 5706PRTHomo sapiensDOMAIN(1)...(6)Alternate FR2 comparison region of CA215 70Gly Leu Glu Cys Ile Gly1 57118PRTHomo sapiensDOMAIN(1)...(18)Alternate CDR2 comparison region of CA215 71Tyr Met Tyr Ser Ser Gly Ser Ser Phe Tyr Asn Pro Ser Leu Lys Ser1 5 10 15Arg Gly7231PRTHomo sapiensDOMAIN(1)...(31)FR3 region of T47D (IgG) heavy chain 72Gly Arg Phe Thr Phe Ser Glu Thr Phe Leu Arg Pro Cys Ser Leu Cys1 5 10 15Lys Cys Thr Val Asn Leu Arg Ala Arg Pro Ser Ile Pro Ala Pro 20 25 307313PRTHomo sapiensDOMAIN(1)...(13)CDR3 region of T47D (IgG) heavy chain 73Gly Ile Thr Val Pro His Pro Arg Leu Cys Pro Arg Asn1 5 107432PRTHomo sapiensDOMAIN(1)...(32)FR3 region of ZR75-1 (IgM) heavy chain 74Gln Val Thr Ile Ser Ala Asp Lys Ser Ile Ser Thr Ala Tyr Leu Gln1 5 10 15Trp Ser Ser Leu Lys Ala Ser Asp Thr Ala Met Tyr Tyr Cys Ala Arg 20 25 30757PRTHomo sapiensDOMAIN(1)...(7)CDR3 region of ZR75-1 (IgM) heavy chain 75Gln Glu Ile Val Ala Phe Ser1 57632PRTHomo sapiensDOMAIN(1)...(32)FR3 region of ZR75-1 (IgG) heavy chain 76Arg Leu Thr Ile Ser Arg Asp Asn Ser Arg Asn Thr Leu Tyr Leu Gln1 5 10 15Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Ile Tyr Phe Cys Ala Lys 20 25 30775PRTHomo sapiensDOMAIN(1)...(5)CDR3 region of ZR75-1 (IgG) heavy chain 77Asp Trp Tyr Asp Tyr1 57832PRTHomo sapiensDOMAIN(1)...(32)FR3 region of SKBR3 (IgG) heavy chain 78Arg Ala Ser Ile Ser Val Asp Thr Ser Lys Asn Gln Phe Ser Leu Lys1 5 10 15Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys Ala Arg 20 25 30799PRTHomo sapiensDOMAIN(1)...(9)CDR3 region of SKBR3 (IgG) heavy chain 79Asp Ile Lys His Thr Tyr Gly Pro Asn1 58032PRTHomo sapiensDOMAIN(1)...(32)FR3 region of SKBR3 (IgA) heavy chain 80Arg Phe Phe Ile Ser Arg Asp Asp Ser Lys Lys Thr Val Tyr Leu Gln1 5 10 15Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr Tyr Cys Ser Arg 20 25 308112PRTHomo sapiensDOMAIN(1)...(12)CDR3 region of SKBR3 (IgA) heavy chain 81Gln Gly Cys Gly Gly Asp Cys His Ile Pro Lys Met1 5 108232PRTHomo sapiensDOMAIN(1)...(32)FR3 region of MDA-MB-231 (IgM) heavy chain 82Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr Leu Gln1 5 10 15Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Gly 20 25 30836PRTHomo sapiensDOMAIN(1)...(6)CDR3 region of MDA-MB-231 (IgM) heavy chain 83Gly Tyr Leu Ser Ser His1 58432PRTHomo sapiensDOMAIN(1)...(32)FR3 region of Lung Cancer heavy chain 84Gln Val Thr Leu Ser Val Asp Lys Phe Ile Asn Thr Ala Tyr Leu Gln1 5 10 15Trp Asp Ser Leu Lys Ala Ser Asp Thr Ala Ile Tyr Tyr Cys Ala Arg 20 25 308510PRTHomo sapiensDOMAIN(1)...(10)CDR3 region of Lung Cancer heavy chain 85Trp Asp Val Met Ile Gly Phe Tyr Thr Ala1 5 108630PRTHomo sapiensDOMAIN(1)...(30)FR3 region of CA215 86Asp Arg Val Thr Ile Thr Trp Arg Arg Thr Leu Tyr Leu Gln Met Asn1 5 10 15Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Lys 20 25 30875PRTHomo sapiensDOMAIN(1)...(5)CDR3 region of CA215 87Thr Leu Thr Ile Arg1 58816PRTHomo sapiensDOMAIN(1)...(16)Alternate FR3 comparison region of CA215 88Leu Ser Ser Val Thr Ala Ala Asp Thr Asn Val Tyr Tyr Cys Ala Arg1 5 10 158915PRTHomo sapiensDOMAIN(1)...(15)Alternate FR3 comparison region of CA215 89Met Ala Tyr Leu Gln Gln Thr Leu Ala Gly Pro Ser Gly Thr Arg1 5 10 159014PRTHomo sapiensDOMAIN(1)...(14)JH region of T47D (IgG) heavy chain 90Tyr Phe Asp Ser Gly Gln Gly Thr Leu Val Thr Val Ser Ser1 5 109111PRTHomo sapiensDOMAIN(1)...(11)CH region of T47D (IgG) heavy chain 91Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu1 5 109217PRTHomo sapiensDOMAIN(1)...(17)JH region of ZR75-1 (IgM) heavy chain 92Tyr Tyr Tyr Met Asp Val Trp Gly Lys Gly Thr Thr Val Thr Val Ser1 5 10 15Ser9311PRTHomo

sapiensDOMAIN(1)...(11)CH region of ZR75-1 (IgM) heavy chain 93Gly Ser Ala Ser Pro Gln Pro Phe Ser Pro Ser1 5 109411PRTHomo sapiensDOMAIN(1)...(11)JH region of ZR75-1 (IgG) heavy chain 94Trp Gly Gln Gly Thr Leu Val Thr Ala Leu Leu1 5 109515PRTHomo sapiensDOMAIN(1)...(15)CH region of ZR75-1 (IgG) heavy chain 95Thr Val Ser Thr Gly Leu His Gln Gly Pro Ile Gly Leu Pro Pro1 5 10 159618PRTHomo sapiensDOMAIN(1)...(18)JH region of SKBR3 (IgG) heavy chain 96Tyr Asn Cys Tyr Met Asp Val Trp Gly Lys Gly Thr Thr Val Thr Val1 5 10 15Ser Ser9711PRTHomo sapiensDOMAIN(1)...(11)CH region of SKBR3 (IgG) heavy chain 97Gly Leu His Gln Gly Pro Ile Gly Leu Pro Pro1 5 109819PRTHomo sapiensDOMAIN(1)...(19)JH region of SKBR3 (IgA) heavy chain 98Tyr Tyr Tyr Tyr Gly Met Asp Val Trp Gly Gln Gly Thr Thr Val Thr1 5 10 15Val Ser Ser999PRTHomo sapiensDOMAIN(1)...(9)CH region of SKBR3 (IgA) heavy chain 99Ala Ser Pro Thr Ser Pro Lys Val Phe1 510013PRTHomo sapiensDOMAIN(1)...(14)JH region of MDA-MB-231 (IgM) heavy chain 100Asp Tyr Trp Gly Arg Gly Thr Leu Val Thr Val Ser Ser1 5 1010111PRTHomo sapiensDOMAIN(1)...(11)CH region of MDA-MB-231 (IgM) heavy chain 101Gly Glu Cys Ile Arg Pro Asn Pro Phe Pro Pro1 5 1010212PRTHomo sapiensDOMAIN(1)...(12)JH region of Lung Cancer heavy chain 102Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser1 5 1010330PRTHomo sapiensDOMAIN(1)...(30)CH region of Lung Cancer heavy chain 103Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser1 5 10 15Lys Ser Thr Ser Gly Gly Thr Ala Val Leu Gly Cys Leu Val 20 25 3010410PRTHomo sapiensDOMAIN(1)...(11)CH region of Lung Cancer heavy chain 104Lys Asp Tyr Phe Pro Glu Pro Val Thr Val1 5 1010519PRTHomo sapiensDOMAIN(1)...(19)CH region of CA215 105Thr Ala Lys Gly Ser Thr Gly Met Glu Ile Leu Leu Ser Thr Leu Glu1 5 10 15Asn Thr Lys106167PRTHomo sapiensDOMAIN(1)...(166)Constant region of CA215 106Gly Asn Ser Gly Gly Ser Ser Ser Ile Cys Tyr Val Leu Leu Gly Phe1 5 10 15Ile Gly Thr Ser Lys Leu Ser Gly Ser Cys Arg Ser Thr Asp Ser Leu 20 25 30His Pro Cys Pro Pro Thr Ala Leu Pro Arg Ala Glu Leu Gly Gly Leu 35 40 45Leu Ser Pro Arg Lys Asp Val Leu Thr Ile Thr Leu Thr Pro Lys Val 50 55 60Thr Cys Val Val Val Asp Ile Ser Lys Asp Arg Ser Val Ser Glu Leu65 70 75 80Pro Ile Met His Gln Asp Trp Leu Asn Gly Lys Glu Arg Val Asn Ser 85 90 95Ala Ala Phe Pro Ala Pro Ile Glu Lys Thr Lys Ala Pro Gln Val Tyr 100 105 110Thr Ile Pro Pro Lys Glu Gln Met Ala Lys Asp Lys Gly His Gln Asp 115 120 125Ser Cys Pro Phe Glu Leu Thr Ala Cys Pro Asn Glu Gly Cys Thr Ser 130 135 140Gln Val Pro Arg Lys Asn Thr Gln Pro Ile Met Asp Thr Asp Gly Ser145 150 155 160Tyr Phe Val Tyr Ser Lys Leu 16510714PRTHomo sapiensDOMAIN(1)...(14)Partial amino acid sequence of CA215 107Gly Pro Leu Cys Gly Cys Cys Pro Gly Arg Ser Ser Gln Lys1 5 1010810PRTHomo sapiensDOMAIN(1)...(10)Partial amino acid sequence of CA215 108Ala Pro Thr Val Val Leu Met Met Thr Lys1 5 1010918PRTHomo sapiensDOMAIN(1)...(18)Partial amino acid sequence of CA215 109Met Ser Thr Arg Tyr His Gln Ala Ala Ser Asp Ser Tyr Leu Glu Leu1 5 10 15Ile Lys11017PRTHomo sapiensDOMAIN(1)...(17)Partial amino acid sequence of CA215 110Ser Leu Pro Gly Ser Pro Lys Asp Ser Ser His Leu Leu Ser Pro Leu1 5 10 15Arg111164PRTHomo sapiensDOMAIN(1)...(164)Anti-human colon carcinoma heavy chain 111Pro Lys Asp Val Leu Thr Ile Thr Leu Thr Pro Lys Val Thr Cys Val1 5 10 15Val Val Asp Ile Ser Lys Asp Asp Pro Glu Val Gln Phe Ser Trp Phe 20 25 30Val Asp Asp Val Glu Val His Thr Ala Gln Thr Gln Pro Arg Glu Glu 35 40 45Gln Phe Asn Ser Thr Phe Arg Ser Val Ser Glu Leu Pro Ile Met His 50 55 60Gln Asp Trp Leu Asn Gly Lys Glu Phe Lys Cys Arg Val Asn Ser Ala65 70 75 80Ala Phe Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly Arg 85 90 95Pro Lys Ala Pro Gln Val Tyr Thr Ile Pro Pro Pro Lys Glu Gln Met 100 105 110Ala Lys Asp Lys Val Ser Leu Thr Cys Met Ile Thr Asp Phe Phe Pro 115 120 125Glu Asp Ile Thr Val Glu Trp Gln Trp Asn Gly Gln Pro Ala Glu Asn 130 135 140Tyr Lys Asn Thr Gln Pro Ile Met Asp Thr Asp Gly Ser Tyr Phe Val145 150 155 160Tyr Ser Lys Leu112110PRTHomo sapiensDOMAIN(1)...(110)Constant region CA215 amino acid sequence by MALDI-TOF MS 112Lys Asp Val Leu Thr Ile Thr Leu Thr Pro Lys Val Thr Cys Val Val1 5 10 15Val Asp Ile Ser Lys Asp Leu Ser Thr Leu Glu Asn Thr Lys Arg Ser 20 25 30Val Ser Glu Leu Pro Ile Met His Gln Asp Trp Leu Asn Gly Lys Glu 35 40 45Arg Val Asn Ser Ala Ala Phe Pro Ala Pro Ile Glu Lys Thr Lys Ala 50 55 60Pro Gln Val Tyr Thr Ile Pro Pro Lys Glu Gln Met Ala Lys Asp Lys65 70 75 80Val Thr Cys Val Val Val Asp Ile Ser Lys Asp Lys Asn Thr Gln Pro 85 90 95Ile Met Asp Thr Asp Gly Ser Tyr Phe Val Tyr Ser Lys Leu 100 105 110113145PRTHomo sapiensDOMAIN(1)...(145)Constant region CA215 amino acid sequence by RT-PCR 113Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn1 5 10 15Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Val His Gln Asp Trp 20 25 30Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro 35 40 45Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly Gly Thr Arg Gly 50 55 60Cys Glu Gly His Met Asp Arg Gly Gln Leu Gly Pro Pro Ser Ala Leu65 70 75 80Gly Val Thr Ala Val Pro Thr Ser Val Pro Thr Gly Gln Pro Arg Glu 85 90 95Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn 100 105 110Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile 115 120 125Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr 130 135 140Thr1451146PRTHomo sapiensDOMAIN(1)...(6)Last 6 amino acids in FR1 region of T47D (IgG) heavy chain 114Ser Arg Phe Ser Ser Arg1 51155PRTHomo sapiensDOMAIN(1)...(5)CDR1 region of T47D (IgG) heavy chain 115Thr Ser Gly Met Arg1 511616PRTHomo sapiensDOMAIN(1)...(16)CDR2 region of T47D (IgG) heavy chain 116Pro Phe Trp Asn Gly Gly Ser Gln Lys Tyr Cys Ala Asp Ser Val Thr1 5 10 1511713PRTHomo sapiensDOMAIN(1)...(13)CDR3 region of T47D (IgG) heavy chain 117Gly Ile Thr Val Pro Asx Pro Arg Leu Cys Pro Arg Asn1 5 101186PRTHomo sapiensDOMAIN(1)...(6)Last 6 amino acids in FR1 region of ZR75-1 (IgM) heavy chain 118Ser Gly Tyr Ser Phe Thr1 51195PRTHomo sapiensDOMAIN(1)...(5)CDR1 region of ZR75-1 (IgM) heavy chain 119Ser Tyr Trp Ile Gly1 512017PRTHomo sapiensDOMAIN(1)...(17)CDR2 region of ZR75-1 (IgM) heavy chain 120Ile Ile Tyr Pro Gly Asp Ser Asp Thr Arg Tyr Ser Pro Ser Phe Gln1 5 10 15Gly1217PRTHomo sapiensDOMAIN(1)...(7)CDR3 region of ZR75-1 (IgM) heavy chain 121Gln Asx Ile Val Ala Phe Ser1 51226PRTHomo sapiensDOMAIN(1)...(6)Last 6 amino acids in FR1 region of ZR75-1 (IgG) heavy chain 122Ser Gly Phe Asn Phe Asn1 51235PRTHomo sapiensDOMAIN(1)...(5)CDR1 region of ZR75-1 (IgG) heavy chain 123Thr Tyr Ala Met Thr1 512417PRTHomo sapiensDOMAIN(1)...(17)CDR2 region of ZR75-1 (IgG) heavy chain 124Thr Ile Ala Ala Asp Gly Thr Trp Thr Ser Asn Ala Asp Phe Val Arg1 5 10 15Gly1255PRTHomo sapiensDOMAIN(1)...(5)CDR3 region of ZR75-1 (IgG) heavy chain 125Asp Trp Tyr Asp Tyr1 51266PRTHomo sapiensDOMAIN(1)...(6)Last 6 amino acids in FR1 region of SKBR3 (IgG) heavy chain 126Ser Gly Gly Ser Val Ser1 51277PRTHomo sapiensDOMAIN(1)...(7)CDR1 region of SKBR3 (IgG) heavy chain 127Ser Gly Tyr Tyr Tyr Trp Ser1 512816PRTHomo sapiensDOMAIN(1)...(16)CDR2 region of SKBR3 (IgG) heavy chain 128Tyr Ile Tyr Tyr Asn Gly Ser Thr Tyr Glu Asn Pro Ser Leu Lys Ser1 5 10 151299PRTHomo sapiensDOMAIN(1)...(9)CDR3 region of SKBR3 (IgG) heavy chain 129Asp Ile Lys His Thr Tyr Gly Pro Asn1 51306PRTHomo sapiensDOMAIN(1)...(6)Last 6 amino acids in FR1 region of SKBR3 (IgA) heavy chain 130Ser Gly Leu Ser Phe Ser1 51315PRTHomo sapiensDOMAIN(1)...(5)CDR1 region of SKBR3 (IgA) heavy chain 131Ser Ser Gly Met Asn1 513219PRTHomo sapiensDOMAIN(1)...(19)CDR2 region of SKBR3 (IgA) heavy chain 132Arg Ile Gly Ser Lys Ala Ala Ser Asp Thr Thr Ser Tyr Ala Ala Ser1 5 10 15Val Arg Gly13312PRTHomo sapiensDOMAIN(1)...(12)CDR3 region of SKBR3 (IgA) heavy chain 133Gln Gly Cys Gly Gly Asp Cys His Ile Pro Lys Met1 5 101346PRTHomo sapiensDOMAIN(1)...(6)Last 6 amino acids in FR1 region of MDA-MB-231 (IgM) heavy chain 134Ser Gly Phe Thr Phe Ser1 51355PRTHomo sapiensDOMAIN(1)...(5)CDR1 region of MDA-MB-231 (IgM) heavy chain 135Ser Tyr Trp Met Asp1 513617PRTHomo sapiensDOMAIN(1)...(17)CDR2 region of MDA-MB-231 (IgM) heavy chain 136Arg Ile Ser Pro Asp Gly Arg Thr Thr Thr Tyr Ala Asp Ser Val Glu1 5 10 15Gly1376PRTHomo sapiensDOMAIN(1)...(6)CDR3 region of MDA-MB-231 (IgM) heavy chain 137Gly Tyr Leu Ser Ser His1 51386PRTHomo sapiensDOMAIN(1)...(6)Last 6 amino acids in FR1 region of Lung Cancer heavy chain 138Ser Gly Tyr Thr Phe Gly1 51395PRTHomo sapiensDOMAIN(1)...(5)CDR1 region of Lung Cancer heavy chain 139Thr Tyr Trp Ile Gly1 514017PRTHomo sapiensDOMAIN(1)...(17)CDR2 region of Lung Cancer heavy chain 140Ile Ile Tyr Pro Gly Asp Ser Asp Thr Thr Tyr Ser Pro Ser Phe Arg1 5 10 15Gly14110PRTHomo sapiensDOMAIN(1)...(10)CDR3 region of Lung Cancer heavy chain 141Trp Asp Val Met Ile Gly Phe Tyr Thr Ala1 5 101426PRTHomo sapiensDOMAIN(1)...(6)Last 6 amino acids in FR1 region of Dakiki heavy chain 142Ser Gly Phe Thr Phe Ser1 51435PRTHomo sapiensDOMAIN(1)...(5)CDR1 region of Dakiki heavy chain 143Asp Tyr Gly Met Thr1 514417PRTHomo sapiensDOMAIN(1)...(17)CDR2 region of Dakiki heavy chain 144Gly Ile Thr Ser Ser Val Leu Thr Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly1459PRTHomo sapiensDOMAIN(1)...(9)CDR3 region of Dakiki heavy chain 145Ala Gln Gly Phe Ala Pro Pro Ala Ser1 51466PRTHomo sapiensPEPTIDE(1)...(6)Last 6 amino acids in FR1 region of IM-9 heavy chain 146Ser Gly Phe Arg Phe Asp1 51475PRTHomo sapiensDOMAIN(1)...(5)CDR1 region of IM-9 heavy chain 147Asp Tyr Ala Met His1 514817PRTHomo sapiensDOMAIN(1)...(17)CDR2 region of IM-9 heavy chain 148Gly Ile Ser Trp Asn Ser Asp Thr Ile Asp Tyr Ala Asp Ser Val Lys1 5 10 15Gly14914PRTHomo sapiensDOMAIN(1)...(14)CDR3 region of IM-9 heavy chain 149Thr Lys Glu Gly Gly Val Thr Asp Ile Asp Pro Phe Asp Ile1 5 101506PRTHomo sapiensDOMAIN(1)...(6)Last 6 amino acids in FR1 region of MC116 heavy chain 150Ser Gly Tyr Arg Phe Thr1 51515PRTHomo sapiensDOMAIN(1)...(5)CDR1 region of MC116 heavy chain 151Gly Tyr Tyr Met His1 515217PRTHomo sapiensDOMAIN(1)...(17)CDR2 region of MC116 heavy chain 152Arg Ile Asn Pro Asn Ser Gly Gly Ile Asn Tyr Ala Gln Arg Phe Gln1 5 10 15Gly15310PRTHomo sapiensDOMAIN(1)...(10)CDR3 region of MC116 heavy chain 153Thr Arg Glu Asp Ser Gly Ser Tyr Glu Tyr1 5 101546PRTHomo sapiensDOMAIN(1)...(6)Last 6 amino acids in FR1 region of Daudi heavy chain 154Ser Gly Tyr Ser Ile Thr1 51555PRTHomo sapiensDOMAIN(1)...(5)CDR1 region of Daudi heavy chain 155Ser Tyr Tyr Ile His1 515617PRTHomo sapiensDOMAIN(1)...(17)CDR2 region of Daudi heavy chain 156Lys Thr Asp Asn Asp Gly Arg Asp Ala Asp Tyr Ala Gln Arg Phe Gln1 5 10 15Gly15711PRTHomo sapiensDOMAIN(1)...(11)CDR3 region of Daudi heavy chain 157Val Arg Glu Asn Gly Gln Lys Cys Phe Asp Tyr1 5 1015857DNAHomo sapiensCDS(1)...(57)misc_feature(1)...(57)H chain variable region signal peptide 158atg aga tgg agc tgt atc atc ctc ttc ttg gta gca aca gct aca ggt 48Met Arg Trp Ser Cys Ile Ile Leu Phe Leu Val Ala Thr Ala Thr Gly1 5 10 15gtc agc tcc 57Val Ser Ser159339DNAHomo sapiensCDS(1)...(339)misc_feature(1)...(339)H chain variable region 159cag gtc caa ctg cag cag cct ggg gct gag ctt gtg atg cct ggg gct 48Gln Val Gln Leu Gln Gln Pro Gly Ala Glu Leu Val Met Pro Gly Ala1 5 10 15tca gtg aag atg tcc tgc aag gct tct ggc tac aca ttc act gac tac 96Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25 30tgg atg cac tgg gtg aag cag agg cct gga caa ggc ctt gag tgg atc 144Trp Met His Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45gga gcg att gat act tct gat agt tat act agg tac aat caa aag ttc 192Gly Ala Ile Asp Thr Ser Asp Ser Tyr Thr Arg Tyr Asn Gln Lys Phe 50 55 60aag gac aag gcc aca ttg act gta gac gaa tcc tcc agc aca gcc ttc 240Lys Asp Lys Ala Thr Leu Thr Val Asp Glu Ser Ser Ser Thr Ala Phe65 70 75 80atg cag ctc agc agc ctg aca tct gag gac tct gcg gtc tat tac tgt 288Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95gca aga tcc atc tat gac tgg ggc caa ggg act ctg gtc act gtc tct 336Ala Arg Ser Ile Tyr Asp Trp Gly Gln Gly Thr Leu Val Thr Val Ser 100 105 110gca 339Ala16063DNAHomo sapiensCDS(1)...(63)misc_feature(1)...(63)L chain variable region - signal peptide 160atg gaa tca cag acc cag gtc ctc atg ttt ctt ctg ctc tgg gta tct 48Met Glu Ser Gln Thr Gln Val Leu Met Phe Leu Leu Leu Trp Val Ser1 5 10 15ggt ggt gcc tgt gca 63Gly Gly Ala Cys Ala 20161339DNAHomo sapiensCDS(1)...(339)misc_feature(1)...(339)L chain variable region 161gac att gtg atg aca cag tct cca tcc tcc ctg gct atg tca gta gga 48Asp Ile Val Met Thr Gln Ser Pro Ser Ser Leu Ala Met Ser Val Gly1 5 10 15cag aag gtc act atg agc tgc aag tcc agt cag agc ctt tta aat agt 96Gln Lys Val Thr Met Ser Cys Lys Ser Ser Gln Ser Leu Leu Asn Ser 20 25 30agc aat caa aag agc tat ttg gcc tgg tac cag cag aaa cca gga cag 144Ser Asn Gln Lys Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln 35 40 45tct cct aaa ctt ctg gta tac ttt gca tcc act agg gaa tct ggg gtc 192Ser Pro Lys Leu Leu Val Tyr Phe Ala Ser Thr Arg Glu Ser Gly Val 50 55 60cct gat cgc ttc ata ggc agt gga tct ggg aca gat ttc act ctt acc 240Pro Asp Arg Phe Ile Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr65 70 75 80atc agc agt gtg cag gct gaa gac ctg gca gat tac ttc tgt cag caa 288Ile Ser Ser Val Gln Ala Glu Asp Leu Ala Asp Tyr Phe Cys Gln Gln

85 90 95cat tat agc act ccg tcc acg ttc gga ggg ggg acc aag ctg gaa ata 336His Tyr Ser Thr Pro Ser Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile 100 105 110aaa 339Lys

Claims

1. A method to elicit an immune response to cancer in a subject, wherein said cancer expresses CA215, which method comprises administering to said subject a formulation comprising a molecule that is immunoreactive with RP215 monoclonal antibody, but not significantly immunoreactive with antihuman IgG, said molecule consisting of an FR1 and CDR1 sequence of CA215 and a carbohydrate, wherein said carbohydrate is coupled to a threonine or serine glycosylation site proximal to the junction between FR1 and CDR1.

2. The method of claim 1 wherein said molecule is coupled to a heterologous moiety.

3. The method of claim 1, wherein the subject is human and which method further comprises treating said subject with chemotherapeutic agents or with radiation.

4. The method of claim 1, wherein the subject is an animal tumor model.

5. A method to elicit an immune response to cancer in a subject, wherein said cancer expresses CA215, which method comprises administering to said subject a formulation comprising antiidiotype antibodies to RP215 monoclonal antibody.

6. The method of claim 5, wherein the subject is human and which method further comprises treating said subject with chemotherapeutic agents or with radiation.

7. The method of claim 5, wherein the subject is an animal tumor model.

8. A method to detect CA215 in a sample, which method comprises (a) contacting said sample with a solid support to which is bound an anti-human IgG, followed by contacting said support with the monoclonal antibody RP215 or an antibody cross-reactive therewith or with immunospecific fragments of either, that is labeled or modified subsequently to contain a label; or (b) conducting a sandwich immunoassay in which one member of the sandwich is RP215 antibody and the other member of the sandwich is immunoreactive with antihuman IgG.

9. A protocol for diagnosis and treatment of solid tumors in a human patient which method comprises a) diagnosing said patient by assaying a sample of body fluid from said patient for the presence or absence of CA215, wherein the presence of CA215 indicates the presence of a solid tumor in said patient; and b) treating said patient by administering to said patient a humanized antibody that binds an epitope on membrane-bound CA215.

10. The method of claim 9, wherein the antibody is a humanized form of RP215.

11. The method of claim 9, wherein the antibody is coupled to a cytotoxic agent.

Images