SPECIFIC BINDING AGENTS OF HUMAN ANGIOPOEITIN-2

Abstract

at bind to Ang-2. Also disclosed are peptibodies comprising the peptides, methods of making such peptides and peptibodies, and methods of treatment using such peptides and peptibodies.

Description

[0001]This application is a divisional of U.S. application Ser. No. 10/269,695 filed Oct. 10, 2002, pending, which claims the benefit of U.S. Provisional Application Ser. No. 60/414,155, filed Sep. 27, 2002, and U.S. Provisional Application Ser. No. 60/328,624 filed Oct. 11, 2001, which are incorporated herein by reference in their entirety.

FIELD OF INVENTION

[0002]The present invention relates to specific binding agents that recognize and bind to angiopoietin-2 (Ang-2). More specifically, the invention relates to the production, diagnostic use, and therapeutic use of the specific binding agents and fragments thereof, which specifically bind Ang-2.

BACKGROUND OF THE INVENTION

[0003]Angiogenesis, the formation of new blood vessels from existing ones, is essential to many physiological and pathological processes. Normally, angiogenesis is tightly regulated by pro- and anti-angiogenic factors, but in the case of diseases such as cancer, ocular neovascular diseases, arthritis, and psoriasis, the process can go awry. Folkman, J., Nat. Med., 1:27-31 (1995).

[0004]There are a number of diseases known to be associated with deregulated or undesired angiogenesis. Such diseases include, but are not limited to, ocular neovascularisation, such as retinopathies (including diabetic retinopathy), age-related macular degeneration, psoriasis, hemangioblastoma, hemangioma, arteriosclerosis, inflammatory disease, such as a rheumatoid or rheumatic inflammatory disease, especially arthritis (including rheumatoid arthritis), or other chronic inflammatory disorders, such as chronic asthma, arterial or post-transplantational atherosclerosis, endometriosis, and neoplastic diseases, for example so-called solid tumors and liquid (or hematopoietic) tumors (such as leukemias and lymphomas). Other diseases associated with undesired angiogenesis will be apparent to those skilled in the art.

[0005]Although many signal transduction systems have been implicated in the regulation of angiogenesis, one of the best-characterized and most endothelial cell-selective systems involves the Tie-2 receptor tyrosine kinase (referred to as "Tie-2" or "Tie-2R" (also referred to as "ORK"); murine Tie-2 is also referred to as "tek") and its ligands, the angiopoietins (Gale, N. W. and Yancopoulos, G. D., Genes Dev. 13:1055-1066 [1999]). There are 4 known angiopoietins; angiopoietin-1 ("Ang-1") through angiopoietin-4 ("Ang-4"). These angiopoietins are also referred to as "Tie-2 ligands". (Davis, S., et al., Cell, 87:1161-1169 [1996]; Grosios, K., et al., Cytogenet Cell Genet, 84:118-120 [1999]; Holash, J., et al., Investigative Ophthalmology & Visual Science, 42:1617-1625 [1999]; Koblizek, T. I., et al., Current Biology, 8:529-532 [1998]; Lin, P., et al., Proc Natl Acad Sci USA, 95:8829-8834 [1998]; Maisonpierre, P. C., et al., Science, 277:55-60 [1997]; Papapetropoulos, A., et al., Lab Invest, 79:213-223 [1999]; Sato, T. N., et al., Nature, 375:70-74 [1998]; Shyu, K. G., et al., Circulation, 98:2081-2087 [1998]; Suri, C., et al., Cell, 87:1171-1180 [1996]; Suri, C., et al., Science, 282:468-471 [1998]; Valenzuela, D. M., et al., Proceedings of the National Academy of Sciences of the USA, 96:1904-1909 [1999]; Witzenbichler, B., et al., J Biol Chem, 273:18514-18521 [1998]). Whereas Ang-1 binding to Tie-2 stimulates receptor phosphorylation in cultured endothelial cells, Ang-2 has been observed to both agonize and antagonize Tie-2 receptor phosphorylation (Davis, S., et al., [1996], supra; Maisonpierre, P. C., et al., [1997], supra; Kim, I., J. H. Kim, et al., Oncogene 19(39): 4549-4552 (2000); Teichert-Kuliszewska, K., P. C. Maisonpierre, et al., Cardiovascular Research 49(3): 659-70 (2001)).

[0006]The phenotypes of mouse Tie-2 and Ang-1 knockouts are similar and suggest that Ang-1-stimulated Tie-2 phosphorylation mediates remodeling and stabilization of developing vessels in utero through maintenance of endothelial cell-support cell adhesion (Dumont, D. J., et al., Genes & Development, 8:1897-1909 [1994]; Sato, T. N., et al., Nature, 376:70-74 [1995]; Suri, C., et al., [1996], supra). The role of Ang-1 in vessel stabilization is thought to be conserved in the adult, where it is expressed widely and constitutively (Hanahan, D., Science, 277:48-50 [1997]; Zagzag, D., et al., Experimental Neurology, 159:391-400 [1999]). In contrast, Ang-2 expression is primarily limited to sites of vascular remodeling, where it is thought to block Ang-1 function, thereby inducing a state of vascular plasticity conducive to angiogenesis (Hanahan, D., [1997], supra; Holash, J., et al., Science, 284:1994-1998 [1999]; Maisonpierre, P. C., et al., [1997], supra).

[0007]Numerous published studies have purportedly demonstrated vessel-selective Ang-2 expression in disease states associated with angiogenesis. These pathological conditions include, for example, psoriasis, macular degeneration, and cancer (Bunone, G., et al., American Journal of Pathology, 155:1967-1976 [1999]; Etoh, T., et al., Cancer Research, 61:2145-2153 [2001]; Hangai, M., et al., Investigative Opthalmology & Visual Science, 42:1617-1625 [2001]; Holash, J., et al., [1999] supra; Kuroda, K., et al., Journal of Investigative Dermatology, 116:713-720 [2001]; Otani, A., et al., Investigative Opthalmology & Visual Science, 40:1912-1920 [1999]; Stratmann, A., et al., American Journal of Pathology, 153:1459-1466 [1998]; Tanaka, S., et al., J Clin Invest, 103:34-345 [1999]; Yoshida, Y., et al., International Journal of Oncology, 15:1221-1225 [1999]; Yuan, K., et al., Journal of Periodontal Research, 35:165-171 [2000]; Zagzag, D., et al., [1999] supra). Most of these studies have focused on cancer, in which many tumor types appear to display vascular Ang-2 expression. In contrast with its expression in pathological angiogenesis, Ang-2 expression in normal tissues is extremely limited (Maisonpierre, P. C., et al., [1997], supra; Mezquita, J., et al., Biochemical and Biophysical Research Communications, 260:492-498 [1999]). In the normal adult, the three main sites of angiogenesis are the ovary, placenta, and uterus; these are the primary tissues in normal (i.e., non-cancerous) tissues in which Ang-2 mRNA has been detected.

[0008]Certain functional studies suggest that Ang-2 may be involved in tumor angiogenesis. Ahmad et al. (Cancer Res., 61:1255-1259 [2001]) describe Ang-2 over-expression and show that it is purportedly associated with an increase in tumor growth in a mouse xenograft model. See also Etoh et al., supra, and Tanaka et al., supra, wherein data is presented purportedly associating Ang-2 over expression with tumor hypervascularity. However, in contrast, Yu et al. (Am. J. Path., 158:563-570 [2001]) report data to show that overexpression of Ang-2 in Lewis lung carcinoma and TA3 mammary carcinoma cells purportedly prolonged the survival of mice injected with the corresponding transfectants.

[0009]In the past few years, various publications have suggested Ang-1, Ang-2 and/or Tie-2 as a possible target for anticancer therapy. For example, U.S. Pat. Nos. 6,166,185, 5,650,490, and 5,814,464 each disclose the concept of anti-Tie-2 ligand antibodies and receptor bodies. Lin et al. (Proc. Natl. Acad. Sci. USA, 95:8829-8834 [1998]) injected an adenovirus expressing soluble Tie-2 into mice; the soluble Tie-2 purportedly decreased the number and size of the tumors developed by the mice. In a related study, Lin et al (J. Clin. Invest., 100:2072-2078 [1997]) injected a soluble form of Tie-2 into rats; this compound purportedly reduced tumor size in the rats. Siemeister et al. (Cancer Res., 59:3185-3189 [1999]) generated human melanoma cell lines expressing the extracellular domain of Tie-2, injected these cell lines into nude mice, and concluded that soluble Tie-2 purportedly resulted in a "significant inhibition" of tumor growth and tumor angiogenesis. In view of this information, and given that both Ang-1 and Ang-2 bind to Tie-2, it is not clear from these studies whether Ang-1, Ang-2, or Tie-2 would be an attractive target for anti-cancer therapy.

[0010]The fusion of certain peptides to a stable plasma protein such as an Ig constant region to improve the half-life of these molecules has been described in, for example, PCT publication WO 00/24782, published May 4, 2000.

[0011]The fusion of a protein or fragment thereof to a stable plasma protein such as an Ig constant region to improve the half-life of these molecules has been variously described (see, for example, U.S. Pat. No. 5,480,981; Zheng et al., J. Immunol., 154:5590-5600, (1995); Fisher et al., N. Engl. J. Med., 334:1697-1702, (1996); Van Zee, K. et al., J. Immunol., 156:2221-2230, (1996); U.S. Pat. No. 5,808,029, issued Sep. 15, 1998; Capon et al., Nature, 337:525-531, (1989); Harvill et al., Immunotech., 1:95-105, (1995); WO 97/23614, published Jul. 3, 1997; PCT/US97/23183, filed Dec. 11, 1997; Linsley, J. Exp. Med., 174:561-569, (1991); WO 95/21258, published Aug. 10, 1995).

[0012]An effective anti-Ang-2 therapy might benefit a vast population of cancer patients because most solid tumors require neovascularization to grow beyond 1-2 millimeters in diameter. Such therapy might have wider application in other angiogenesis-associated diseases as well, such as retinopathies, arthritis, and psoriasis.

[0013]There is an undeveloped need to identify new agents that specifically recognize and bind Ang-2. Such agents would be useful for diagnostic screening and therapeutic intervention in disease states that are associated with Ang-2 activity.

[0014]Accordingly, it is an object of the present invention to provide specific binding agents of Ang-2 that modulate Ang-2 activity. Such agents of the present invention take the form of peptibodies, i.e., peptides fused to other molecules such as an Fc domain of an antibody, where the peptide moiety specifically binds to Ang-2.

SUMMARY OF THE INVENTION

[0015]The present invention is directed in one embodiment to peptides (also referred to as polypeptides herein) that bind to Ang-2. Also embodied in the present invention are variants and derivatives of such peptides.

[0016]In another embodiment, the peptides and variants and derivatives thereof of the present invention are attached to vehicles.

[0017]In another embodiment, the peptides may be fused to Fc domains, thereby providing peptibodies. Optionally, the peptibodies comprise at least one peptide of, for example, SEQ ID NO:3-SEQ ID NO:6, or SEQ ID NO:76-SEQ ID NO:157, as well as variants and derivatives thereof. Further, the peptides may comprise at least one peptide according to the formulae set forth in SEQ ID NO:65-SEQ ID NO:75, and SEQ ID NO:158.

[0018]In yet another embodiment, the invention provides nucleic acid molecules encoding the specific binding agents, and variants and derivatives thereof.

[0019]In still another embodiment, the invention provides nucleic acid molecules encoding the peptibodies, as well as variants and derivatives thereof. Optionally, such nucleic acid molecules include SEQ ID NO:33-SEQ ID NO:53.

[0020]In still another embodiment, the invention provides a method of decreasing a tumor by administering an effective amount of the specific binding agents of the present invention to a subject in need thereof. The invention also provides a method of inhibiting angiogenesis in a subject, comprising administering an effective amount of the specific binding agents of the present invention to a subject in need thereof. The invention further provides a method of treating cancer in a subject, comprising an effective amount of the specific binding agents of the present invention to a subject in need thereof.

[0021]The invention also relates to a polypeptide capable of binding Ang-2 wherein the polypeptide comprises the amino acid sequence WDPWT (SEQ ID NO: 65), and wherein the polypeptide is from 5 to 50 amino acids in length, as well as physiologically acceptable salts thereof. The polypeptide can also comprise the amino acid sequence:

TABLE-US-00001 WDPWTC (SEQ ID NO: 66)

and physiologically acceptable salts thereof. Additionally, the polypeptide can comprise the amino acid sequence:

TABLE-US-00002 Cz²WDPWT (SEQ ID NO: 67)

wherein z² is an acidic or neutral polar amino acid residue, and physiologically acceptable salts thereof. The polypeptide can further comprise the amino acid sequence:

TABLE-US-00003 Cz²WDPWTC (SEQ ID NO: 68)

wherein z² is an acidic or neutral polar amino acid residue, and physiologically acceptable salts thereof.

[0022]In another embodiment, the invention relates to a polypeptide capable of binding Ang-2 comprising an amino acid sequence of the formula:

TABLE-US-00004 a¹a²a³Ca⁵WDPWTCa¹²a¹³a¹⁴ (SEQ ID NO: 69)

[0023]wherein: [0024]a¹, a², and a³ are each independently amino acid residues; [0025]a⁵ is an amino acid residue; [0026]a¹² is absent or an amino acid residue; [0027]a¹³ is absent or a neutral hydrophobic, neutral polar, or a basic amino acid residue; [0028]a¹⁴ is a neutral hydrophobic or neutral polar amino acid residue;

[0029]and physiologically acceptable salts thereof. In a preferred embodiment: [0030]a¹ is V, I, P, W, G, S, Q, N, E, K, R, or H; [0031]a² is V, P, M, G, S, Q, D, E, K, R, or H; [0032]a³ is A, V, P, M, F, T, G, D, E, K, or H; [0033]a⁸ is A, V, G, Q, N, D, or E; [0034]a¹² is S, Q, N, D, E, K, or R; [0035]a¹³ is L, T, or H; and [0036]a¹⁴ is V, L, I, W, or M.

[0037]In a more preferred embodiment, a¹ is Q; a² is E; a³ is E; a⁵ is D or E; a¹² is D or E; a¹³ is H; and a¹⁴ is M.

[0038]It will be appreciated that the use of lower case letters with superscripted numbers herein (such as a¹ and b¹) are intended to identify amino acid positions, and are not meant to indicate the single letter abbreviations for a given amino acid. Single letter amino acid abbreviations are given in upper case letters herein.

[0039]The invention further relates to a polypeptide capable of binding Ang-2 comprising an amino acid sequence of the formula:

TABLE-US-00005 (SEQ ID NO: 70) b¹b²b³b⁴b⁵b⁶Cb⁸WDPWTCb¹⁵b¹⁶b- ¹⁷b¹⁸b¹⁹b²⁰

[0040]wherein: [0041]b¹ is absent or an amino acid residue; [0042]b² is absent or a neutral hydrophobic, neutral polar, or a basic amino acid residue; [0043]b³, b⁴, b⁵, and b⁶ are each independently absent or amino acid residues; [0044]b⁸ is an amino acid residue; [0045]b¹⁵ is absent or an amino acid residue; [0046]b¹⁶ is absent or a neutral hydrophobic, neutral polar, or a basic amino acid residue; [0047]b¹⁷ is absent or a neutral hydrophobic or neutral polar amino acid residue; [0048]b¹⁸, b¹⁹, and b²⁰ are each independently absent or amino acid residues;

[0049]and physiologically acceptable salts thereof. In a preferred embodiment: [0050]b¹ is absent, or A, V, L, P, W, F, T, G, S, Q, N, K, R, or H; [0051]b² is absent, or A, V, L, I, P, W, M, T, G, S, Y, N, K, R, or H; [0052]b³ is absent, or A, L, I, P, W, M, T, G, S, Q, N, E, R, or H; [0053]b⁴ is V, I, P, W, G, S, Q, N, E, K, R, or H; [0054]b⁵ is V, P, M, G, S, Q, D, E, K, R, or H; [0055]b⁶ is A, V, P, M, F, T, G, D, E, K, or H; [0056]b⁸ is A, V, G, Q, N, D, or E; [0057]b¹⁵ is S, Q, N, D, E, K, or R; [0058]b¹⁶ is L, T, or H; [0059]b¹⁷ is V, L, I, W, or M; [0060]b¹⁸ is absent, or A, V, L, P, W, F, T, G, Y, Q, D, E, or R; [0061]b¹⁹ is absent, or V, L, I, P, T, G, S, Y, Q, N, D, E, or R; and [0062]b²⁰ is absent, or V, L, P, W, M, T, G, S, Y, Q, N, D, K, or R.

[0063]In a more preferred embodiment, b¹ is absent, or P, or T; b² is absent, or I, or N; b³ is absent, or R, or I; b⁴ is Q; b⁵ is E; b⁶ is E; b⁸ is D or E; b¹⁵ is D or E; b¹⁶ is H; b¹⁷ is M; b¹⁸ is absent, or W, or P; b¹⁹ is absent, or G, or E; and b²⁰ is absent, or V, or K.

[0064]It will also be appreciated that the invention preferably relates to a polypeptide comprising at least one amino acid sequence selected from the group consisting of SEQ ID NO: 4, and SEQ ID NO: 76 to SEQ ID NO: 118, inclusive, wherein the polypeptide is capable of binding to Ang-2, as well as physiologically acceptable salts thereof. The peptide sequences are set forth below:

TABLE-US-00006 TABLE 1 PEPTIDE SEQ ID NO. PEPTIDE SEQUENCE Con4-44 76 PIRQEECDWDPWTCEHMWEV Con4-40 77 TNIQEECEWDPWTCDHMPGK Con4-4 78 WYEQDACEWDPWTCEHMAEV Con4-31 79 NRLQEVCEWDPWTCEHMENV Con4-C5 80 AATQEECEWDPWTCEHMPRS Con4-42 81 LRHQEGCEWDPWTCEHMFDW Con4-35 82 VPRQKDCEWDPWTCEHMYVG Con4-43 83 SISHEECEWDPWTCEHMQVG Con4-49 84 WAAQEECEWDPWTCEHMGRM Con4-27 85 TWPQDKCEWDPWTCEHMGST Con4-48 86 GHSQEECGWDPWTCEHMGTS Con4-46 87 QHWQEECEWDPWTCDHMPSK Con4-41 88 NVRQEKCEWDPWTCEHMPVR Con4-36 89 KSGQVECNWDPWTCEHMPRN Con4-34 90 VKTQEHCDWDPWTCEHMREW Con4-28 91 AWGQEGCDWDPWTCEHMLPM Con4-39 92 PVNQEDCEWDPWTCEHMPPM Con4-25 93 RAPQEDCEWDPWTCAHMDIK Con4-50 94 HGQNMECEWDPWTCEHMFRY Con4-38 95 PRLQEECVWDPWTCEHMPLR Con4-29 96 RTTQEKCEWDPWTCEHMESQ Con4-47 97 QTSQEDCVWDPWTCDHMVSS Con4-20 98 QVIGRPCEWDPWTCEHLEGL Con4-45 99 WAQQEECAWDPWTCDHMVGL Con4-37 100 LPGQEDCEWDPWTCEHMVRS Con4-33 101 PMNQVECDWDPWTCEHMPRS AC2-Con4 102 FGWSHGCEWDPWTCEHMGST Con4-32 103 KSTQDDCDWDPWTCEHMVGP Con4-17 104 GPRISTCQWDPWTCEHMDQL Con4-8 105 STIGDMCEWDPWTCAHMQVD AC4-Con4 106 VLGGQGCEWDPWTCRLLQGW Con4-1 107 VLGGQGCQWDPWTCSHLEDG Con4-C1 108 TTIGSMCEWDPWTCAHMQGG Con4-21 109 TKGKSVCQWDPWTCSHMQSG Con4-C2 110 TTIGSMCQWDPWTCAHMQGG Con4-18 111 WVNEVVCEWDPWTCNHWDTP Con4-19 112 VVQVGMCQWDPWTCKHMRLQ Con4-16 113 AVGSQTCEWDPWTCAHLVEV Con4-11 114 QGMKMFCEWDPWTCAHIVYR Con4-C4 115 TTIGSMCQWDPWTCEHMQGG Con4-23 116 TSQRVGCEWDPWTCQHLTYT Con4-15 117 QWSWPPCEWDPWTCQTVWPS Con4-9 118 GTSPSFCQWDPWTCSHMVQG TN8-Con4* 4 QEECEWDPWTCEHM

[0065]It will be appreciated that certain peptides and/or peptibodies may contain the prefix "TN", "TN8", or "TN12", and that this prefix may or may not be present for a given peptibody. Thus, for example, the terms "TN8-Con4" and "Con4" are used interchangeably herein.

[0066]In another embodiment, the invention relates to a composition of matter having the formula:

(X¹)_a--F¹--(X²)_b

[0067]and multimers thereof, wherein:

[0068]F¹ is a vehicle;

[0069]X¹ and X² are each independently selected from [0070]-(L¹)_c-P¹; [0071]-(L¹)_c-P¹-(L²)_d-P²; [0072]-(L¹)_c-P¹-(L²)_d-P²-(L³)_e-P.- sup.3; and [0073]-(L¹)_c-P¹-(L²)_d-P²-(L³- )_e-P³-(L⁴)_f-P⁴;

[0074]wherein one or more of P¹, P², P³, and P⁴ each independently comprise a polypeptide as described herein. For example, in a preferred embodiment, P¹, P², P³, and P⁴ can each independently comprise a polypeptide of

[0075]SEQ ID NO: 3 to SEQ ID NO: 6, and/or SEQ ID NO: 76 to SEQ ID NO: 157.

[0076]In another embodiment, the composition of matter is of the formulae:

X¹--F¹

or

F¹--X²

and physiologically acceptable salts thereof, where X¹, F¹, and X² are as defined herein. In another embodiment, the composition of matter is of the formula:

F¹-(L¹)_c-P¹

and physiologically acceptable salts thereof, where L¹, F¹, and P¹ are as defined herein. In yet another embodiment, the composition of matter is of the formula:

F¹-(L¹)_c-P¹-(L²)_d-P²

and physiologically acceptable salts thereof, where L¹, F¹, P¹, P², and c and d are as defined herein. In still another embodiment the composition of matter is of the formula:

P¹-(L¹)_c-F¹-(L²)_d-P²

and physiologically acceptable salts thereof. In a preferred embodiment, F¹ is an Fc domain or fragment thereof.

[0077]The invention further relates to a polypeptide capable of binding Ang-2 comprising an amino acid sequence of the formula:

TABLE-US-00007 Pc²Dc⁴Lc⁶c⁷c⁸LY (SEQ ID NO: 71)

wherein

[0078]c² is a neutral hydrophobic amino acid residue

[0079]c⁴ is a A, D, or E

[0080]c⁶ is an acidic amino acid residue

[0081]c⁷ is an amino acid residue; and

[0082]c⁸ is a neutral hydrophobic, neutral polar, or basic amino acid residue;

and physiologically acceptable salts thereof. In a preferred embodiment, c² is L or M. In another preferred embodiment, c⁶ is D or E.

[0083]The invention further relates to a polypeptide capable of binding Ang-2 comprising an amino acid sequence of the formula:

TABLE-US-00008 (SEQ ID NO: 72) d¹d²d³d⁴Pd⁶Dd⁸Ld¹⁰d¹¹d¹²LY d¹⁵d¹⁶d¹⁷d¹⁸d¹⁹d²⁰d²¹ d²²

wherein, [0084]d¹ is absent, or an amino acid residue; [0085]d² is absent, or a neutral polar, acidic, or a basic amino acid residue; [0086]d³ is absent, or a neutral hydrophobic or neutral polar amino acid residue; [0087]d⁴ is absent, or an amino acid residue; [0088]d⁶ is a neutral hydrophobic amino acid residue; [0089]d⁸ is a A, D, or E; [0090]d¹⁰ is an acidic amino acid residue; [0091]d¹¹ is an amino acid residue; [0092]d¹² is a neutral hydrophobic, neutral polar, or basic amino acid residue; [0093]d¹⁵ is absent, or a neutral polar, acidic, or a basic amino acid residue; [0094]d¹⁶ is absent, or a neutral polar, acidic, or a basic amino acid residue; [0095]d¹⁷ is absent, or a neutral hydrophobic, or neutral polar amino acid residue; [0096]d¹⁸ is absent, or a neutral hydrophobic, or neutral polar amino acid residue; [0097]d¹⁹ is absent, or a neutral hydrophobic, neutral polar, or basic amino acid residue; [0098]d²⁰ is absent, or an amino acid residue; [0099]d²¹ is absent, or a neutral polar, acidic, or a basic amino acid residue; [0100]d²² is absent, or a neutral hydrophobic, neutral polar, or basic amino acid residue;and physiologically acceptable salts thereof. In a preferred embodiment: [0101]d¹ is T, S, Q, R, or H; [0102]d² is T, Q, N, or K; [0103]d³ is F; [0104]d⁴ is M, Q, E, or K; [0105]d⁶ is L or M; [0106]d⁸ is D or E; [0107]d¹⁰ is E; [0108]d¹¹ is Q or E; [0109]d¹² is T or R; [0110]d¹⁵ Y, D, E, or K; [0111]d¹⁶ is Q; [0112]d¹⁷ is W or F; [0113]d¹⁸ is L, I, M, or T; [0114]d¹⁹ is L, F, or Y; [0115]d²⁰ is Q, D, or E; [0116]d²¹ is absent, Q, or H; [0117]d²² is absent, A, L, G, S, or R.

[0118]In a preferred embodiment, the polypeptide comprises at least one amino acid sequence selected from the group consisting of SEQ ID NO: 6, and SEQ ID NO: 119 to SEQ ID NO: 142, inclusive, wherein the polypeptide is capable of binding to Ang-2. SEQ ID NO: 6, and SEQ ID NOS: 119-142 are set forth below:

TABLE-US-00009 Peptide SEQ ID NO. Peptide Sequence L1-1 119 QNYKPLDELDATLYEHFIFHYT L1-2 120 LNFTPLDELEQTLYEQWTLQQS L1-3 121 TKFNPLDELEQTLYEQWTLQHQ L1-4 122 VKFKPLDALEQTLYEHWMFQQA L1-5 123 VKYKPLDELDEILYEQQTFQER L1-7 124 TNFMPMDDLEQRLYEQFILQQG L1-9 125 SKFKPLDELEQTLYEQWTLQHA L1-10 126 QKFQPLDELEQTLYEQFMLQQA L1-11 127 QNFKPMDELEDTLYKQFLFQHS L1-12 128 YKFTPLDDLEQTLYEQWTLQHV L1-13 129 QEYEPLDELDETLYNQWMFHQR L1-14 130 SNFMPLDELEQTLYEQFMLQHQ L1-15 131 QKYQPLDELDKTLYDQFMLQQG L1-16 132 QKFQPLDELEETLYKQWTLQQR L1-17 133 VKYKPLDELDEWLYHQFTLHHQ L1-18 134 QKFMPLDELDEILYEQFMFQQS L1-19 135 QTFQPLDDLEEYLYEQWIRRYH L1-20 136 EDYMPLDALDAQLYEQFILLHG L1-21 137 HTFQPLDELEETLYYQWLYDQL L1-22 138 YKFNPMDELEQTLYEEFLFQHA AC6-L1 139 TNYKPLDELDATLYEHWILQHS L1-C1 140 QKFKPLDELEQTLYEQWTLQQR L1-C2 141 TKFQPLDELDQTLYEQWTLQQR L1-C3 142 TNFQPLDELDQTLYEQWTLQQR L1 6 KFNPLDELEETLYEQFTFQQ

[0119]The invention also relates to a a polypeptide capable of binding Ang-2 comprising an amino acid sequence of the formula:)

TABLE-US-00010 RPe³e⁴e⁵e⁶e⁷G (SEQ ID NO: 73)

[0120]wherein [0121]e³ is a neutral polar amino acid residue; [0122]e⁴ is an acidic amino acid residue; [0123]e⁵ is a neutral polar or an acidic amino acid residue; [0124]e⁶ is a neutral hydrophobic amino acid residue; [0125]e⁷ is a neutral hydrophobic amino acid residue; [0126]and physiologically acceptable salts thereof. In a preferred embodiment, e³ is Y or C. In another preferred embodiment, e⁴ is D or E. In still another preferred embodiment, e⁶ is I or M.

[0127]The invention further relates to a polypeptide capable of binding Ang-2 comprising an amino acid sequence of the formula:

TABLE-US-00011 (SEQ ID NO: 74) f¹f²f³f⁴RPf⁷f⁸f⁹f¹⁰f¹¹Gf¹³f¹⁴f¹⁵f¹⁶f¹⁷f¹⁸f¹⁹f²⁰

wherein,

[0128]f¹ is a neutral hydrophobic or neutral polar amino acid residue;

[0129]f² is a neutral hydrophobic or neutral polar amino acid residue;

[0130]f³ is a neutral polar or acidic amino acid residue;

[0131]f⁴ is a neutral hydrophobic or neutral polar amino acid residue;

[0132]f⁷ is a neutral polar amino acid residue;

[0133]f⁸ is an acidic amino acid residue;

[0134]f⁹ is a neutral polar or acidic amino acid residue;

[0135]f¹⁰ is a neutral hydrophobic amino acid residue;

[0136]f¹¹ is a neutral hydrophobic amino acid residue;

[0137]fe¹³ is a neutral hydrophobic or neutral polar amino acid residue;

[0138]f¹⁴ is a neutral hydrophobic or neutral polar amino acid residue;

[0139]f¹⁵ is a neutral polar amino acid residue;

[0140]f¹⁶ is a neutral polar amino acid residue;

[0141]f¹⁷ is a neutral polar or acidic amino acid residue;

[0142]f¹⁸ is a neutral hydrophobic or basic amino acid residue;

[0143]f¹⁹ is a neutral hydrophobic or neutral polar amino acid residue; and

[0144]f²⁰ is a neutral hydrophobic or neutral polar amino acid residue;

[0145]and physiologically acceptable salts thereof.

[0146]In a preferred embodiment:

[0147]f¹ is S, A, or G;

[0148]f² is G, Q, or P;

[0149]f³ is Q, G, or D;

[0150]f⁴ is L, M, or Q;

[0151]f⁷ is C or Y;

[0152]f⁸ is E or D;

[0153]f⁹ is E, G, or D;

[0154]f¹⁰ is I or M;

[0155]f¹¹ is F or L;

[0156]f¹³ is C or W;

[0157]f¹⁴ is G or P;

[0158]f¹⁵ T or N;

[0159]f¹⁶ is Q, Y, or K;

[0160]f¹⁷ is N, D, or Q;

[0161]f¹⁸ is L, V, W, or R;

[0162]f¹⁹ is A, Q, Y, or I; and

[0163]f²⁰ is L, A, G, or V.

[0164]In a more preferred embodiment, the invention relates to a polypeptide comprising at least one amino acid sequence selected from the group consisting of SEQ ID NO: 3, and SEQ ID NO: 143 to SEQ ID NO: 148, inclusive, wherein the polypeptide is capable of binding to Ang-2, and physiologically acceptable salts thereof. SEQ ID NO: 3, and SEQ ID NO: 143 to SEQ ID NO: 148 are as follows.

TABLE-US-00012 Peptide SEQ ID NO. Sequence Con1-1 143 AGGMRPYDGMLGWPNYDVQA Con1-2 144 QTWDDPCMHILGPVTWRRCI Con1-3 145 APGQRPYDGMLGWPTYQRIV Con1-4 146 SGQLRPCEEIFGCGTQNLAL Con1-5 147 FGDKRPLECMFGGPIQLCPR Con1-6 148 GQDLRPCEDMFGCGTKDWYG Con1 3 KRPCEEIFGGCTYQ

[0165]In still another aspect, the invention relates to a polypeptide capable of binding Ang-2 comprising an amino acid sequence of the formula:

TABLE-US-00013 Cg²Gg⁴g⁵DPFTg¹⁰GCg¹³ (SEQ ID NO: 75)

wherein

[0166]g² is an acidic amino acid residue;

[0167]g⁴ is a neutral hydrophobic amino acid residue;

[0168]g⁵ is E, D, or Q;

[0169]g¹⁰ is a neutral hydrophobic or neutral polar amino acid residue;

[0170]g¹³ is an acidic residue; and physiologically acceptable salts thereof. In a preferred embodiment, g² is E or D. In another preferred embodiment, g⁴ is V or M. In yet another embodiment, g¹⁰ is F or Q. In still another embodiment, g¹³ is D or E.

[0171]The invention further relates to a polypeptide capable of binding Ang-2 comprising an amino acid sequence of the formula:

TABLE-US-00014 (SEQ ID NO: 158) h¹h²h³h⁴Ch⁶Gh⁸h⁹DPFTh¹⁴GCh¹⁷- h¹⁸h¹⁹h²⁰

wherein, [0172]h¹ is absent or a neutral hydrophobic, neutral polar, or a basic amino acid residue; [0173]h² is a neutral hydrophobic or neutral polar amino acid residue; [0174]h³ is an acidic amino acid residue; [0175]h⁴ is a neutral hydrophobic or neutral polar amino acid residue; [0176]h⁶ is an acidic amino acid residue; [0177]h⁸ is a neutral hydrophobic amino acid residue; [0178]h⁹ is E, D, or Q; [0179]h¹⁴ is a neutral hydrophobic or neutral polar amino acid residue; [0180]h¹⁷ is an acidic amino acid residue; [0181]h¹⁸ is a neutral hydrophobic, neutral polar, or a basic amino acid residue; [0182]h¹⁹ is a neutral hydrophobic or neutral polar amino acid residue; and [0183]h²⁰ is absent or an amino acid residue;

[0184]and physiologically acceptable salts thereof.

[0185]In a preferred embodiment,

[0186]h¹ is absent, or A, L, M, G, K, or H;

[0187]h² is L, F, or Q;

[0188]h³ is D or E;

[0189]h⁴ is W or Y;

[0190]h⁶ is D or E;

[0191]h⁸ is V or M;

[0192]h¹⁴ is F or Q;

[0193]h¹⁷ is D or E;

[0194]h¹⁸ is M, Y, N, or K;

[0195]h¹⁹ is L or Q; and

[0196]h²⁰ is absent or M, T, G, S, D, K, or R.

[0197]In a more preferred embodiment, the invention relates to a polypeptide comprising at least one amino acid sequence selected from the group consisting of SEQ ID NO: 5, or SEQ ID NO: 149 to SEQ ID NO: 157 inclusive, wherein said polypeptide is capable of binding to Ang-2, and physiologically acceptable salts thereof. SEQ ID NO: 5, and SEQ ID NO: 149 to SEQ ID NO: 157 are set forth below.

TABLE-US-00015 Peptide SEQ ID NO: Sequence 12-9-1 149 GFEYCDGMEDPFTFGCDKQT 12-9-2 150 KLEYCDGMEDPFTQGCDNQS 12-9-3 151 LQEWCEGVEDPFTFGCEKQR 12-9-4 152 AQDYCEGMEDPFTFGCEMQK 12-9-5 153 LLDYCEGVQDPFTFGCENLD 12-9-6 154 HQEYCEGMEDPFTFGCEYQG 12-9-7 155 MLDYCEGMDDPFTFGCDKQM 12-9-C2 156 LQDYCEGVEDPFTFGCENQR 12-9-C1 157 LQDYCEGVEDPFTFGCEKQR 12-9 5 FDYCEGVEDPFTFGCDNH

[0198]In a highly preferred embodiment, the invention relates to a a composition of matter having the formula:

(X¹)_q--F¹--(X²)_r

[0199]and multimers thereof, wherein:

[0200]F¹ is a vehicle;

[0201]X¹ and X² are each independently selected from [0202]-(L¹)_s-P¹; [0203]-(L¹)_s-P¹-(L²)_t-P²; [0204]-(L¹)_s-P¹-(L²)_t-P²-(L³)_u-P.- sup.3; and [0205]-(L¹)_r-P¹-(L²)_t-P²-(L³- )_u-P³-(L⁴)_v-P⁴;

[0206]wherein one or more of P¹, P², P³, and P⁴ each independently comprise a polypeptide selected from the group consisting of:

[0207](a) the amino acid sequence WDPWT (SEQ ID NO: 65), wherein said polypeptide is from 5 to 50 amino acids in length;

[0208](b) the amino acid sequence WDPWTC (SEQ ID NO: 66);

[0209](c) the amino acid sequence Cz²WDPWT (SEQ ID NO: 67), wherein z² is an acidic or neutral polar amino acid residue;

[0210](d) the amino acid sequence Cz²WDPWTC (SEQ ID NO: 68), wherein z² is an acidic or neutral polar amino acid residue;

[0211](e) the amino acid sequence Pc²Dc⁴Lc⁶c⁷c⁸LY (SEQ ID NO: 71) wherein c² is a neutral hydrophobic amino acid residue; c⁴ is A, D, or E; c⁶ is an acidic amino acid residue; c⁷ is an amino acid residue; and c⁸ is a neutral hydrophobic, neutral polar, or basic amino acid residue;

[0212](f) the amino acid sequence RPe³e⁴e⁵e⁶e⁷G (SEQ ID NO: 73) wherein e³ is a neutral polar amino acid residue; e⁴ is an acidic amino acid residue; e⁵ is a neutral polar or an acidic amino acid residue; e⁶ is a neutral hydrophobic amino acid residue; and e⁷ is a neutral hydrophobic amino acid residue;

[0213](g) the amino acid sequence Cg²Gg⁴g⁵DPFTg¹⁰GCg¹³ (SEQ ID NO: 75) wherein g² is an acidic amino acid residue; g⁴ is a neutral hydrophobic amino acid residue; g⁵ is a neutral polar or an acidic amino acid residue; g¹⁰ is a neutral hydrophobic or neutral polar amino acid residue; and g¹³ is an acidic residue;

[0214](h) A polypeptide of SEQ ID NO: 1;

[0215](i) A polypeptide of SEQ ID NO: 2; and

[0216](j) A polypeptide of SEQ ID NO: 7;

[0217]wherein L¹, L², L³, and L⁴ are each independently linkers; and q, r, s, t, u, and v are each independently 0 or 1, provided that at least one of q and r is 1; and physiologically acceptable salts thereof.

[0218]It will be appreciated that the invention further relates to a fusion polypeptide comprising at least one peptide described as described herein and a vehicle, wherein the fusion polypeptide is capable of binding to Ang-2, and physiologically acceptable salts thereof. In the fusion polypeptide, the vehicle is preferably at least one of an Fc domain, polyethylene glycol, a lipid, a cholesterol group, a carbohydrate, and an oligosaccharide. Other suitable vehicles, such as albumin and the like, will be appreciated by those skilled in the art, and are encompassed within the scope of the invention.

[0219]One skilled in the art will recognize that various molecules can be inserted into specific binding agent structure. Thus a given molecule can be inserted, for example, between the peptide and vehicle portions of the specific binding agents, or inserted within the peptide portion itself, while retaining the desired activity of specific binding agent. One can readily insert for example, molecules such as an Fc domain or fragment thereof, polyethylene glycol or other related molecules such as dextran, a fatty acid, a lipid, a cholesterol group, a small carbohydrate, a peptide, a cyotoxic agent, a chemotherapeutic agent, a detectable moiety as described herein (including fluorescent agents, radiolabels such as radioisotopes), an oligosaccharide, oligonucleotide, a polynucleotide, interference (or other) RNA, enzymes, hormones, or the like. Other molecules suitable for insertion in this fashion will be appreciated by those skilled in the art, and are encompassed within the scope of the invention. This includes insertion of, for example, a desired molecule in between two consecutive amino acids, optionally joined by a suitable linker. By way of example, in the Con4(C) peptibody sequence:

TABLE-US-00016 M-Fc-GGGGGAQQEECEWDPWTCEHMLE (SEQ ID NO: 23)

[0220]one skilled in the art could readily insert a desired molecule between, for example, the two adjacent glutamine ("QQ") residues to achieve a desired structure and/or function, while retaining the ability of the peptide to bind Ang-2. Thus, this sequence could be modified as follows:

TABLE-US-00017 M-Fc-GGGGGAQ-[molecule]-QEECEWDPWTCEHMLE

[0221]Suitable linker molecules can be added if desired. It will further be appreciated that the molecule can be inserted in a number of locations on the molecule, including on suitable side chains, between the vehicle and peptide sequence as follows:

TABLE-US-00018 M-Fc-[molecule]-GGGGGAQQEECEWDPWTCEHMLE

[0222]or in any other location desired by one skilled in the art. Other suitable embodiments will be apparent to those skilled in the art.

[0223]In still another embodiment, the invention relates to a polynucleotide encoding the specific binding agents (including, but not limited to peptides and/or peptibodies) of the invention, as described herein. One skilled in the art will appreciate that where the amino acid sequence is known, the corresponding nucleotide sequence(s) can be readily determined using known techniques. See for example Suzuki, D., An Introduction to Genetic Analysis, W.H. Freeman Pub. Co. (1986). Exemplary nucleotide sequences encoding peptides of the invention are set forth below. One skilled in the art will recognize that more than one codon can encode for a given amino acid, and therefore the invention relates to any nucleotide sequence which encodes the peptides and/or peptibodies of the invention.

TABLE-US-00019 Seq. Id Exemplary DNA Peptide No. Peptide Sequence Sequence Con4-44 76 PIRQEECDWDPWTCEHMWEV ccgatccgtcaggaagaatgcga ctgggacccgtggacctgcgaac acatgtgggaagtt (SEQ ID NO: 159) Con4-40 77 TNIQEECEWDPWTCDHMPGK accaacatccaggaagaatgcga atgggacccgtggacctgcgacc acatgccgggtaaa (SEQ ID NO: 160) Con4-4 78 WYEQDACEWDPWTCEHMAEV tggtacgaacaggacgcttgcga atgggacccgtggacctgcgaac acatggctgaagtt (SEQ ID NO: 161) Con4-31 79 NRLQEVCEWDPWTCEHMENV aaccgtctgcaggaagtttgcgaa tgggacccgtggacctgcgaaca catggaaaacgtt (SEQ ID NO: 162) Con4- 80 AATQEECEWDPWTCEHMPRS gctgctacccaggaagaatgcga C5 atgggacccgtggacctgcgaac acatgccgcgttcc (SEQ ID NO: 163) Con4-42 81 LRHQEGCEWDPWTCEHMFDW ctgcgtcaccaggaaggttgcga atgggacccgtggacctgcgaac acatgttcgactgg (SEQ ID NO: 164) Con4-35 82 VPRQKDCEWDPWTCEHMYVG gttccgcgtcagaaagactgcga atgggacccgtggacctgcgaac acatgtacgttggt (SEQ ID NO: 165) Con4-43 83 SISHEECEWDPWTCEHMQVG tccatctcccacgaagaatgcgaa tgggacccgtggacctgcgaaca catgcaggttggt (SEQ ID NO: 360) Con4-49 84 WAAQEECEWDPWTCEHMGRM tgggctgctcaggaagaatgcga atgggatccgtggacttgcgaaca catgggtcgtatg (SEQ ID NO: 166) Con4-27 85 TWPQDKCEWDPWTCEHMGST acttggccgcaggacaaatgcga atgggatccgtggacttgcgaaca catgggttctact (SEQ ID NO: 167) Con4-48 86 GHSQEECGWDPWTCEHMGTS ggtcactcccaggaagaatgcgg ttgggacccgtggacctgcgaac acatgggtacgtcc (SEQ ID NO: 168) Con4-46 87 QHWQEECEWDPWTCDHMPSK cagcactggcaggaagaatgcga atgggacccgtggacctgcgacc acatgccgtccaaa (SEQ ID NO: 169) Con4-41 88 NVRQEKCEWDPWTCEHMPVR aacgttcgtcaggaaaaatgcgaa tgggacccgtggacctgcgaaca catgccggttcgt (SEQ ID NO: 170) Con4-36 89 KSGQVECNWDPWTCEHMPRN aaatccggtcaggttgaatgcaac tgggacccgtggacctgcgaaca catgccgcgtaac (SEQ ID NO: 171) Con4-34 90 VKTQEHCDWDPWTCEHMREW gttaaaacccaggaacactgcga ctgggacccgtggacctgcgaac acatgcgtgaatgg (SEQ ID NO: 172) Con4-28 91 AWGQEGCDWDPWTCEHMLPM gcttggggtcaggaaggttgcga ctgggacccgtggacctgcgaac acatgctgccgatg (SEQ ID NO: 173) Con4-39 92 PVNQEDCEWDPWTCEHMPPM ccggttaaccaggaagactgcga atgggacccgtggacctgcgaac acatgccgccgatg (SEQ ID NO: 174) Con4-25 93 RAPQEDCEWDPWTCAHMDIK cgtgctccgcaggaagactgcga atgggacccgtggacctgcgctc acatggacatcaaa (SEQ ID NO: 175) Con4-50 94 HGQNMECEWDPWTCEHMFRY cacggtcagaacatggaatgcga atgggacccgtggacctgcgaac acatgttccgttac (SEQ ID NO: 176) Con4-38 95 PRLQEECVWDPWTCEHMPLR ccgcgtctgcaggaagaatgcgtt tgggacccgtggacctgcgaaca catgccgctgcgt (SEQ ID NO: 177) Con4-29 96 RTTQEKCEWDPWTCEHMESQ cgtaccacccaggaaaaatgcga atgggacccgtggacctgcgaac acatggaatcccag (SEQ ID NO: 178) Con4-47 97 QTSQEDCVWDPWTCDHMVSS cagacctcccaggaagactgcgtt tgggacccgtggacctgcgacca catggtttcctcc (SEQ ID NO: 179) Con4-20 98 QVIGRPCEWDPWTCEHLEGL caggttatcggtcgtccgtgcgaa tgggacccgtggacctgcgaaca cctggaaggtctg (SEQ ID NO: 180) Con4-45 99 WAQQEECAWDPWTCDHMVGL tgggctcagcaggaagaatgcgc ttgggacccgtggacctgcgacc acatggttggtctg (SEQ ID NO: 181) Con4-37 100 LPGQEDCEWDPWTCEHMVRS ctgccgggtcaggaagactgcga atgggacccgtggacctgcgaac acatggttcgttcc (SEQ ID NO: 182) Con4-33 101 PMNQVECDWDPWTCEHMPRS ccgatgaaccaggttgaatgcga ctgggacccgtggacctgcgaac acatgccgcgttcc (SEQ ID NO: 183) AC2- 102 FGWSHGCEWDPWTCEHMGST ttcggttggtctcacggttgcgaat Con4 gggatccgtggacttgcgaacac atgggttctacc (SEQ ID NO: 184) Con4-32 103 KSTQDDCDWDPWTCEHMVGP aaatccacccaggacgactgcga ctgggacccgtggacctgcgaac acatggttggtccg (SEQ ID NO: 185) Con4-17 104 GPRISTCQWDPWTCEHMDQL ggtccgcgtatctccacctgccag tgggacccgtggacctgcgaaca catggaccagctg (SEQ ID NO: 186) Con4-8 105 STIGDMCEWDPWTCAHMQVD tccaccatcggtgacatgtgcgaa tgggacccgtggacctgcgctca catgcaggttgac (SEQ ID NO: 187) AC4- 106 VLGGQGCEWDPWTCRLLQGW gttctgggtggtcagggttgcgaa Con4 tgggacccgtggacctgccgtctg ctgcagggttgg (SEQ ID NO: 188) Con4-1 107 VLGGQGCQWDPWTCSHLEDG gttctgggtggtcagggttgccag tgggacccgtggacctgctccca cctggaagacggt (SEQ ID NO: 189) Con4- 108 TTIGSMCEWDPWTCAHMQGG accaccatcggttccatgtgcgaa C1 tgggacccgtggacctgcgctca catgcagggtggt (SEQ ID NO: 190) Con4-21 109 TKGKSVCQWDPWTCSHMQSG accaaaggtaaatccgtttgccag tgggacccgtggacctgctccca catgcagtccggt (SEQ ID NO: 191) Con4- 110 TTIGSMCQWDPWTCAHMQGG accaccatcggttccatgtgccag C2 tgggacccgtggacctgcgctca catgcagggtggt (SEQ ID NO: 192) Con4-18 111 WVNEVVCEWDPWTCNHWDTP tgggttaacgaagttgtttgcgaat gggacccgtggacctgcaaccac tgggacaccccg (SEQ ID NO: 193) Con4-19 112 VVQVGMCQWDPWTCKHMRLQ gttgttcaggttggtatgtgccagt gggacccgtggacctgcaaacac atgcgtctgcag (SEQ ID NO: 194) Con4-16 113 AVGSQTCEWDPWTCAHLVEV gctgttggttcccagacctgcgaat gggacccgtggacctgcgctcac ctggttgaagtt (SEQ ID NO: 195) Con4-11 114 QGMKMFCEWDPWTCAHIVYR cagggtatgaaaatgttctgcgaat gggacccgtggacctgcgctcac atcgtttaccgt (SEQ ID NO: 196) Con4- 115 TTIGSMCQWDPWTCEHMQGG accaccatcggttccatgtgccag C4 tgggacccgtggacctgcgaaca catgcagggtggt (SEQ ID NO: 197) Con4-23 116 TSQRVGCEWDPWTCQHLTYT acctcccagcgtgttggttgcgaat gggacccgtggacctgccagcac ctgacctacacc (SEQ ID NO: 198) Con4-15 117 QWSWPPCEWDPWTCQTVWPS cagtggtcctggccgccgtgcga atgggacccgtggacctgccaga ccgtttggccgtcc (SEQ ID NO: 199) Con4-9 118 GTSPSFCQWDPWTCSHMVQG ggtacctccccgtccttctgccagt gggacccgtggacctgctcccac atggttcagggt (SEQ ID NO: 200) TN8- 4 QEECEWDPWTCEHM caggaagaatgcgaatgggaccc Con4 atggacttgcgaacacatg (SEQ ID NO: 201) L1-1 119 QNYKPLDELDATLYEHFIFHYT cagaactacaaaccgctggacga actggacgctaccctgtacgaaca cttcatcttccactacacc (SEQ ID NO: 202) L1-2 120 LNFTPLDELEQTLYEQWTLQQS ctgaacttcaccccgctggacgaa ctggaacagaccctgtacgaaca gtggaccctgcagcagtcc (SEQ ID NO: 203) L1-3 121 TKFNPLDELEQTLYEQWTLQHQ accaaattcaacccgctggacga actggaacagaccctgtacgaac agtggaccctgcagcaccag (SEQ ID NO: 204) L1-4 122 VKFKPLDALEQTLYEHWMFQQA gttaaattcaaaccgctggacgct ctggaacagaccctgtacgaaca ctggatgttccagcaggct (SEQ ID NO: 205) L1-5 123 VKYKPLDELDEILYEQQTFQER gttaaatacaaaccgctggacgaa ctggacgaaatcctgtacgaacag cagaccttccaggaacgt (SEQ ID NO: 206)

L1-7 124 TNFMPMDDLEQRLYEQFILQQG accaacttcatgccgatggacgac ctggaacagcgtctgtacgaaca gttcatcctgcagcagggt (SEQ ID NO: 207) L1-9 125 SKFKPLDELEQTLYEQWTLQHA tccaaattcaaaccgctggacgaa ctggaacagaccctgtacgaaca gtggaccctgcagcacgct (SEQ ID NO: 208) L1-10 126 QKFQPLDELEQTLYEQFMLQQA cagaaattccagccgctggacga actggaacagaccctgtacgaac agttcatgctgcagcaggct (SEQ ID NO: 209) L1-11 127 QNFKPMDELEDTLYKQFLFQHS cagaacttcaaaccgatggacga attggaagacaccctgtacaaaca gttcctgttccagcactcc (SEQ ID NO: 210) L1-12 128 YKFTPLDDLEQTLYEQWTLQHV tacaaattcaccccgctggacgac ctggaacagaccctgtacgaaca gtggaccctgcagcacgtt (SEQ ID NO: 211) L1-13 129 QEYEPLDELDETLYNQWMFHQR caggaatacgaaccgctggacga actggacgaaaccctgtacaacc agtggatgttccaccagcgt (SEQ ID NO: 212) L1-14 130 SNFMPLDELEQTLYEQFMLQHQ tccaacttcatgccgctggacgaa ctggaacagaccctgtacgaaca gttcatgctgcagcaccag (SEQ ID NO: 213) L1-15 131 QKYQPLDELDKTLYDQFMLQQG cagaaataccagccgctggacga actggacaaaaccctgtacgatca gttcatgctgcagcagggt (SEQ ID NO: 214) L1-16 132 QKFQPLDELEETLYKQWTLQQR cagaaattccagccgctggacga actggaagaaaccctgtacaaac agtggaccctgcagcagcgt (SEQ ID NO: 215) L1-17 133 VKYKPLDELDEWLYHQFTLHHQ gttaaatacaaaccgctggacgaa ctggacgaatggctgtaccacca gttcaccctgcaccaccag (SEQ ID NO: 216) L1-18 134 QKFMPLDELDEILYEQFMFQQS cagaaattcatgccgctggacgaa ctggacgaaatcctgtacgaacag ttcatgttccagcagtccc (SEQ ID NO: 217) L1-19 135 QTFQPLDDLEEYLYEQWIRRYH cagaccttccagccgctggacga cctggaagaatacttgtacgaaca gtggatccgtcgttaccac (SEQ ID NO: 218) L1-20 136 EDYMPLDALDAQLYEQFILLHG gaagactacatgccgctggacgc tctggacgctcagctgtacgaaca gttcatcctgctgcacggt (SEQ ID NO: 219) L1-21 137 HTFQPLDELEETLYYQWLYDQL cacaccttccagccgctggacga actggaagaaaccctgtactacca gtggctgtacgaccagctg (SEQ ID NO: 220) L1-22 138 YKFNPMDELEQTLYEEFLFQHA tacaaattcaacccgatggacgaa ctggaacagaccctgtacgaaga attcctgttccagcacgct (SEQ ID NO: 221) AC6-L1 139 TNYKPLDELDATLYEHWILQHS accaactacaaaccgctggacga actggacgctaccctgtacgaaca ctggatcctgcagcactcc (SEQ ID NO: 222) L1-C1 140 QKFKPLDELEQTLYEQWTLQQR cagaaattcaaaccgctggacga actggaacagaccctgtacgaac agtggaccctgcagcagcgt (SEQ ID NO: 223) L1-C2 141 TKFQPLDELDQTLYEQWTLQQR accaaattccagccgctggacga actggaccagaccctgtacgaac agtggaccctgcagcagcgt (SEQ ID NO: 224) L1-C3 142 TNFQPLDELDQTLYEQWTLQQR accaacttccagccgctggacga actggaccagaccctgtacgaac agtggaccctgcagcagcgt (SEQ ID NO: 225) L1 6 KFNPLDELEETLYEQFTFQQ aaattcaacccgctggacgagctg gaagagactctgtacgaacagttt acttttcaacag (SEQ ID NO: 226) Con1-1 143 AGGMRPYDGMLGWPNYDVQA gctggtggtatgcgtccgtacgac ggtatgctgggttggccgaactac gacgttcaggct (SEQ ID NO: 227) Con1-2 144 QTWDDPCMHILGPVTWRRCI cagacttgggacgatccgtgcatg cacattctgggtccggttacttggc gtcgttgcatc (SEQ ID NO: 228) Con1-3 145 APGQRPYDGMLGWPTYQRIV gctccgggtcagcgtccgtacga cggtatgctgggttggccgaccta ccagcgtatcgtt (SEQ ID NO: 229) Con1-4 146 SGQLRPCEEIFGCGTQNLAL tccggtcagctgcgtccgtgcgaa gaaatcttcggttgcggtacccag aacctggctctg (SEQ ID NO: 230) Con1-5 147 FGDKRPLECMFGGPIQLCPR ttcggtgacaaacgtccgctggaa tgcatgttcggtggtccgatccag ctgtgcccgcgt (SEQ ID NO: 231) Con1-6 148 GQDLRPCEDMFGCGTKDWYG ggtcaggacctgcgtccgtgcga agacatgttcggttgcggtaccaa agactggtacggt (SEQ ID NO: 232) 12-9-1 149 GFEYCDGMEDPFTFGCDKQT ggtttcgaatactgcgacggtatg gaagacccgttcaccttcggttgc gacaaacagacc (SEQ ID NO: 233) 12-9-2 150 KLEYCDGMEDPFTQGCDNQS aaactggaatactgcgacggtatg gaagacccgttcacccagggttg cgacaaccagtcc (SEQ ID NO: 234) 12-9-31 51 LQEWCEGVEDPFTFGCEKQR ctgcaggaatggtgcgaaggtgtt gaagacccgttcaccttcggttgc gaaaaacagcgt (SEQ ID NO: 235) 12-9-4 152 AQDYCEGMEDPFTFGCEMQK gctcaggactactgcgaaggtatg gaagacccgttcaccttcggttgc gaaatgcagaaa (SEQ ID NO: 236) 12-9-5 153 LLDYCEGVQDPFTFGCENLD ctgctggactactgcgaaggtgtt caggacccgttcaccttcggttgc gaaaacctggac (SEQ ID NO: 237) 12-9-6 154 HQEYCEGMEDPFTFGCEYQG caccaggaatactgcgaaggtat ggaagacccgttcaccttcggttg cgaataccagggt (SEQ ID NO: 238) 12-9-7 155 MLDYCEGMDDPFTFGCDKQM atgctggactactgcgaaggtatg gacgacccgttcaccttcggttgc gacaaacagatg (SEQ ID NO: 239) 12-9-C2 156 LQDYCEGVEDPFTFGCENQR ctgcaggactactgcgaaggtgtt gaagacccgttcaccttcggttgc gaaaaccagcgt (SEQ ID NO: 240) 12-9-C1 157 LQDYCEGVEDPFTFGCEKQR ctgcaggactactgcgaaggtgtt gaagacccgttcaccttcggttgc gaaaaacagcgt (SEQ ID NO: 241) 12-9 5 FDYCEGVEDPFTFGCDNH ttcgactactgcgaaggtgttgaa gacccgttcactttcggctgtgata accac (SEQ ID NO: 242)

[0224]In still another embodiment, the invention relates to expression vectors comprising at least one polynucleotide of the invention. In another embodiment, the invention relates to host cells comprising the expression vector. It will be appreciated that the host cells are preferably prokaryotic cells (such as E. coli cells) or eukaryotic cells.

[0225]The invention also relates to a pharmaceutical composition comprising an effective amount of a composition as described herein, in admixture with a pharmaceutically acceptable carrier.

[0226]The invention also relates to a method of inhibiting undesired angiogenesis in a mammal comprising administering a therapeutically effective amount of a polypeptide or composition as described herein. The invention also relates to a method of modulating angiogenesis in a mammal comprising administering a therapeutically effective amount of a polypeptide or composition as described herein. The invention further relates to a method of inhibiting tumor growth characterized by undesired angiogenesis in a mammal comprising administering a therapeutically effective amount of a polypeptide or composition as described herein. Additionally, the invention relates to a method of treating cancer in a mammal comprising administering a therapeutically effective amount of a polypeptide or composition as described herein, and a chemotherapeutic agent. In a preferred embodiment, the chemotherapeutic agent is at least one of 5-FU, CPT-11, and Taxotere. It will be appreciated, however, that other suitable chemotherapeutic agents and other cancer therapies can be used.

[0227]The invention also relates to a method of modulating at least one of vascular permeability or plasma leakage in a mammal comprising administering a therapeutically effective amount of a polypeptide or composition as described herein. The invention further relates to a method of treating at least one of ocular neovascular disease, obesity, hemangioblastoma, hemangioma, arteriosclerosis, inflammatory disease, inflammatory disorders, atherosclerosis, endometriosis, neoplastic disease, bone-related disease, or psoriasis in a mammal comprising administering a therapeutically effective amount of a polypeptide or composition as described herein.

[0228]It will be appreciated that the specific binding agents of the invention can be used to treat a number of diseases associated with deregulated or undesired angiogenesis. Such diseases include, but are not limited to, ocular neovascularisation, such as retinopathies (including diabetic retinopathy and age-related macular degeneration) psoriasis, hemangioblastoma, hemangioma, arteriosclerosis, inflammatory disease, such as a rheumatoid or rheumatic inflammatory disease, especially arthritis (including rheumatoid arthritis), or other chronic inflammatory disorders, such as chronic asthma, arterial or post-transplantational atherosclerosis, endometriosis, and neoplastic diseases, for example so-called solid tumors and liquid tumors (such as leukemias). Additional diseases which can be treated by administration of the specific binding agents will be apparent to those skilled in the art. Such additional diseases include, but are not limited to, obesity, vascular permeability, plasma leakage, and bone-related disorders, including osteoporosis. Thus, the invention further relates to methods of treating these diseases associated with deregulated or undesired angiogenesis.

[0229]Other embodiments of this invention will be readily apparent from the disclosure provided herewith.

BRIEF DESCRIPTION OF THE FIGURES

[0230]FIG. 1 depicts a graph of tumor volume (y-axis) versus time (x-axis) in A-431 tumor bearing mice treated with peptibody TN8-Con4-C of the present invention, or with phosphate buffered saline (PBS). Details are described in the Examples.

[0231]FIG. 2 depicts a graph of peptibody concentration (y-axis) versus time post-dose (x-axis) in wildtype mice treated with a 50 μg dose of either 2×Con4-C, L1-7-N, or L1-21-N peptibody. Details are described in the Examples.

[0232]FIG. 3 depicts a graph of tumor volume (y-axis) versus time (x-axis) in A431 tumor bearing mice treated with peptibody 2×Con4-C according to the present invention, or with phosphate buffered saline (PBS) or control peptibody. Details are described in the Examples.

[0233]FIG. 4 depicts a graph representing in vitro growth of cultured A431 cells treated with peptibody Con4-C according to the present invention, control peptibody, or untreated. Details are described in the Examples.

[0234]FIG. 5 depicts a graph of tumor volume (y-axis) versus time (x-axis) in Colo205 tumor cells treated with peptibody Con4-C, peptibody L1-7-N, peptibody L1-21-N, or peptibody 2×Con4-C according to the present invention, or with phosphate buffered saline (PBS), anti-Ang-2 antibody (Ab536), or Fc. Details are described in the Examples.

[0235]FIG. 6 depicts a graph of tumor volume (y-axis) versus time (x-axis) in Colo205 xenograft tumor bearing mice treated with varying doses of peptibody 2×Con4-C according to the present invention, or with phosphate buffered saline (PBS) or Fc. Details are described in the Examples.

[0236]FIG. 7 depicts a graph of tumor volume (y-axis) versus time (x-axis) in Colo205 xenograft tumor bearing mice treated with peptibody 2×Con4-C according to the present invention, or with control peptibodies. FIG. 7 also depicts a graph of CD31 stained area/total tumor area for these peptibodies. Details are described in the Examples.

[0237]FIG. 8 depicts a graph of tumor volume (y-axis) versus time (x-axis) in Colo205 xenograft tumor bearing mice treated with peptibody 2×Con4-C according to the present invention, or with phosphate buffered saline (PBS) or control peptibody. Details are described in the Examples. This graph shows that anti-Ang-2 peptibodies are capable of inhibiting Colo205 tumor growth irrespective of when dosing begins.

[0238]FIG. 9 depicts a summary of complete response (CR) rates obtained in female nude mice using antibody Ab536 or with peptibody 2×Con4-C, in both the A431 and Colo-205 xenograft models. Details are described in the Examples.

[0239]FIG. 10A depicts a graph of tumor volume (y-axis) versus time (x-axis) in Colo205 xenograft tumor bearing mice treated with peptibody 2×Con4-C according to the present invention, or a combination of 2×Con4-C and taxotere, or with phosphate buffered saline (PBS), or with PBS plus taxotere. Details are described in the Examples.

[0240]FIG. 10B depicts a graph of tumor volume (y-axis) versus time (x-axis) in Colo205 xenograft tumor bearing mice treated with peptibody 2×Con4-C according to the present invention, or a combination of 2×Con4-C and 5-FU, or with phosphate buffered saline (PBS), or with PBS plus 5-FU. Details are described in the Examples.

[0241]FIG. 11A depicts a graph of paw swelling levels (AUC±SE) in an adjuvant-induced arthritis model in rats treated with peptibody 2×Con4-C according to the present invention, or with phosphate buffered saline (PBS), or with control peptibody, or normal or arthritis controls. Details are described in the Examples.

[0242]FIG. 11B depicts a graph of paw bone mineral density (BMD) in an adjuvant-induced arthritis model in rats treated with peptibody 2×Con4-C according to the present invention, or with phosphate buffered saline (PBS), or with control peptibody, or normal or arthritis controls. Details are described in the Examples.

[0243]FIG. 11c depicts a graph of change in body weight in an adjuvant-induced arthritis model in rats treated with peptibody 2×Con4-C according to the present invention, or with phosphate buffered saline (PBS), or with control peptibody, or normal or arthritis controls. Details are described in the Examples.

[0244]FIG. 12 depicts two graphs depicting inhibition of VEGF-induced corneal angiogenesis in rats. The first graph depicts number of blood vessels measured in rats treated with bovine serum albumin (BSA), VEGF plus phosphate buffered saline (PBS), or VEGF plus peptibody Con4-C of the invention. The second graph depicts blood vessel area (mm2) in rats treated with BSA, VEGF plus phosphate buffered saline (PBS), or VEGF plus peptibody Con4-C of the invention. Details are described in the Examples.

[0245]FIGS. 13A, 13B, and 13C depict epitope mapping data (O.D. 370) for full-length human Ang-2 (hAng-2), to the N-terminus of hAng-2, and to the C-terminus of hAng-2, respectively, for peptibodies TN8-Con4-C, L1-7-N, and 12-9-3-C according to the invention, as well as for control peptibody, Tie2-Fc, C2B8, or 5B12. Details are described in the Examples.

[0246]FIG. 14 depicts binding affinity (K_D) of the 2×Con-4-C peptibody according to the invention, using the Sapidyne KinExA assay. Details are described in the Examples.

DETAILED DESCRIPTION OF INVENTION

[0247]The section headings are used herein for organizational purposes only, and are not to be construed as in any way limiting the subject matter described.

[0248]Standard techniques may be used for recombinant DNA molecule, protein, and antibody production, as well as for tissue culture and cell transformation. Enzymatic reactions and purification techniques are typically performed according to the manufacturer's specifications or as commonly accomplished in the art using conventional procedures such as those set forth in Sambrook et al. (Molecular Cloning: A Laboratory Manual. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. [1989]), or as described herein. Unless specific definitions are provided, the nomenclature utilized in connection with, and the laboratory procedures and techniques of analytical chemistry, synthetic organic chemistry, and medicinal and pharmaceutical chemistry described herein are those well known and commonly used in the art. Standard techniques may be used for chemical syntheses, chemical analyses, pharmaceutical preparation, formulation, and delivery, and treatment of patients.

DEFINITIONS

[0249]The terms used throughout this specification are defined as follows, unless otherwise limited in specific instances.

[0250]The term "Ang-2" refers to the polypeptide set forth in FIG. 6 of U.S. Pat. No. 6,166,185 ("Tie-2 ligand-2") or fragments thereof as well as related polypeptides which include allelic variants, splice variants, derivatives, substitution, deletions, and/or insertion variants, fusion peptides and polypeptides, and interspecies homologs. The Ang-2 polypeptide may or may not include additional terminal residues, e.g., leader sequences, targeting sequences, amino terminal methionine, amino terminal methionine and lysine residues, and/or tag or fusion proteins sequences, depending on the manner in which it is prepared.

[0251]The term "biologically active" when used in relation to Ang-2 or an Ang-2 specific binding agent refers to a peptide or polypeptide having at least one activity characteristic of Ang-2 or of an Ang-2 specific binding agent. A specific binding agent of Ang-2 may have agonist, antagonist, or neutralizing or blocking activity with respect to at least one biological activity of Ang-2.

[0252]The term "specific binding agent" refers to a molecule, preferably a proteinaceous molecule, that specifically binds Ang-2, and variants and derivatives thereof, as defined herein. A specific binding agent may be a protein, peptide, nucleic acid, carbohydrate, lipid, or small molecular weight compound which binds preferentially to Ang-2. In a preferred embodiment, the specific binding agent according to the present invention is a peptide or a peptibody, as well as fragments, variants or derivatives thereof, either alone or in combination with other amino acid sequences, provided by known techniques. Such techniques include, but are not limited to enzymatic cleavage, chemical cleavage, peptide synthesis or recombinant techniques. The anti-Ang-2 specific binding agents of the present invention are capable of binding portions of Ang-2 that modulate, e.g., inhibit or promote, the biological activity of Ang-2 and/or other Ang-2-associated activities.

[0253]The term "variants," as used herein, include those peptides and polypeptides wherein amino acid residues are inserted into, deleted from and/or substituted into the naturally occurring (or at least a known) amino acid sequence for the binding agent. Variants of the invention include fusion proteins as described below.

[0254]"Derivatives" include those binding agents that have been chemically modified in some manner distinct from insertion, deletion, or substitution variants.

[0255]"Specifically binds Ang-2" refers to the ability of a specific binding agent (such as a peptibody, or peptide portion thereof) of the present invention to recognize and bind mature, full-length or partial-length human Ang-2 polypeptide, or an ortholog thereof, such that its affinity (as determined by, e.g., Affinity ELISA or BIAcore assays as described herein) or its neutralization capability (as determined by e.g., Neutralization ELISA assays described herein, or similar assays) is at least 10 times as great, but optionally 50 times as great, 100, 250 or 500 times as great, or even at least 1000 times as great as the affinity or neutralization capability of the same for any other angiopoietin or other peptide or polypeptide, wherein the peptide portion of the peptibody is first fused to a human Fc moiety for evaluation in such assay.

[0256]The term "epitope" refers to that portion of any molecule capable of being recognized by and bound by a specific binding agent, e.g., a peptibody, at one or more of the binding agent's antigen binding regions. Epitopes usually consist of chemically active surface groupings of molecules, such as for example, amino acids or carbohydrate side chains, and have specific three-dimensional structural characteristics as well as specific charge characteristics. Epitopes as used herein may be contiguous or non-contiguous.

[0257]The term "inhibiting and/or neutralizing epitope" is an epitope, which when bound by a specific binding agent such as a peptibody, results in the loss of (or at least the decrease in) biological activity of the molecule, cell, or organism containing such epitope, in vivo, in vitro, or in situ. In the context of the present invention, the neutralizing epitope is located on or is associated with a biologically active region of Ang-2. Alternatively, the term "activating epitope" is an epitope, which when bound by a specific binding agent of the invention, such as an antibody, results in activation, or at least maintenance of a biologically active conformation, of Ang-2.

[0258]The term "peptibody fragment" refers to a peptide or polypeptide which comprises less than a complete, intact peptibody.

[0259]The term "naturally occurring" when used in connection with biological materials such as nucleic acid molecules, polypeptides, host cells, and the like, refers to those which are found in nature and not modified by a human being.

[0260]The term "isolated" when used in relation to Ang-2 or to a specific binding agent of Ang-2 refers to a compound that is free from at least one contaminating polypeptide or compound that is found in its natural environment, and preferably substantially free from any other contaminating mammalian polypeptides that would interfere with its therapeutic or diagnostic use.

[0261]The term "mature" when used in relation to Ang-2 peptibody or a fragment thereof, or to any other proteinaceous specific binding agent of Ang-2 refers to a peptide or a polypeptide lacking a leader or signal sequence. When a binding agent of the invention is expressed, for example, in a prokaryotic host cell, the "mature" peptide or polypeptide may also include additional amino acid residues (but still lack a leader sequence) such as an amino terminal methionine, or one or more methionine and lysine residues. A peptide or polypeptide produced in this manner may be utilized with or without these additional amino acid residues having been removed.

[0262]The terms "effective amount" and "therapeutically effective amount" when used in relation to a specific binding agent of Ang-2 refers to an amount of a specific binding agent that is useful or necessary to support an observable change in the level of one or more biological activities of Ang-2. The change may be either an increase or decrease in the level of Ang-2 activity. Preferably, the change is a decrease in Ang-2 activity.

[0263]The term "peptibody" refers to a molecule comprising an antibody Fc domain attached to at least one peptide. The production of peptibodies is generally described in PCT publication WO 00/24782, published May 4, 2000.

[0264]The term "variants," as used herein, include those molecules such as peptides or peptide-vehicle combinations such as peptibodies of the present invention wherein amino acid residues are inserted into, deleted from and/or substituted into amino acid sequence for such molecules. Variants having one or more amino acids inserted include fusion proteins as described below.

[0265]"Derivatives" include those peptides and/or peptide-vehicle combinations such as peptibodies that have been chemically modified in some manner distinct from insertion, deletion, or substitution variants.

[0266]The term "fragment" refers to a peptide or peptide-vehicle combination that comprises less than the full-length amino acid sequence of such peptides and/or peptide-vehicle combinations. Such a fragment may arise, for example, from a truncation at the amino terminus, a truncation at the carboxy-terminus, and/or an internal deletion of a residue(s) from the amino acid sequence of the peptide or peptide-vehicle combination. Fragments may result from alternative RNA splicing or from in vivo or in vitro protease activity. Such fragments may also be constructed by chemical peptide synthesis methods, or by modifying a polynucleotide encoding a peptide, peptide-vehicle combination, or an Fc portion and/or peptide portion of a peptibody.

[0267]The term "Fc" refers to one type of vehicle of the present invention, and comprises the sequence of a non-antigen-binding fragment of an antibody resulting from the proteolytic digestion of a whole antibody, whether in monomeric or multimeric form. The source of the Fc in the present invention is preferably fully human Fc, and may be any of the immunoglobulins, although IgG1 and IgG2 are preferred. However, Fc molecules that are partially human, or obtained from non-human species are also included herein. Fc's are made up of monomeric polypeptides that may be linked into dimeric or multimeric forms by covalent (i.e., disulfide bonds) and non-covalent association. The number of intermolecular disulfide bonds between monomeric subunits of native Fc molecules ranges from 1 to 4 depending on class (e.g., IgG, IgA, IgE) or subclass (e.g., IgG1, IgG2, IgG3, IgA1, IgGA2). One example of a native Fc is a disulfide-bonded dimer resulting from papain digestion of an IgG [see Ellison et al. (1982), Nucl. Acids. Res. 10: 4071-9]. The term "native Fc" as used herein is generic to the monomeric, dimeric, and multimeric forms.

[0268]The term "Fc domain" encompasses native Fc and Fc variant molecules and sequences as defined above. As with Fc variants and native Fc's, the term "Fc domain" includes molecules in monomeric or multimeric form, whether digested from whole antibody or produced by other means.

[0269]The term "multimer" as applied to Fc domains or molecules comprising Fc domains refers to molecules having two or more polypeptide chains associated covalently, noncovalently, or by both covalent and non-covalent interactions. IgG molecules typically form dimers; IgM, pentamers; IgD, dimers; and IgA, monomers, dimers, trimers, or tetramers. Multimers may be formed by exploiting the sequence and resulting activity of the native Ig source of the Fc or by derivatizing (as defined below) such a native Fc.

[0270]The term "dimer" as applied to Fc domains or molecules comprising Fc domains refers to molecules having two polypeptide chains associated covalently or non-covalently.

[0271]The term "vehicle" refers to a molecule that prevents degradation and/or increases half-life, reduces toxicity, reduces immunogenicity, or increases biological activity of a therapeutic protein. Exemplary vehicles include an Fc domain as well as a linear polymer (e.g., polyethylene glycol (PEG), polylysine, dextran, etc.); a branched-chain polymer (See, for example, U.S. Pat. No. 4,289,872 to Denkenwalter et al., issued Sep. 15, 1981; U.S. Pat. No. 5,229,490 to Tam, issued Jul. 20, 1993; WO 93/21259 by Frechet et al., published 28 Oct. 1993); a lipid; a cholesterol group (such as a steroid); a carbohydrate or oligosaccharide; or any natural or synthetic protein, polypeptide or peptide that binds to a salvage receptor. Vehicles are further described hereinafter.

[0272]The terms "derivatizing" and "derivative" or "derivatized" comprise processes and resulting compounds respectively in which (1) the compound has a cyclic portion; for example, cross-linking between cysteinyl residues within the compound; (2) the compound is cross-linked or has a cross-linking site; for example, the compound has a cysteinyl residue and thus forms cross-linked dimers in culture or in vivo; (3) one or more peptidyl linkage is replaced by a non-peptidyl linkage; (4) the N-terminus is replaced by --NRR1, NRC(O)R1, --NRC(O)OR1, --NRS(O)2R1, --NHC(O)NHR, a succinimide group, or substituted or unsubstituted benzyloxycarbonyl-NH--, wherein R and R1 and the ring substituents are as defined hereinafter; (5) the C-terminus is replaced by --C(O)R2 or --NR3R4 wherein R2, R3 and R4 are as defined hereinafter; and (6) compounds in which individual amino acid moieties are modified through treatment with agents capable of reacting with selected side chains or terminal residues. Derivatives are further described hereinafter.

[0273]The term "peptide" refers to molecules of about 3 to about 75 amino acids, with molecules of about 5 to 50 amino acids preferred, 8 to 40 more preferred, and those of about 10 to 25 amino acids most preferred. Peptides may be naturally occurring or artificial (i.e., non-naturally occurring) amino acid sequences. Exemplary peptides may be generated by any of the methods set forth herein, such as carried in a peptide library (e.g., a phage display library), generated by chemical synthesis, derived by digestion of proteins, or generated using recombinant DNA techniques.

[0274]The term "pharmacologically active" means that a substance so described is determined to have activity that affects a medical parameter (e.g., blood pressure, blood cell count, cholesterol level) or disease state (e.g., cancer, autoimmune disorders, etc.).

[0275]The terms "antagonist peptide" or "inhibitor peptide" refer to a peptide that blocks or in some way interferes with the biological activity of the associated protein of interest, or has biological activity comparable to a known antagonist or inhibitor of the associated protein of interest. Thus, the term "Ang-2-antagonist peptide" comprises peptides that can be identified or derived as having Ang-2-antagonistic characteristics.

[0276]Additionally, physiologically acceptable salts of the compounds of this invention are also encompassed herein. By "physiologically acceptable salts" is meant any salts that are known or later discovered to be pharmaceutically acceptable. Some specific examples are: acetate; trifluoroacetate; hydrohalides, such as hydrochloride and hydrobromide; sulfate; citrate; tartrate; glycolate; and oxalate, mesylate, and phosphate.

Peptibodies

[0277]One aspect of the present invention relates to development of Ang-2 peptibodies. The interaction of a protein ligand with its receptor often takes place at a relatively large interface. However, as demonstrated for human growth hormone and its receptor, only a few key residues at the interface contribute to most of the binding energy. Clackson et al., Science 267: 383-6 (1995). The bulk of the protein ligand merely displays the binding epitopes in the right topology or serves functions unrelated to binding. Thus, molecules of only "peptide" length (generally 2 to 40 amino acids) can bind to the receptor protein of a given large protein ligand. Such peptides may mimic the bioactivity of the large protein ligand ("peptide agonists") or, through competitive binding, inhibit the bioactivity of the large protein ligand ("peptide antagonists").

[0278]Phage display technology has emerged as a powerful method in identifying such peptide agonists and antagonists. See, for example, Scott et al. Science 249: 386 (1990); Devlin et al., Science 249: 404 (1990); U.S. Pat. No. 5,223,409, issued Jun. 29, 1993; U.S. Pat. No. 5,733,731, issued Mar. 31, 1998; U.S. Pat. No. 5,498,530, issued Mar. 12, 1996; U.S. Pat. No. 5,432,018, issued Jul. 11, 1995; U.S. Pat. No. 5,338,665, issued Aug. 16, 1994; U.S. Pat. No. 5,922,545, issued Jul. 13, 1999; WO 96/40987, published Dec. 19, 1996; and WO 98/15833, published Apr. 16, 1998 (each of which is incorporated by reference). In peptide phage display libraries, random peptide sequences can be displayed by fusion with coat proteins of filamentous phage. The displayed peptides can be affinity-eluted against an antibody-immobilized extracellular domain of a receptor, if desired. The retained phage may be enriched by successive rounds of affinity purification and repropagation. The best binding peptides may be sequenced to identify key residues within one or more structurally related families of peptides. See, e.g., Cwirla et al., Science 276: 1696-9 (1997), in which two distinct families were identified. The peptide sequences may also suggest which residues may be safely replaced by alanine scanning or by mutagenesis at the DNA level. Mutagenesis libraries may be created and screened to further optimize the sequence of the best binders. Lowman, Ann. Rev. Biophys. Biomol. Struct. 26: 401-24 (1997).

[0279]Structural analysis of protein-protein interaction may also be used to suggest peptides that mimic the binding activity of large protein ligands. In such an analysis, the crystal structure may suggest the identity and relative orientation of critical residues of the large protein ligand, from which a peptide may be designed. See, e.g., Takasaki et al., Nature Biotech 15: 1266-70 (1997). These analytical methods may also be used to investigate the interaction between a receptor protein and peptides selected by phage display, which may suggest further modification of the peptides to increase binding affinity.

[0280]Other methods compete with phage display in peptide research. A peptide library can be fused to the carboxyl terminus of the lac repressor and expressed in E. coli. Another E. coli-based method allows display on the cell's outer membrane by fusion with a peptidoglycan-associated lipoprotein (PAL). Hereinafter, these and related methods are collectively referred to as "E. coli display." In another method, translation of random RNA is halted prior to ribosome release, resulting in a library of polypeptides with their associated RNA still attached. Hereinafter, this and related methods are collectively referred to as "ribosome display." Other methods employ chemical linkage of peptides to RNA. See, for example, Roberts and Szostak, Proc Natl Acad Sci USA, 94: 12297-303 (1997). Hereinafter, this and related methods are collectively referred to as "RNA-peptide screening." Chemically derived peptide libraries have been developed in which peptides are immobilized on stable, non-biological materials, such as polyethylene rods or solvent-permeable resins. Another chemically derived peptide library uses photolithography to scan peptides immobilized on glass slides. Hereinafter, these and related methods are collectively referred to as "chemical-peptide screening." Chemical-peptide screening may be advantageous in that it allows use of D-amino acids and other unnatural analogues, as well as non-peptide elements. Both biological and chemical methods are reviewed in Wells and Lowman, Curr. Opin. Biotechnol., 3: 355-62 (1992).

[0281]Conceptually, one may discover peptide mimetics of any protein using phage display and the other methods mentioned above. These methods have been used for epitope mapping, for identification of critical amino acids in protein-protein interactions, and as leads for the discovery of new therapeutic agents. See, e.g., Cortese et al., Curr. Opin. Biotech. 7: 616-21 (1996). Peptide libraries are now being used most often in immunological studies, such as epitope mapping. See Kreeger, The Scientist 10(13):19-20 (1996).

[0282]Peptides identified by phage display library screening have been regarded as "leads" in development of therapeutic agents rather than as therapeutic agents themselves. Like other proteins and peptides, they would likely be rapidly removed in vivo either by renal filtration, by cellular clearance mechanisms in the reticuloendothelial system, or by proteolytic degradation [Francis, (supra)]. As a result, the art presently uses peptides to validate drug targets or as scaffolds for design of organic compounds that might not have been as easily or as quickly identified through chemical library screening [Lowman, (supra); Kay et al., (supra)]. The art would benefit from a process by which such peptides could more readily yield therapeutic agents against angiogenesis.

Structure of Peptibodies

[0283]In the compositions of matter prepared in accordance with this invention, the peptide may be attached to a vehicle through the peptide's N-terminus or C-terminus. Thus, vehicle-peptide molecules of this invention may be described by the following five formulae and multimers thereof:

TABLE-US-00020 (X₁)_a - F₁ - (X₂)_b (FORMULA I) X₁ - F₁ (FORMULA II) F₁ - X₂ (FORMULA III) F₁ - (L₁)_c - P₁ (FORMULA IV) F₁ - (L₁)_c - P₁ - (L₂)_d - P₂ (FORMULA V)

wherein:

[0284]F₁ is a vehicle (preferably an Fc domain);

[0285]X₁ and X₂ are each independently selected from -(L₁)_c-P₁, -(L₁)_c-P₁-(L₂)_d-P₂, -(L₁)_c-P₁-(L₂)_d-P₂-(L₃)_e-P₃, and -(L₁)_c-P₁-(L₂)_d-P₂-(L₃)_e-P.su- b.3-(L₄)_f-P₄

[0286]P₁, P₂, P₃, and P₄ are each independently sequences of pharmacologically active peptides as described herein;

[0287]L₁, L₂, L₃, and L₄ are each independently linkers; and

[0288]"a", "b", "c", "d", "e", and "f" are each independently 0 or 1, provided that at least one of "a" and "b" is 1.

Peptides

[0289]The present invention contemplates peptides that selectively bind or specifically bind to Ang-2. Any number of such peptides may be used in conjunction with the present invention. Phage display, in particular, is useful in generating peptides for use in the present invention as has been shown that affinity selection from libraries of random peptides can be used to identify peptide ligands for any site of any gene product. Dedman et al., J. Biol. Chem. 268: 23025-30 (1993).

[0290]The peptides in this invention may be prepared by any of the methods disclosed in the art. Single letter amino acid abbreviations are used. The "X" in any sequence (and throughout this specification, unless specified otherwise in a particular instance) means that any of the 20 naturally occurring amino acid residues, or any non-naturally occurring amino acids (described below under "Variants"), may be present. Any of these peptides may be linked in tandem (i.e., sequentially), with or without linkers, and tandem-linked examples are provided in the table. Linkers are listed as "L" and may be any of the linkers described herein. Tandem repeats and linkers are shown separated by dashes for clarity. Any peptide containing a cysteinyl residue may be cross-linked with another Cys-containing peptide, either or both of which may be linked to a vehicle. Any peptide having more than one Cys residue may form an intrapeptide disulfide bond, as well. Any of these peptides may be derivatized as described herein. For derivatives in which the carboxyl terminus may be capped with an amino group, the capping amino group is --NH₂. For derivatives in which amino acid residues are substituted by moieties other than amino acid residues, the substitutions are denoted by S, which signifies any of the moieties described in Bhatnagar et al., J. Med. Chem. 39: 3814-9 (1996), and Cuthbertson et al., J. Med. Chem. 40: 2876-82 (1997), which are incorporated by reference. All peptides are linked through peptide bonds unless otherwise noted.

Vehicles

[0291]In one embodiment, this invention provides for at least one peptide to be attached to at least one vehicle (F₁, F₂) through the N-terminus, C-terminus or a side chain of one of the amino acid residues of the peptide(s). Multiple vehicles may also be used; e.g., Fc's at each terminus or an Fc at a terminus and a PEG group at the other terminus or a side chain.

[0292]An Fc domain is one preferred vehicle. The Fc domain may be fused to the N or C termini of the peptides or at both the N and C termini.

[0293]As noted above, Fc variants are suitable vehicles within the scope of this invention. A native Fc may be extensively modified to form an Fc variant in accordance with this invention, provided binding to the salvage receptor is maintained. See, for example WO 97/34631 and WO 96/32478. In such Fc variants, one may remove one or more sites of a native Fc that provide structural features or functional activity not required by the fusion molecules of this invention. One may remove these sites by, for example, substituting or deleting residues, inserting residues into the site, or truncating portions containing the site. The inserted or substituted residues may also be altered amino acids, such as peptidomimetics or D-amino acids. Fc variants may be desirable for a number of reasons, several of which are described below. Exemplary Fc variants include molecules and sequences in which:

[0294]1. Sites involved in disulfide bond formation are removed. Such removal may avoid reaction with other cysteine-containing proteins present in the host cell used to produce the molecules of the invention. For this purpose, the cysteine-containing segment at the N-terminus may be truncated or cysteine residues may be deleted or substituted with other amino acids (e.g., alanyl, seryl). Even when cysteine residues are removed, the single chain Fc domains can still form a dimeric Fc domain that is held together non-covalently.

[0295]2. A native Fc is modified to make it more compatible with a selected host cell. For example, one may remove the PA sequence near the N-terminus of a typical native Fc, which may be recognized by a digestive enzyme in E. coli such as proline iminopeptidase. One may also add an N-terminal methionyl residue, especially when the molecule is expressed recombinantly in a bacterial cell such as E. coli.

[0296]3. A portion of the N-terminus of a native Fc is removed to prevent N-terminal heterogeneity when expressed in a selected host cell. For this purpose, one may delete any of the first 20 amino acid residues at the N-terminus, particularly those at positions 1, 2, 3, 4 and 5.

[0297]4. One or more glycosylation sites are removed. Residues that are typically glycosylated (e.g., asparagine) may confer cytolytic response. Such residues may be deleted or substituted with unglycosylated residues (e.g., alanine).

[0298]5. Sites involved in interaction with complement, such as the C1q binding site, are removed. For example, one may delete or substitute the EKK sequence of human IgG1. Complement recruitment may not be advantageous for the molecules of this invention and so may be avoided with such an Fc variant.

[0299]6. Sites are removed that affect binding to Fc receptors other than a salvage receptor. A native Fc may have sites for interaction with certain white blood cells that are not required for the fusion molecules of the present invention and so may be removed.

[0300]7. The ADCC site is removed. ADCC sites are known in the art. See, for example, Molec. Immunol. 29 (5):633-9 (1992) with regard to ADCC sites in IgG1. These sites, as well, are not required for the fusion molecules of the present invention and so may be removed.

[0301]8. When the native Fc is derived from a non-human antibody, the native Fc may be humanized. Typically, to humanize a native Fc, one will substitute selected residues in the non-human native Fc with residues that are normally found in human native Fc. Techniques for antibody humanization are well known in the art.

[0302]An alternative vehicle would be a protein, polypeptide, peptide, antibody, antibody fragment, or small molecule (e.g., a peptidomimetic compound) capable of binding to a salvage receptor. For example, one could use as a vehicle a polypeptide as described in U.S. Pat. No. 5,739,277, issued Apr. 14, 1998 to Presta et al. Peptides could also be selected by phage display for binding to the FcRn salvage receptor. Such salvage receptor-binding compounds are also included within the meaning of "vehicle" and are within the scope of this invention. Such vehicles should be selected for increased half-life (e.g., by avoiding sequences recognized by proteases) and decreased immunogenicity (e.g., by favoring non-immunogenic sequences, as discovered in antibody humanization).

[0303]As noted above, polymer vehicles may also be used for F₁ and F₂. Various means for attaching chemical moieties useful as vehicles are currently available, see, e.g., Patent Cooperation Treaty ("PCT") International Publication No. WO 96/11953, entitled "N-Terminally Chemically Modified Protein Compositions and Methods," herein incorporated by reference in its entirety. This PCT publication discloses, among other things, the selective attachment of water soluble polymers to the N-terminus of proteins.

[0304]A preferred polymer vehicle is polyethylene glycol (PEG). The PEG group may be of any convenient molecular weight and may be linear or branched. The average molecular weight of the PEG will preferably range from about 2 kiloDalton ("kDa") to about 100 kDa, more preferably from about 5 kDa to about 50 kDa, most preferably from about 5 kDa to about 10 kDa. The PEG groups will generally be attached to the compounds of the invention via acylation or reductive alkylation through a reactive group on the PEG moiety (e.g., an aldehyde, amino, thiol, or ester group) to a reactive group on the inventive compound (e.g., an aldehyde, amino, or ester group).

[0305]A useful strategy for the PEGylation of synthetic peptides consists of combining, through forming a conjugate linkage in solution, a peptide and a PEG moiety, each bearing a special functionality that is mutually reactive toward the other. The peptides can be easily prepared with conventional solid phase synthesis as known in the art. The peptides are "preactivated" with an appropriate functional group at a specific site. The precursors are purified and fully characterized prior to reacting with the PEG moiety. Ligation of the peptide with PEG usually takes place in aqueous phase and can be easily monitored by reverse phase analytical HPLC. The PEGylated peptides can be easily purified by preparative HPLC and characterized by analytical HPLC, amino acid analysis and laser desorption mass spectrometry.

[0306]Polysaccharide polymers are another type of water soluble polymer which may be used for protein modification. Dextrans are polysaccharide polymers comprised of individual subunits of glucose predominantly linked by a1-6 linkages. The dextran itself is available in many molecular weight ranges, and is readily available in molecular weights from about 1 kDa to about 70 kDa. Dextran is a suitable water-soluble polymer for use in the present invention as a vehicle by itself or in combination with another vehicle (e.g., Fc). See, for example, WO 96/11953 and WO 96/05309. The use of dextran conjugated to therapeutic or diagnostic immunoglobulins has been reported; see, for example, European Patent Publication No. 0 315 456, which is hereby incorporated by reference. Dextran of about 1 kDa to about 20 kDa is preferred when dextran is used as a vehicle in accordance with the present invention.

Linkers

[0307]Any "linker" group is optional. When present, its chemical structure is not critical, since it serves primarily as a spacer. The linker is preferably made up of amino acids linked together by peptide bonds. Thus, in preferred embodiments, the linker is made up of from 1 to 20 amino acids linked by peptide bonds, wherein the amino acids are selected from the 20 naturally occurring amino acids. One or more of these amino acids may be glycosylated, as is well understood by those in the art. In a more preferred embodiment, the 1 to 20 amino acids are selected from glycine, alanine, proline, asparagine, glutamine, and lysine. Even more preferably, a linker is made up of a majority of amino acids that are sterically unhindered, such as glycine and alanine. Thus, preferred linkers are polyglycines (particularly (Gly)₅, (Gly)₈), poly(Gly-Ala), and polyalanines. Combinations of Gly and Ala are also preferred as is the linker referred to herein as K1 and having an amino acid sequence set forth in the Examples herein.

[0308]Non-peptide linkers are also possible. For example, alkyl linkers such as --NH--(CH₂)s-C(O)--, wherein s=2-20 can be used. These alkyl linkers may further be substituted by any non-sterically hindering group such as lower alkyl (e.g., C₁-C₆) lower acyl, halogen (e.g., Cl, Br), CN, NH₂, phenyl, etc. An exemplary non-peptide linker is a PEG linker, and has a molecular weight of 100 to 5000 kDa, preferably 100 to 500 kDa. The peptide linkers may be altered to form derivatives in the same manner as described above.

Variants and Derivatives

[0309]Variants and derivatives of the specific binding agents are included within the scope of the present invention. Included within variants are insertional, deletional, and substitutional variants. It is understood that a particular specific binding agent of the present invention may contain one, two or all three types of variants. Insertional and substitutional variants may contain natural amino acids, unconventional amino acids (as set forth below), or both.

[0310]In one example, insertional variants are provided wherein one or more amino acid residues, either naturally occurring or unconventional amino acids, supplement a peptide or a peptibody amino acid sequence. Insertions may be located at either or both termini of the protein, or may be positioned within internal regions of the peptibody amino acid sequence. Insertional variants with additional residues at either or both termini can include, for example, fusion proteins and proteins including amino acid tags or labels. Insertion variants include peptides and peptibodies wherein one or more amino acid residues are added to the peptide or peptibody amino acid sequence, or fragment thereof.

[0311]Variant products of the invention also include mature peptides and peptibodies wherein leader or signal sequences are removed, and the resulting proteins having additional amino terminal residues, which amino acids may be natural or non-natural. Specific binding agents (such as peptibodies) with an additional methionyl residue at amino acid position -1 (Met^-1-peptibody) are contemplated, as are specific binding agents with additional methionine and lysine residues at positions -2 and -1 (Met^-2-Lys^-1-). Variants having additional Met, Met-Lys, Lys residues (or one or more basic residues, in general) are particularly useful for enhanced recombinant protein production in bacterial host cells.

[0312]The invention also embraces specific binding agent variants having additional amino acid residues that arise from use of specific expression systems. For example, use of commercially available vectors that express a desired polypeptide as part of glutathione-S-transferase (GST) fusion product provides the desired polypeptide having an additional glycine residue at amino acid position -1 after cleavage of the GST component from the desired polypeptide. Variants which result from expression in other vector systems are also contemplated, including those wherein poly-histidine tags are incorporated into the amino acid sequence, generally at the carboxy and/or amino terminus of the sequence.

[0313]Insertional variants also include fusion proteins wherein the amino and/or carboxy termini of the peptide or peptibody is fused to another polypeptide, a fragment thereof or amino acids which are not generally recognized to be part of any specific protein sequence. Examples of such fusion proteins are immunogenic polypeptides, proteins with long circulating half lives, such as immunoglobulin constant regions, marker proteins, proteins or polypeptides that facilitate purification of the desired peptide or peptibody, and polypeptide sequences that promote formation of multimeric proteins (such as leucine zipper motifs that are useful in dimer formation/stability).

[0314]This type of insertional variant generally has all or a substantial portion of the native molecule, linked at the N- or C-terminus, to all or a portion of a second polypeptide. For example, fusion proteins typically employ leader sequences from other species to permit the recombinant expression of a protein in a heterologous host. Another useful fusion protein includes the addition of an immunologically active domain, such as an antibody epitope, to facilitate purification of the fusion protein. Inclusion of a cleavage site at or near the fusion junction will facilitate removal of the extraneous polypeptide after purification. Other useful fusions include linking of functional domains, such as active sites from enzymes, glycosylation domains, cellular targeting signals or transmembrane regions.

[0315]There are various commercially available fusion protein expression systems that may be used in the present invention. Particularly useful systems include but are not limited to the glutathione-S-transferase (GST) system (Pharmacia), the maltose binding protein system (NEB, Beverley, Mass.), the FLAG system (IBI, New Haven, Conn.), and the 6×His system (Qiagen, Chatsworth, Calif.). These systems are capable of producing recombinant peptides and/or peptibodies bearing only a small number of additional amino acids, which are unlikely to significantly affect the activity of the peptide or peptibody. For example, both the FLAG system and the 6×His system add only short sequences, both of which are known to be poorly antigenic and which do not adversely affect folding of a polypeptide to its native conformation. Another N-terminal fusion that is contemplated to be useful is the fusion of a Met-Lys dipeptide at the N-terminal region of the protein or peptides. Such a fusion may produce beneficial increases in protein expression or activity.

[0316]Other fusion systems produce polypeptide hybrids where it is desirable to excise the fusion partner from the desired peptide or peptibody. In one embodiment, the fusion partner is linked to the recombinant peptibody by a peptide sequence containing a specific recognition sequence for a protease. Examples of suitable sequences are those recognized by the Tobacco Etch Virus protease (Life Technologies, Gaithersburg, Md.) or Factor Xa (New England Biolabs, Beverley, Mass.).

[0317]The invention also provides fusion polypeptides which comprises all or part of a peptibody or peptide of the present invention, in combination with truncated tissue factor (tTF). tTF is a vascular targeting agent consisting of a truncated form of a human coagulation-inducing protein that acts as a tumor blood vessel clotting agent, as described U.S. Pat. Nos. 5,877,289; 6,004,555; 6,132,729; 6,132,730; 6,156,321; and European Patent No. EP 0988056. The fusion of tTF to the anti-Ang-2 peptibody or peptide, or fragments thereof facilitates the delivery of anti-Ang-2 to target cells.

[0318]In another aspect, the invention provides deletion variants wherein one or more amino acid residues in a peptide or peptibody are removed. Deletions can be effected at one or both termini of the peptibody, or from removal of one or more residues within the peptibody amino acid sequence. Deletion variants necessarily include all fragments of a peptide or peptibody.

[0319]In still another aspect, the invention provides substitution variants of peptides and peptibodies of the invention. Substitution variants include those peptides and peptibodies wherein one or more amino acid residues are removed and replaced with one or more alternative amino acids, which amino acids may be naturally occurring or non-naturally occurring. Substitutional variants generate peptides or peptibodies that are "similar" to the original peptide or peptibody, in that the two molecules have a certain percentage of amino acids that are identical. Substitution variants include substitutions of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, amino acids within a peptide or peptibody, wherein the number of substitutions may be up to ten percent or more, of the amino acids of the peptide or peptibody. In one aspect, the substitutions are conservative in nature, however, the invention embraces substitutions that are also non-conservative and also includes unconventional amino acids.

[0320]Identity and similarity of related peptides and peptibodies can be readily calculated by known methods. Such methods include, but are not limited to, those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York (1988); Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York (1993); Computer Analysis of Sequence Data, Part 1, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey (1994); Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press (1987); Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M. Stockton Press, New York (1991); and Carillo et al., SIAM J. Applied Math., 48:1073 (1988).

[0321]Preferred methods to determine the relatedness or percent identity of two peptides or polypeptides, or a polypeptide and a peptide, are designed to give the largest match between the sequences tested. Methods to determine identity are described in publicly available computer programs. Preferred computer program methods to determine identity between two sequences include, but are not limited to, the GCG program package, including GAP (Devereux et al., Nucl. Acid. Res., 12:387 (1984); Genetics Computer Group, University of Wisconsin, Madison, Wis., BLASTP, BLASTN, and FASTA (Altschul et al., J. Mol. Biol., 215:403-410 (1990)). The BLASTX program is publicly available from the National Center for Biotechnology Information (NCBI) and other sources (BLAST Manual, Altschul et al. NCB/NLM/NIH Bethesda, Md. 20894; Altschul et al., supra (1990)). The well-known Smith Waterman algorithm may also be used to determine identity.

[0322]Certain alignment schemes for aligning two amino acid sequences may result in the matching of only a short region of the two sequences, and this small aligned region may have very high sequence identity even though there is no significant relationship between the two full-length sequences. Accordingly, in certain embodiments, the selected alignment method (GAP program) will result in an alignment that spans at least ten percent of the full length of the target polypeptide being compared, i.e., at least 40 contiguous amino acids where sequences of at least 400 amino acids are being compared, 30 contiguous amino acids where sequences of at least 300 to about 400 amino acids are being compared, at least 20 contiguous amino acids where sequences of 200 to about 300 amino acids are being compared, and at least 10 contiguous amino acids where sequences of about 100 to 200 amino acids are being compared.

[0323]For example, using the computer algorithm GAP (Genetics Computer Group, University of Wisconsin, Madison, Wis.), two polypeptides for which the percent sequence identity is to be determined are aligned for optimal matching of their respective amino acids (the "matched span", as determined by the algorithm). In certain embodiments, a gap opening penalty (which is typically calculated as 3× the average diagonal; the "average diagonal" is the average of the diagonal of the comparison matrix being used; the "diagonal" is the score or number assigned to each perfect amino acid match by the particular comparison matrix) and a gap extension penalty (which is usually 1/10 times the gap opening penalty), as well as a comparison matrix such as PAM 250 or BLOSUM 62 are used in conjunction with the algorithm. In certain embodiments, a standard comparison matrix (see Dayhoff et al., Atlas of Protein Sequence and Structure, 5(3)(1978) for the PAM 250 comparison matrix; Henikoff et al., Proc. Natl. Acad. Sci USA, 89:10915-10919 (1992) for the BLOSUM 62 comparison matrix) is also used by the algorithm.

[0324]In certain embodiments, the parameters for a polypeptide sequence comparison include the following:

[0325]Algorithm: Needleman et al., J. Mol. Biol., 48:443-453 (1970);

[0326]Comparison matrix: BLOSUM 62 from Henikoff et al., supra (1992);

[0327]Gap Penalty: 12

[0328]Gap Length Penalty: 4

[0329]Threshold of Similarity: 0

[0330]The GAP program may be useful with the above parameters. In certain embodiments, the aforementioned parameters are the default parameters for polypeptide comparisons (along with no penalty for end gaps) using the GAP algorithm.

[0331]In certain embodiments, the parameters for polynucleotide molecule sequence (as opposed to an amino acid sequence) comparisons include the following:

[0332]Algorithm: Needleman et al., supra (1970);

[0333]Comparison matrix: matches=+10, mismatch=0

[0334]Gap Penalty: 50

[0335]Gap Length Penalty: 3

[0336]The GAP program may also be useful with the above parameters. The aforementioned parameters are the default parameters for polynucleotide molecule comparisons.

[0337]Other exemplary algorithms, gap opening penalties, gap extension penalties, comparison matrices, thresholds of similarity, etc. may be used, including those set forth in the Program Manual, Wisconsin Package, Version 9, September, 1997. The particular choices to be made will be apparent to those of skill in the art and will depend on the specific comparison to be made, such as DNA-to-DNA, protein-to-protein, protein-to-DNA; and additionally, whether the comparison is between given pairs of sequences (in which case GAP or BestFit are generally preferred) or between one sequence and a large database of sequences (in which case FASTA or BLASTA are preferred).

[0338]As used herein, the twenty conventional amino acids and their abbreviations follow conventional usage. See Immunology--A Synthesis (2nd Edition, E. S. Golub and D. R. Gren, Eds., Sinauer Associates, Sunderland, Mass. (1991)), which is incorporated herein by reference for any purpose.

[0339]The amino acids may have either L or D stereochemistry (except for Gly, which is neither L nor D) and the polypeptides and compositions of the present invention may comprise a combination of stereochemistries. However, the L stereochemistry is preferred. The invention also provides reverse molecules wherein the amino terminal to carboxy terminal sequence of the amino acids is reversed. For example, the reverse of a molecule having the normal sequence X₁-X₂-X₃ would be X₃-X₂-X₁. The invention also provides retro-reverse molecules wherein, as above, the amino terminal to carboxy terminal sequence of amino acids is reversed and residues that are normally "L" enantiomers are altered to the "D" stereoisomer form.

[0340]Stereoisomers (e.g., D-amino acids) of the twenty conventional amino acids, unnatural amino acids such as α-,α-disubstituted amino acids, N-alkyl amino acids, lactic acid, and other unconventional amino acids may also be suitable components for polypeptides of the present invention. Examples of unconventional amino acids include, without limitation: aminoadipic acid, beta-alanine, beta-aminopropionic acid, aminobutyric acid, piperidinic acid, aminocaprioic acid, aminoheptanoic acid, aminoisobutyric acid, aminopimelic acid, diaminobutyric acid, desmosine, diaminopimelic acid, diaminopropionic acid, N-ethylglycine, N-ethylaspargine, hyroxylysine, allo-hydroxylysine, hydroxyproline, isodesmosine, allo-isoleucine, N-methylglycine, sarcosine, N-methylisoleucine, N-methylvaline, norvaline, norleucine, orithine, 4-hydroxyproline, γ-carboxyglutamate, ε-N,N,N-trimethyllysine, ε-N-acetyllysine, O-phosphoserine, N-acetylserine, N-formylmethionine, 3-methylhistidine, 5-hydroxylysine, σ-N-methylarginine, and other similar amino acids and amino acids (e.g., 4-hydroxyproline).

[0341]Similarly, unless specified otherwise, the left-hand end of single-stranded polynucleotide sequences is the 5' end; the left-hand direction of double-stranded polynucleotide sequences is referred to as the 5' direction. The direction of 5' to 3' addition of nascent RNA transcripts is referred to as the transcription direction; sequence regions on the DNA strand having the same sequence as the RNA and which are 5' to the 5' end of the RNA transcript are referred to as "upstream sequences"; sequence regions on the DNA strand having the same sequence as the RNA and which are 3' to the 3' end of the RNA transcript are referred to as "downstream sequences".

[0342]It will be appreciated that amino acid residues can be divided into classes based on their common side chain properties: [0343]1. Neutral Hydrophobic: Alanine (Ala; A), Valine (Val; V), Leucine (Leu; L), Isoleucine (Ile; I), Proline (Pro; P), Tryptophan (Trp; W), Phenylalanine (Phe; F), and Methionine (Met, M). [0344]2. Neutral Polar: Glycine (Gly; G); Serine (Ser; S), Threonine (Thr; T), Tyrosine (Tyr; Y), Cysteine (Cys; C), Glutamine (Glu; Q), Asparagine (Asn; N), and Norleucine. [0345]3. Acidic: Aspartic Acid (Asp; D), Glutamic Acid (Glu; E); [0346]4) Basic: Lysine (Lys; K), Arginine (Arg; R), Histidine (His; H).

See Lewin, B., Genes V, Oxford University Press (1994), p. 11.

[0347]Conservative amino acid substitutions may encompass unconventional amino acid residues, which are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems. These include, without limitation, peptidomimetics and other reversed or inverted forms of amino acid moieties. Non-conservative substitutions may involve the exchange of a member of one of these classes for a member from another class.

[0348]In making such changes, according to certain embodiments, the hydropathic index of amino acids may be considered. Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics. They are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine (+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4); threonine (-0.7); serine (-0.8); tryptophan (-0.9); tyrosine (-1.3); proline (-1.6); histidine (-3.2); glutamate (-3.5); glutamine (-3.5); aspartate (-3.5); asparagine (-3.5); lysine (-3.9); and arginine (-4.5).

[0349]The importance of the hydropathic amino acid index in conferring interactive biological function on a protein is understood in the art. Kyte et al., J. Mol. Biol., 157:105-131 (1982). It is known that certain amino acids may be substituted for other amino acids having a similar hydropathic index or score and still retain a similar biological activity. In making changes based upon the hydropathic index, in certain embodiments, the substitution of amino acids whose hydropathic indices are within ±2 is included. In certain embodiments, those which are within ±1 are included, and in certain embodiments, those within ±0.5 are included.

[0350]It is also understood in the art that the substitution of like amino acids can be made effectively on the basis of hydrophilicity, particularly where the biologically functional peptibody or peptide thereby created is intended for use in immunological embodiments, as in the present case. In certain embodiments, the greatest local average hydrophilicity of a protein, as governed by the hydrophilicity of its adjacent amino acids, correlates with its immunogenicity and antigenicity, i.e., with a biological property of the protein.

[0351]The following hydrophilicity values have been assigned to these amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0±1); glutamate (+3.0±1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline (-0.5±1); alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5) and tryptophan (-3.4). In making changes based upon similar hydrophilicity values, in certain embodiments, the substitution of amino acids whose hydrophilicity values are within ±2 is included, in certain embodiments, those which are within ±1 are included, and in certain embodiments, those within ±0.5 are included. One may also identify epitopes from primary amino acid sequences on the basis of hydrophilicity. These regions are also referred to as "epitopic core regions."

[0352]Exemplary amino acid substitutions are set forth in Table 2 below.

TABLE-US-00021 TABLE 2 Amino Acid Substitutions Original Residues Exemplary Substitutions Preferred Substitutions Ala Val, Leu, Ile Val Arg Lys, Gln, Asn Lys Asn Gln, Glu, Asp Gln Asp Glu, Gln, Asp Glu Cys Ser, Ala Ser Gln Asn, Glu, Asp Asn Glu Asp, Gln, Asn Asp Gly Pro, Ala Ala His Asn, Gln, Lys, Arg Arg Ile Leu, Val, Met, Ala, Phe, Leu Norleucine Leu Norleucine, Ile, Val, Met, Ile Ala, Phe Lys Arg, 1,4 Diamino-butyric Arg Acid, Gln, Asn Met Leu, Phe, Ile Leu Phe Leu, Val, Ile, Ala, Tyr Leu Pro Ala Gly Ser Thr, Ala, Cys Thr Thr Ser Ser Trp Tyr, Phe Tyr Tyr Trp, Phe, Thr, Ser Phe Val Ile, Met, Leu, Phe, Ala, Leu Norleucine

[0353]A skilled artisan will be able to determine suitable variants of the polypeptide as set forth herein using well-known techniques. In certain embodiments, one skilled in the art may identify suitable areas of the molecule that may be changed without destroying activity by targeting regions not believed to be important for activity. In certain embodiments, one can identify residues and portions of the molecules that are conserved among similar peptides or polypeptides. In certain embodiments, even areas that may be important for biological activity or for structure may be subject to conservative amino acid substitutions without destroying the biological activity or without adversely affecting the polypeptide structure.

[0354]Additionally, one skilled in the art can review structure-function studies identifying residues in similar polypeptides that are important for activity or structure. In view of such a comparison, one can predict the importance of amino acid residues in a protein that correspond to amino acid residues which are important for activity or structure in similar proteins. One skilled in the art may opt for chemically similar amino acid substitutions for such predicted important amino acid residues.

[0355]One skilled in the art can also analyze the three-dimensional structure and amino acid sequence in relation to that structure in similar polypeptides. In view of such information, one skilled in the art may predict the alignment of amino acid residues of an antibody with respect to its three dimensional structure. In certain embodiments, one skilled in the art may choose not to make radical changes to amino acid residues predicted to be on the surface of the protein, since such residues may be involved in important interactions with other molecules. Moreover, one skilled in the art may generate test variants containing a single amino acid substitution at each desired amino acid residue. The variants can then be screened using activity assays known to those skilled in the art. Such variants could be used to gather information about suitable variants. For example, if one discovered that a change to a particular amino acid residue resulted in destroyed, undesirably reduced, or unsuitable activity, variants with such a change may be avoided. In other words, based on information gathered from such routine experiments, one skilled in the art can readily determine the amino acids where further substitutions should be avoided either alone or in combination with other mutations.

[0356]A number of scientific publications have been devoted to the prediction of secondary structure. See Moult J., Curr. Op. in Biotech., 7(4):422-427 (1996), Chou et al., Biochemistry, 13(2):222-245 (1974); Chou et al., Biochemistry, 113(2):211-222 (1974); Chou et al., Adv. Enzymol. Relat. Areas Mol. Biol., 47:45-148 (1978); Chou et al., Ann. Rev. Biochem., 47:251-276 and Chou et al., Biophys. J, 26:367-384 (1979). Moreover, computer programs are currently available to assist with predicting secondary structure. One method of predicting secondary structure is based upon homology modeling. For example, two polypeptides or proteins which have a sequence identity of greater than 30%, or similarity greater than 40% often have similar structural topologies. The recent growth of the protein structural database (PDB) has provided enhanced predictability of secondary structure, including the potential number of folds within a polypeptide's or protein's structure. See Holm et al., Nucl. Acid. Res., 27(1):244-247 (1999). It has been suggested (Brenner et al., Curr. Op. Struct. Biol., 7(3):369-376 (1997)) that there are a limited number of folds in a given polypeptide or protein and that once a critical number of structures have been resolved, structural prediction will become dramatically more accurate.

[0357]Additional methods of predicting secondary structure include "threading" (Jones, D., Curr. Opin. Struct. Biol., 7(3):377-87 (1997); Sippl et al., Structure, 4(1):15-19 (1996)), "profile analysis" (Bowie et al., Science, 253:164-170 (1991); Gribskov et al., Meth. Enzym., 183:146-159 (1990); Gribskov et al., Proc. Nat. Acad. Sci., 84(13):4355-4358 (1987)), and "evolutionary linkage" (See Holm, supra (1999), and Brenner, supra (1997)).

[0358]In certain embodiments, peptibody variants include glycosylation variants wherein one or more glycosylation sites, such as a N-linked glycosylation site, has been added to the peptibody. An N-linked glycosylation site is characterized by the sequence: Asn-X-Ser or Asn-X-Thr, wherein the amino acid residue designated as X may be any amino acid residue except proline. The substitution or addition of amino acid residues to create this sequence provides a potential new site for the addition of an N-linked carbohydrate chain. Alternatively, substitutions which eliminate this sequence will remove an existing N-linked carbohydrate chain. Also provided is a rearrangement of N-linked carbohydrate chains wherein one or more N-linked glycosylation sites (typically those that are naturally occurring) are eliminated and one or more new N-linked sites are created.

[0359]The invention also provides "derivatives" that include peptibodies bearing modifications other than, or in addition to, insertions, deletions, or substitutions of amino acid residues. Preferably, the modifications are covalent in nature, and include for example, chemical bonding with polymers, lipids, other organic, and inorganic moieties. Derivatives of the invention may be prepared to increase circulating half-life of a peptibody, or may be designed to improve targeting capacity for the peptibody to desired cells, tissues, or organs.

[0360]Exemplary derivatives include moieties wherein one or more of the following modifications have been made: [0361]One or more of the peptidyl [--C(O)NR--] linkages (bonds) have been replaced by a non-peptidyl linkage such as a --CH₂-carbamate linkage [--CH₂--OC(O)NR--]; a phosphonate linkage; a --CH₂-sulfonamide [--CH₂--S(O)₂NR--] linkage; a urea [--NHC(O)NH--]linkage; a --CH₂-secondary amine linkage; or an alkylated peptidyl linkage [--C(O)NR⁶-- where R⁶ is lower alkyl]; [0362]Peptides wherein the N-terminus is derivatized to a --NRR¹ group; to a --NRC(O)R group; to a --NRC(O)OR group; to a --NRS(O)₂R group; to a --NHC(O)NHR group, where R and R¹ are hydrogen or lower alkyl, with the proviso that R and R¹ are not both hydrogen; to a succinimide group; to a benzyloxycarbonyl-NH-- (CBZ-NH--) group; or to a benzyloxycarbonyl-NH-- group having from 1 to 3 substituents on the phenyl ring selected from the group consisting of lower alkyl, lower alkoxy, chloro, and bromo; and [0363]Peptides wherein the free C terminus is derivatized to --C(O)R² where R² is selected from the group consisting of lower alkoxy and --NR³R⁴ where R³ and R⁴ are independently selected from the group consisting of hydrogen and lower alkyl. By "lower" is meant a group having from 1 to 6 carbon atoms.

[0364]Additionally, modifications of individual amino acids may be introduced into the polypeptides or compositions of the invention by reacting targeted amino acid residues of the peptide with an organic derivatizing agent that is capable of reacting with selected side chains or terminal residues. The following are exemplary:

[0365]Lysinyl and amino terminal residues may be reacted with succinic or other carboxylic acid anhydrides. Derivatization with these agents has the effect of reversing the charge of the lysinyl residues. Other suitable reagents for derivatizing alpha-amino-containing residues include imidoesters such as methyl picolinimidate; pyridoxal phosphate; pyridoxal; chloroborohydride; trinitrobenzenesulfonic acid; O-methylisourea; 2,4 pentanedione; and transaminase-catalyzed reaction with glyoxylate.

[0366]Arginyl residues may be modified by reaction with one or several conventional reagents, among them phenylglyoxal, 2,3-butanedione, 1,2-cyclohexanedione, and ninhydrin. Derivatization of arginine residues requires that the reaction be performed in alkaline conditions because of the high pKa of the guanidine functional group. Furthermore, these reagents may react with the groups of lysine as well as the arginine guanidino group.

[0367]The specific modification of tyrosyl residues per se has been studied extensively, with particular interest in introducing spectral labels into tyrosyl residues by reaction with aromatic diazonium compounds or tetranitromethane. Most commonly, N-acetylimidizole and tetranitromethane may be used to form O-acetyl tyrosyl species and 3-nitro derivatives, respectively.

[0368]Carboxyl side groups (aspartyl or glutamyl) may be selectively modified by reaction with carbodiimides (R¹--N═C═N--R') such as 1-cyclohexyl-3-(2-morpholinyl-(4-ethyl) carbodiimide or 1-ethyl-3-(4-azonia-4,4-dimethylpentyl) carbodiimide. Furthermore, aspartyl and glutamyl residues may be converted to asparaginyl and glutaminyl residues by reaction with ammonium ions.

[0369]Glutaminyl and asparaginyl residues are frequently deamidated to the corresponding glutamyl and aspartyl residues. Alternatively, these residues may be deamidated under mildly acidic conditions. Either form of these residues falls within the scope of this invention.

[0370]Derivatization with bifunctional agents is useful for cross-linking the peptides or their functional derivatives to a water-insoluble support matrix or to other macromolecular carriers. Commonly used cross-linking agents include, e.g., 1,1-bis(diazoacetyl)-2-phenylethane, glutaraldehyde, N-hydroxysuccinimide esters, for example, esters with 4-azidosalicylic acid, homobifunctional imidoesters, including disuccinimidyl esters such as 3,3'-dithiobis (succinimidylpropionate), and bifunctional maleimides such as bis-N-maleimido-1,8-octane. Derivatizing agents such as methyl-3-[(p-azidophenyl)dithio]propioimidate yield photoactivatable intermediates that are capable of forming crosslinks in the presence of light. Alternatively, reactive water-insoluble matrices such as cyanogen bromide-activated carbohydrates and the reactive substrates described in U.S. Pat. Nos. 3,969,287; 3,691,016; 4,195,128; 4,247,642; 4,229,537; and 4,330,440 may be employed for protein immobilization.

[0371]Other possible modifications include hydroxylation of proline and lysine, phosphorylation of hydroxyl groups of seryl or threonyl residues, oxidation of the sulfur atom in Cys, methylation of the alpha-amino groups of lysine, arginine, and histidine side chains (Creighton, T. E., Proteins: Structure and Molecule Properties, W. H. Freeman & Co., San Francisco, pp. 79-86 (1983)), acetylation of the N-terminal amine, and, in some instances, amidation of the C-terminal carboxyl groups.

[0372]Such derivatized moieties preferably improve one or more characteristics including anti-angiogenic activity, solubility, absorption, biological half life, and the like of the compounds. Alternatively, derivatized moieties may result in compounds that have the same, or essentially the same, characteristics and/or properties of the compound that is not derivatized. The moieties may alternatively eliminate or attenuate any undesirable side effect of the compounds and the like.

[0373]Compounds of the present invention may be changed at the DNA level, as well. The DNA sequence of any portion of the compound may be changed to codons more compatible with the chosen host cell. For E. coli, which is the preferred host cell, optimized codons are known in the art. Codons may be substituted to eliminate restriction sites or to include silent restriction sites, which may aid in processing of the DNA in the selected host cell. The vehicle, linker and peptide DNA sequences may be modified to include any of the foregoing sequence changes. Thus, all modifications, substitution, derivatizations, etc. discussed herein apply equally to all aspects of the present invention, including but not limited to peptides, peptide dimers and multimers, linkers, and vehicles.

[0374]Additionally, one skilled in the art can review structure-function studies identifying residues in similar peptides that are important for activity or structure. In view of such a comparison, one can predict the importance of amino acid residues in a peptide that correspond to amino acid residues that are important for activity or structure in similar peptides. One skilled in the art may opt for chemically similar amino acid substitutions for such predicted important amino acid residues of the peptides.

[0375]One skilled in the art can also analyze the three-dimensional structure and amino acid sequence in relation to that structure in similar polypeptides. In view of that information, one skilled in the art may predict the alignment of amino acid residues of a peptide with respect to its three dimensional structure. One skilled in the art may choose not to make radical changes to amino acid residues predicted to be on the surface of the protein, since such residues may be involved in important interactions with other molecules. Moreover, one skilled in the art may generate test variants containing a single amino acid substitution at each desired amino acid residue. The variants can then be screened using activity assays know to those skilled in the art. Such data could be used to gather information about suitable variants. For example, if one discovered that a change to a particular amino acid residue resulted in destroyed, undesirably reduced, or unsuitable activity, variants with such a change would be avoided. In other words, based on information gathered from such routine experiments, one skilled in the art can readily determine the amino acids where further substitutions should be avoided either alone or in combination with other mutations.

[0376]A number of scientific publications have been devoted to the prediction of secondary structure. See Moult J., Curr. Op. in Biotech., 7(4): 422-427 (1996), Chou et al., Biochemistry, 13(2): 222-245 (1974); Chou et al., Biochemistry, 113(2): 211-222 (1974); Chou et al., Adv. Enzymol. Relat. Areas Mol. Biol., 47: 45-148 (1978); Chou et al., Ann. Rev. Biochem., 47: 251-276 and Chou et al., Biophys. J., 26: 367-384 (1979). Moreover, computer programs are currently available to assist with predicting secondary structure. One method of predicting secondary structure is based upon homology modeling. For example, two polypeptides or proteins which have a sequence identity of greater than 30%, or similarity greater than 40% often have similar structural topologies. The recent growth of the protein structural data base (PDB) has provided enhanced predictability of secondary structure, including the potential number of folds within a polypeptide's or protein's structure. See Holm et al., Nucl. Acid. Res., 27(1): 244-247 (1999). It has been suggested (Brenner et al., Curr. Op. Struct. Biol., 7(3): 369-376 (1997)) that there are a limited number of folds in a given polypeptide or protein and that once a critical number of structures have been resolved, structural prediction will gain dramatically in accuracy.

[0377]Additional methods of predicting secondary structure include "threading" (Jones, D., Curr. Opin. Struct. Biol., 7(3): 377-87 (1997); Sippl et al., Structure, 4(1): 15-9 (1996)), "profile analysis" (Bowie et al., Science, 253: 164-170 (1991); Gribskov et al., Meth. Enzym., 183: 146-159 (1990); Gribskov et al., Proc. Nat. Acad. Sci., 84(13): 4355-8 (1987)), and "evolutionary linkage" (See Home, supra, and Brenner, supra).

[0378]The invention further embraces derivative specific binding agents, e.g. peptibodies, covalently modified to include one or more water soluble polymer attachments, such as polyethylene glycol, polyoxyethylene glycol, or polypropylene glycol, as described U.S. Pat. Nos. 4,640,835; 4,496,689; 4,301,144; 4,670,417; 4,791,192; and 4,179,337. Still other useful polymers known in the art include monomethoxy-polyethylene glycol, dextran, cellulose, or other carbohydrate based polymers, poly-(N-vinyl pyrrolidone)-polyethylene glycol, propylene glycol homopolymers, a polypropylene oxide/ethylene oxide co-polymer, polyoxyethylated polyols (e.g., glycerol) and polyvinyl alcohol, as well as mixtures of these polymers. Particularly preferred are peptibodies covalently modified with polyethylene glycol (PEG) subunits. Water-soluble polymers may be bonded at specific positions, for example at the amino terminus of the peptibodies, or randomly attached to one or more side chains of the polypeptide. The use of PEG for improving the therapeutic capacity for specific binding agents, e.g. peptibodies, and for humanized antibodies in particular, is described in U.S. Pat. No. 6,133,426 to Gonzales et al., issued Oct. 17, 2000.

[0379]The invention also contemplates derivatizing the peptide and/or vehicle portion of the compounds. Such derivatives may improve the solubility, absorption, biological half-life, and the like of the compounds. The moieties may alternatively eliminate or attenuate any undesirable side-effect of the compounds and the like. Exemplary derivatives include compounds in which:

[0380]1. The compound or some portion thereof is cyclic. For example, the peptide portion may be modified to contain two or more Cys residues (e.g., in the linker), which could cyclize by disulfide bond formation.

[0381]2. The compound is cross-linked or is rendered capable of cross-linking between molecules. For example, the peptide portion may be modified to contain one Cys residue and thereby be able to form an intermolecular disulfide bond with a like molecule. The compound may also be cross-linked through its C-terminus.

[0382]3. One or more peptidyl [--C(O)NR--] linkages (bonds) is replaced by a non-peptidyl linkage. Exemplary non-peptidyl linkages are --CH₂-carbamate [--CH₂--OC(O)NR--], phosphonate, --CH₂-sulfonamide [--CH₂--S(O)₂NR--], urea [--NHC(O)NH--], --CH₂-secondary amine, and alkylated peptide [--C(O)NR₆-- wherein R₆ is lower alkyl].

[0383]4. The N-terminus is derivatized. Typically, the N-terminus may be acylated or modified to a substituted amine. Exemplary N-terminal derivative groups include --NRR₁, (other than --NH₂), --NRC(O)R₁, --NRC(O)OR₁, --NRS(O)₂R₁, --NHC(O)NHR₁, succinimide, or benzyloxycarbonyl-NH-- (CBZ-NH--), wherein R and R₁ are each independently hydrogen or lower alkyl and wherein the phenyl ring may be substituted with 1 to 3 substituents selected from the group consisting of C₁-C₄ alkyl, C₁-C₄ alkoxy, chloro, and bromo.

[0384]5. The free C-terminus is derivatized. Typically, the C-terminus is esterified or amidated. For example, one may use methods described in the art to add (NH--CH₂--CH₂--NH₂)₂ to compounds of this invention at the C-terminus. Likewise, one may use methods described in the art to add --NH₂ to compounds of this invention at the C-terminus. Exemplary C-terminal derivative groups include, for example, --C(O)R₂ wherein R₂ is lower alkoxy or --NR₃R₄ wherein R₃ and R₄ are independently hydrogen or C₁-C₈ alkyl (preferably C₁-C₄ alkyl).

[0385]6. A disulfide bond is replaced with another, preferably more stable, cross-linking moiety (e.g., an alkylene). See, e.g., Bhatnagar (supra); Alberts et al., Thirteenth Am. Pep. Symp., 357-9 (1993).

[0386]7. One or more individual amino acid residues is modified. Various derivatizing agents are known to react specifically with selected side chains or terminal residues, as described in detail below.

[0387]Lysinyl residues and amino terminal residues may be reacted with succinic or other carboxylic acid anhydrides, which reverse the charge of the lysinyl residues. Other suitable reagents for derivatizing alpha-amino-containing residues include imidoesters such as methyl picolinimidate; pyridoxal phosphate; pyridoxal; chloroborohydride; trinitrobenzenesulfonic acid; O-methylisourea; 2,4 pentanedione; and transaminase-catalyzed reaction with glyoxylate.

[0388]Arginyl residues may be modified by reaction with any one or combination of several conventional reagents, including phenylglyoxal, 2,3-butanedione, 1,2-cyclohexanedione, and ninhydrin. Derivatization of arginyl residues requires that the reaction be performed in alkaline conditions because of the high pKa of the guanidine functional group. Furthermore, these reagents may react with the groups of lysine as well as the arginine epsilon-amino group.

[0389]Specific modification of tyrosyl residues has been studied extensively, with particular interest in introducing spectral labels into tyrosyl residues by reaction with aromatic diazonium compounds or tetranitromethane. Most commonly, N-acetylimidizole and tetranitromethane are used to form O-acetyl tyrosyl species and 3-nitro derivatives, respectively.

[0390]Carboxyl side chain groups (aspartyl or glutamyl) may be selectively modified by reaction with carbodiimides (R'--N═C═N--R') such as 1-cyclohexyl-3-(2-morpholinyl-(4-ethyl) carbodiimide or 1-ethyl-3-(4-azonia-4,4-dimethylpentyl) carbodiimide. Furthermore, aspartyl and glutamyl residues may be converted to asparaginyl and glutaminyl residues by reaction with ammonium ions.

[0391]Glutaminyl and asparaginyl residues may be deamidated to the corresponding glutamyl and aspartyl residues. Alternatively, these residues are deamidated under mildly acidic conditions. Either form of these residues falls within the scope of this invention.

[0392]Cysteinyl residues can be replaced by amino acid residues or other moieties either to eliminate disulfide bonding or, conversely, to stabilize cross-linking. See, e.g., Bhatnagar, (supra).

[0393]Derivatization with bifunctional agents is useful for cross-linking the peptides or their functional derivatives to a water-insoluble support matrix or to other macromolecular vehicles. Commonly used cross-linking agents include, e.g., 1,1-bis(diazoacetyl)-2-phenylethane, glutaraldehyde, N-hydroxysuccinimide esters, for example, esters with 4-azidosalicylic acid, homobifunctional imidoesters, including disuccinimidyl esters such as 3,3'-dithiobis(succinimidylpropionate), and bifunctional maleimides such as bis-N-maleimido-1,8-octane. Derivatizing agents such as methyl-3-[(p-azidophenyl)dithio]propioimidate yield photoactivatable intermediates that are capable of forming crosslinks in the presence of light. Alternatively, reactive water-insoluble matrices such as cyanogen bromide-activated carbohydrates and the reactive substrates described in U.S. Pat. Nos. 3,969,287; 3,691,016; 4,195,128; 4,247,642; 4,229,537; and 4,330,440 are employed for protein immobilization.

[0394]Carbohydrate (oligosaccharide) groups may conveniently be attached to sites that are known to be glycosylation sites in proteins. Generally, O-linked oligosaccharides are attached to serine (Ser) or threonine (Thr) residues while N-linked oligosaccharides are attached to asparagine (Asn) residues when they are part of the sequence Asn-X-Ser/Thr, where X can be any amino acid except proline. X is preferably one of the 19 naturally occurring amino acids other than proline. The structures of N-linked and O-linked oligosaccharides and the sugar residues found in each type are different. One type of sugar that is commonly found on both is N-acetylneuraminic acid (referred to as sialic acid). Sialic acid is usually the terminal residue of both N-linked and O-linked oligosaccharides and, by virtue of its negative charge, may confer acidic properties to the glycosylated compound. Such site(s) may be incorporated in the linker of the compounds of this invention and are preferably glycosylated by a cell during recombinant production of the polypeptide compounds (e.g., in mammalian cells such as CHO, BHK, COS). However, such sites may further be glycosylated by synthetic or semi-synthetic procedures known in the art.

[0395]Other possible modifications include hydroxylation of proline and lysine, phosphorylation of hydroxyl groups of seryl or threonyl residues, oxidation of the sulfur atom in Cys, methylation of the alpha-amino groups of lysine, arginine, and histidine side chains [Creighton, Proteins: Structure and Molecule Properties (W. H. Freeman & Co., San Francisco), pp. 79-86 (1983)].

[0396]Compounds of the present invention may be changed at the DNA level, as well. The DNA sequence of any portion of the compound may be changed to codons more compatible with the chosen host cell. For E. coli, which is the preferred host cell, optimized codons are known in the art. Codons may be substituted to eliminate restriction sites or to include silent restriction sites, which may aid in processing of the DNA in the selected host cell. The vehicle, linker and peptide DNA sequences may be modified to include any of the foregoing sequence changes.

Affinity Maturation

[0397]One embodiment of the present invention includes "affinity matured" peptides and peptibodies. This procedure contemplates increasing the affinity or the bio-activity of the peptides and peptibodies of the present invention using phage display or other selection technologies. Based on a consensus sequence (which is generated for a collection of related peptides), directed secondary phage display libraries can be generated in which the "core" amino acids (determined from the consensus sequence) are held constant or are biased in frequency of occurrence. Alternatively, an individual peptide sequence can be used to generate a biased, directed phage display library. Panning of such libraries can yield peptides (which can be converted to peptibodies) with enhanced binding to Ang-2 or with enhanced bio-activity.

Non-Peptide Analogs/Protein Mimetics

[0398]Furthermore, non-peptide analogs of peptides that provide a stabilized structure or lessened biodegradation, are also contemplated. Peptide mimetic analogs can be prepared based on a selected inhibitory peptide by replacement of one or more residues by nonpeptide moieties. Preferably, the nonpeptide moieties permit the peptide to retain its natural confirmation, or stabilize a preferred, e.g., bioactive, confirmation which retains the ability to recognize and bind Ang-2. In one aspect, the resulting analog/mimetic exhibits increased binding affinity for Ang-2. One example of methods for preparation of nonpeptide mimetic analogs from peptides is described in Nachman et al., Regul. Pept. 57:359-370 (1995). If desired, the peptides of the invention can be modified, for instance, by glycosylation, amidation, carboxylation, or phosphorylation, or by the creation of acid addition salts, amides, esters, in particular C-terminal esters, and N-acyl derivatives of the peptides of the invention. The peptibodies also can be modified to create peptide derivatives by forming covalent or noncovalent complexes with other moieties. Covalently-bound complexes can be prepared by linking the chemical moieties to functional groups on the side chains of amino acids comprising the peptibodies, or at the N- or C-terminus.

[0399]In particular, it is anticipated that the peptides can be conjugated to a reporter group, including, but not limited to a radiolabel, a fluorescent label, an enzyme (e.g., that catalyzes a colorimetric or fluorometric reaction), a substrate, a solid matrix, or a carrier (e.g., biotin or avidin). The invention accordingly provides a molecule comprising a peptibody molecule, wherein the molecule preferably further comprises a reporter group selected from the group consisting of a radiolabel, a fluorescent label, an enzyme, a substrate, a solid matrix, and a carrier. Such labels are well known to those of skill in the art, e.g., biotin labels are particularly contemplated. The use of such labels is well known to those of skill in the art and is described in, e.g., U.S. Pat. Nos. 3,817,837; 3,850,752; 3,996,345; and 4,277,437. Other labels that will be useful include but are not limited to radioactive labels, fluorescent labels and chemiluminescent labels. U.S. patents concerning use of such labels include, for example, U.S. Pat. Nos. 3,817,837; 3,850,752; 3,939,350; and 3,996,345. Any of the peptibodies of the present invention may comprise one, two, or more of any of these labels.

Methods of Making Peptides

[0400]The peptides of the present invention can be generated using a wide variety of techniques known in the art. For example, such peptides can be synthesized in solution or on a solid support in accordance with conventional techniques. Various automatic synthesizers are commercially available and can be used in accordance with known protocols. See, for example, Stewart and Young (supra); Tam et al., J. Am. Chem. Soc., 105:6442, (1983); Merrifield, Science 232:341-347 (1986); Barany and Merrifield, The Peptides, Gross and Meienhofer, eds, Academic Press, New York, 1-284; Barany et al., Int. J. Pep. Protein Res., 30:705-739 (1987); and U.S. Pat. No. 5,424,398, each incorporated herein by reference.

[0401]Solid phase peptide synthesis methods use a copoly(styrene-divinylbenzene) containing 0.1-1.0 mM amines/g polymer. These methods for peptide synthesis use butyloxycarbonyl (t-BOC) or 9-fluorenylmethyloxy-carbonyl (FMOC) protection of alpha-amino groups. Both methods involve stepwise syntheses whereby a single amino acid is added at each step starting from the C-terminus of the peptide (See, Coligan et al., Curr. Prot. Immunol., Wiley Interscience, 1991, Unit 9). On completion of chemical synthesis, the synthetic peptide can be deprotected to remove the t-BOC or FMOC amino acid blocking groups and cleaved from the polymer by treatment with acid at reduced temperature (e.g., liquid HF-10% anisole for about 0.25 to about 1 hours at 0° C.). After evaporation of the reagents, the peptides are extracted from the polymer with 1% acetic acid solution that is then lyophilized to yield the crude material. This can normally be purified by such techniques as gel filtration on Sephadex G-15 using 5% acetic acid as a solvent. Lyophilization of appropriate fractions of the column will yield the homogeneous peptides or peptide derivatives, which can then be characterized by such standard techniques as amino acid analysis, thin layer chromatography, high performance liquid chromatography, ultraviolet absorption spectroscopy, molar rotation, solubility, and quantitated by the solid phase Edman degradation.

[0402]Other methods, such as selecting peptides from a phage display library, are also available. Libraries can be prepared from sets of amino acids as described herein. Phage display can be particularly effective in identifying peptides useful according to the invention. Briefly, one prepares a phage library (using e.g. ml 13, fd, or lambda phage), displaying inserts from 4 to about 80 amino acid residues. The inserts may represent, for example, a completely degenerate or biased array. One then can select phage-bearing inserts that bind to the desired antigen. This process can be repeated through several cycles of reselection of phage that bind to the desired antigen. Repeated rounds lead to enrichment of phage bearing particular sequences. DNA sequence analysis can be conducted to identify the sequences of the expressed peptides. The minimal linear portion of the sequence that binds to the desired antigen can be determined. One can repeat the procedure using a biased library containing inserts containing part or all of the minimal linear portion plus one or more additional degenerate residues upstream or downstream thereof. These techniques may identify peptides of the invention with still greater binding affinity for Ang-2 than agents already identified herein.

[0403]Regardless of the manner in which the peptides are prepared, a nucleic acid molecule encoding each such peptide and peptibody can be generated using standard recombinant DNA procedures. The nucleotide sequence of such DNA molecules can be manipulated as appropriate without changing the amino acid sequence they encode to account for the degeneracy of the nucleic acid code as well as to account for codon preference in particular host cells.

[0404]Recombinant DNA techniques are a convenient method for preparing full length peptibodies and other large proteinaceous specific binding agents of the present invention, or fragments thereof. A DNA molecule encoding the peptibody or fragment may be inserted into an expression vector, which can in turn be inserted into a host cell for production of the antibody or fragment.

[0405]Generally, a DNA molecule encoding a peptide or peptibody can be obtained using procedures described herein in the Examples. Probes and typical hybridization conditions are those such as set forth in Ausubel et al. (Current Protocols in Molecular Biology, Current Protocols Press [1994]). After hybridization, the probed blot can be washed at a suitable stringency, depending on such factors as probe size, expected homology of probe to clone, the type of library being screened, and the number of clones being screened. Examples of high stringency screening are 0.1×SSC, and 0.1 percent SDS at a temperature between 50-65° C.

[0406]Yeast two-hybrid screening methods also may be used to identify peptides of the invention that bind to the Ang-2. Thus, antigen, or a fragment thereof, can be used to screen peptide libraries, including phage display libraries, to identify and select Ang-2 binding agents, e.g. peptibodies, of the present invention.

[0407]Alternatively, a variety of expression vector/host systems may be utilized to contain and express the peptides of the invention. These systems include but are not limited to microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors (e.g., baculovirus); plant cell systems transfected with virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with bacterial expression vectors (e.g., Ti or pBR322 plasmid); or animal cell systems. Mammalian cells that are useful in recombinant protein productions include but are not limited to VERO cells, HeLa cells, Chinese hamster ovary (CHO) cell lines, COS cells (such as COS-7), WI 38, BHK, HepG2, 3T3, RIN, MDCK, A549, PCl₂, K₅62 and 293 cells. Exemplary protocols for the recombinant expression of the peptides are described herein below.

[0408]The term "expression vector" refers to a plasmid, phage, virus or vector, for expressing a polypeptide from a DNA (RNA) sequence. An expression vector can comprise a transcriptional unit comprising an assembly of (1) a genetic element or elements having a regulatory role in gene expression, for example, promoters or enhancers, (2) a structural or sequence that encodes the binding agent which is transcribed into mRNA and translated into protein, and (3) appropriate transcription initiation and termination sequences. Structural units intended for use in yeast or eukaryotic expression systems preferably include a leader sequence enabling extracellular secretion of translated protein by a host cell. Alternatively, where recombinant protein is expressed without a leader or transport sequence, it may include an amino terminal methionyl residue. This residue may or may not be subsequently cleaved from the expressed recombinant protein to provide a final peptide product.

[0409]For example, the peptides may be recombinantly expressed in yeast using a commercially available expression system, e.g., the Pichia Expression System (Invitrogen, San Diego, Calif.), following the manufacturer's instructions. This system also relies on the pre-pro-alpha sequence to direct secretion, but transcription of the insert is driven by the alcohol oxidase (AOX1) promoter upon induction by methanol.

[0410]The secreted peptide is purified from the yeast growth medium by, e.g., the methods used to purify the peptide from bacterial and mammalian cell supernatants.

[0411]Alternatively, the cDNA encoding the peptide may be cloned into the baculovirus expression vector pVL1393 (PharMingen, San Diego, Calif.). This vector can be used according to the manufacturer's directions (PharMingen) to infect Spodoptera frugiperda cells in sF9 protein-free media and to produce recombinant protein. The recombinant protein can be purified and concentrated from the media using a heparin-Sepharose column (Pharmacia).

[0412]Alternatively, the peptide may be expressed in an insect system. Insect systems for protein expression are well known to those of skill in the art. In one such system, Autographa californica nuclear polyhedrosis virus (AcNPV) can be used as a vector to express foreign genes in Spodoptera frugiperda cells or in Trichoplusia larvae. The peptide coding sequence can be cloned into a nonessential region of the virus, such as the polyhedrin gene, and placed under control of the polyhedrin promoter. Successful insertion of the peptide will render the polyhedrin gene inactive and produce recombinant virus lacking coat protein coat. The recombinant viruses can be used to infect S. frugiperda cells or Trichoplusia larvae in which the peptide is expressed. Smith et al., J. Virol. 46: 584 (1983); Engelhard et al., Proc. Nat. Acad. Sci. (USA) 91: 3224-7 (1994).

[0413]In another example, the DNA sequence encoding the peptide can be amplified by PCR and cloned into an appropriate vector for example, pGEX-3X (Pharmacia). The pGEX vector is designed to produce a fusion protein comprising glutathione-S-transferase (GST), encoded by the vector, and a protein encoded by a DNA fragment inserted into the vector's cloning site. The primers for PCR can be generated to include for example, an appropriate cleavage site. Where the fusion moiety is used solely to facilitate expression or is otherwise not desirable as an attachment to the peptide of interest, the recombinant fusion protein may then be cleaved from the GST portion of the fusion protein. The pGEX-3X/specific binding agent peptide construct is transformed into E. coli XL-1 Blue cells (Stratagene, La Jolla Calif.), and individual transformants isolated and grown. Plasmid DNA from individual transformants can be purified and partially sequenced using an automated sequencer to confirm the presence of the desired specific binding agent encoding nucleic acid insert in the proper orientation.

[0414]Certain peptide compositions of the present invention are those in which a peptibody is conjugated to any anti-tumor peptide such as tumor necrosis factor (TNF). In a particularly preferred method, the TNF-specific binding agent peptides chimeras are generated as recombinant fusions with peptide-encoding sequences fused in frame to TNF (Novagen, Madison, Wis.) encoding sequences. Peptide-TNF cDNA can be cloned into pET-11b vector (Novagen) and the expression of TNF-peptides in BL21 E. coli can be induced according to the pET11b manufacturer's instruction. Soluble TNF-peptides can be purified from bacterial lysates by ammonium sulfate preparation, hydrophobic interaction chromatography on Phenyl-Sepharose 6 Fast Flow, ion exchange chromatography on DEAE-Sepharose Fast Flow and gel filtration chromatography on Sephacryl-S-300 HR.

[0415]The fusion protein, which may be produced as an insoluble inclusion body in the bacteria, can be purified as follows. Host cells can be sacrificed by centrifugation; washed in 0.15 M NaCl, 10 mM Tris, pH 8, 1 mM EDTA; and treated with 0.1 mg/ml lysozyme (Sigma, St. Louis, Mo.) for 15 minutes at room temperature. The lysate can be cleared by sonication, and cell debris can be pelleted by centrifugation for 10 minutes at 12,000×g. The fusion protein-containing pellet can be resuspended in 50 mM Tris, pH 8, and 10 mM EDTA, layered over 50% glycerol, and centrifuged for 30 minutes at 6000×g. The pellet can be resuspended in standard phosphate buffered saline solution (PBS) free of Mg++ and Ca++. The fusion protein can be further purified by fractionating the resuspended pellet in a denaturing SDS-PAGE (Sambrook et al., supra). The gel can be soaked in 0.4 M KCl to visualize the protein, which can be excised and electroeluted in gel-running buffer lacking SDS. If the GST/fusion protein is produced in bacteria as a soluble protein, it can be purified using the GST Purification Module (Pharmacia).

[0416]The fusion protein may be subjected to digestion to cleave the GST from the peptide of the invention. The digestion reaction (20-40 mg fusion protein, 20-30 units human thrombin (4000 U/mg, Sigma) in 0.5 ml PBS can be incubated 16-48 hrs at room temperature and loaded on a denaturing SDS-PAGE gel to fractionate the reaction products. The gel can be soaked in 0.4 M KCl to visualize the protein bands. The identity of the protein band corresponding to the expected molecular weight of the peptide can be confirmed by amino acid sequence analysis using an automated sequencer (Applied Biosystems Model 473A, Foster City, Calif.). Alternatively, the identity can be confirmed by performing HPLC and/or mass spectrometry of the peptides.

[0417]Alternatively, a DNA sequence encoding the peptide can be cloned into a plasmid containing a desired promoter and, optionally, a leader sequence [Better et al., Science 240:1041-43 (1988)]. The sequence of this construct can be confirmed by automated sequencing. The plasmid can then be transformed into E. coli strain MC11061 using standard procedures employing CaCl2 incubation and heat shock treatment of the bacteria (Sambrook et al., supra). The transformed bacteria can be grown in LB medium supplemented with carbenicillin, and production of the expressed protein can be induced by growth in a suitable medium. If present, the leader sequence can effect secretion of the peptide and be cleaved during secretion.

[0418]The secreted recombinant protein can be purified from the bacterial culture media by the methods described herein below.

[0419]Mammalian host systems for the expression of the recombinant protein are well known to those of skill in the art. Host cell strains can be chosen for a particular ability to process the expressed protein or produce certain post-translation modifications that will be useful in providing protein activity. Such modifications of the protein include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation and acylation. Different host cells such as CHO, HeLa, MDCK, 293, W138, and the like have specific cellular machinery and characteristic mechanisms for such post-translational activities and can be chosen to ensure the correct modification and processing of the introduced, foreign protein.

[0420]It is preferable that the transformed cells be used for long-term, high-yield protein production and as such stable expression is desirable. Once such cells are transformed with vectors that contain selectable markers along with the desired expression cassette, the cells can be allowed to grow for 1-2 days in an enriched media before they are switched to selective media. The selectable marker is designed to confer resistance to selection and its presence allows growth and recovery of cells that successfully express the introduced sequences. Resistant clumps of stably transformed cells can be proliferated using tissue culture techniques appropriate to the cell.

[0421]A number of selection systems can be used to recover the cells that have been transformed for recombinant protein production. Such selection systems include, but are not limited to, HSV thymidine kinase, hypoxanthine-guanine phosphoribosyltransferase and adenine phosphoribosyltransferase genes, in tk-, hgprt- or aprt- cells, respectively. Also, anti-metabolite resistance can be used as the basis of selection for DHFR which confers resistance to methotrexate; gpt which confers resistance to mycophenolic acid; neo which confers resistance to the aminoglycoside G418 and confers resistance to chlorsulfuron; and hygro which confers resistance to hygromycin. Additional selectable genes that may be useful include trpB, which allows cells to utilize indole in place of tryptophan, or hisD, which allows cells to utilize histinol in place of histidine. Markers that give a visual indication for identification of transformants include anthocyanins, β-glucuronidase and its substrate, GUS, and luciferase and its substrate, luciferin.

Purification and Refolding of Specific Binding Agents

[0422]In some cases, the specific binding agents such as the peptides and/or peptibodies of this invention may need to be "refolded" and oxidized into a proper tertiary structure and generating disulfide linkages in order to be biologically active. Refolding can be accomplished using a number of procedures well known in the art. Such methods include, for example, exposing the solubilized polypeptide agent to a pH usually above 7 in the presence of a chaotropic agent. The selection of chaotrope is similar to the choices used for inclusion body solubilization, however a chaotrope is typically used at a lower concentration. An exemplary chaotropic agent is guanidine. In most cases, the refolding/oxidation solution will also contain a reducing agent plus its oxidized form in a specific ratio to generate a particular redox potential which allows for disulfide shuffling to occur for the formation of cysteine bridges. Some commonly used redox couples include cysteine/cystamine, glutathione/dithiobisGSH, cupric chloride, dithiothreitol DTT/dithiane DTT, and 2-mercaptoethanol (bME)/dithio-bME. In many instances, a co-solvent may be used to increase the efficiency of the refolding. Commonly used cosolvents include glycerol, polyethylene gluycol of various molecular weights, and arginine.

[0423]It may be desirable to purify the peptides and peptibodies of the present invention. Protein purification techniques are well known to those of skill in the art. These techniques involve, at one level, the crude fractionation of the proteinaceous and non-proteinaceous fractions. Having separated the peptide and/or peptibody from other proteins, the peptide or polypeptide of interest can be further purified using chromatographic and electrophoretic techniques to achieve partial or complete purification (or purification to homogeneity). Analytical methods particularly suited to the preparation of peptibodies and peptides or the present invention are ion-exchange chromatography, exclusion chromatography; polyacrylamide gel electrophoresis; isoelectric focusing. A particularly efficient method of purifying peptides is fast protein liquid chromatography or even HPLC.

[0424]Certain aspects of the present invention concern the purification, and in particular embodiments, the substantial purification, of a peptibody or peptide of the present invention. The term "purified peptibody or peptide" as used herein, is intended to refer to a composition, isolatable from other components, wherein the peptibody or peptide is purified to any degree relative to its naturally-obtainable state. A purified peptide or peptibody therefore also refers to a peptibody or peptide that is free from the environment in which it may naturally occur.

[0425]Generally, "purified" will refer to a peptide or peptibody composition that has been subjected to fractionation to remove various other components, and which composition substantially retains its expressed biological activity. Where the term "substantially purified" is used, this designation will refer to a peptide or peptibody composition in which the peptibody or peptide forms the major component of the composition, such as constituting about 50%, about 60%, about 70%, about 80%, about 90%, about 95% or more of the proteins in the composition.

[0426]Various methods for quantifying the degree of purification of the peptide or peptibody will be known to those of skill in the art in light of the present disclosure. These include, for example, determining the specific binding activity of an active fraction, or assessing the amount of peptide or peptibody within a fraction by SDS/PAGE analysis. A preferred method for assessing the purity of a peptide or peptibody fraction is to calculate the binding activity of the fraction, to compare it to the binding activity of the initial extract, and to thus calculate the degree of purification, herein assessed by a "-fold purification number." The actual units used to represent the amount of binding activity will, of course, be dependent upon the particular assay technique chosen to follow the purification and whether or not the peptibody or peptide exhibits a detectable binding activity.

[0427]Various techniques suitable for use in purification will be well known to those of skill in the art. These include, for example, precipitation with ammonium sulphate, PEG, antibodies (immunoprecipitation) and the like or by heat denaturation, followed by centrifugation; chromatography steps such as affinity chromatography (e.g., Protein-A-Sepharose), ion exchange, gel filtration, reverse phase, hydroxylapatite and affinity chromatography; isoelectric focusing; gel electrophoresis; and combinations of such and other techniques. As is generally known in the art, it is believed that the order of conducting the various purification steps may be changed, or that certain steps may be omitted, and still result in a suitable method for the preparation of a substantially purified specific binding agent.

[0428]There is no general requirement that the peptide or peptibody of the present invention always be provided in its most purified state. Indeed, it is contemplated that less substantially specific binding agent products will have utility in certain embodiments. Partial purification may be accomplished by using fewer purification steps in combination, or by utilizing different forms of the same general purification scheme. For example, it is appreciated that a cation-exchange column chromatography performed utilizing an HPLC apparatus will generally result in a greater "-fold" purification than the same technique utilizing a low-pressure chromatography system. Methods exhibiting a lower degree of relative purification may have advantages in total recovery of the peptide or peptibody, or in maintaining binding activity of the peptide or peptibody.

[0429]It is known that the migration of a peptide or polypeptide can vary, sometimes significantly, with different conditions of SDS/PAGE [Capaldi et al., Biochem. Biophys. Res. Comm., 76: 425 (1977)]. It will therefore be appreciated that under differing electrophoresis conditions, the apparent molecular weights of purified or partially purified specific binding agent expression products may vary.

Binding Assays

[0430]Immunological binding assays typically utilize a capture agent to bind specifically to and often immobilize the analyte target antigen. The capture agent is a moiety that specifically binds to the analyte. In one embodiment of the present invention, the capture agent is a peptide or peptibody or fragment thereof that specifically binds Ang-2. These immunological binding assays are well known in the art [Asai, ed., Methods in Cell Biology, Vol. 37, Antibodies in Cell Biology, Academic Press, Inc., New York (1993)].

[0431]Immunological binding assays frequently utilize a labeling agent that will signal the existence of the bound complex formed by the capture agent and antigen. The labeling agent can be one of the molecules comprising the bound complex; i.e. it can be a labeled specific binding agent or a labeled anti-specific binding agent antibody. Alternatively, the labeling agent can be a third molecule, commonly another antibody, which binds to the bound complex. The labeling agent can be, for example, an anti-specific binding agent antibody bearing a label. The second antibody, specific for the bound complex, may lack a label, but can be bound by a fourth molecule specific to the species of antibodies which the second antibody is a member of. For example, the second antibody can be modified with a detectable moiety, such as biotin, which can then be bound by a fourth molecule, such as enzyme-labeled streptavidin. Other proteins capable of specifically binding immunoglobulin constant regions, such as protein A or protein G may also be used as the labeling agent. These binding proteins are normal constituents of the cell walls of streptococcal bacteria and exhibit a strong non-immunogenic reactivity with immunoglobulin constant regions from a variety of species. Akerstrom, J. Immunol., 135:2589-2542 (1985); Chaubert, Mod. Pathol., 10:585-591 (1997).

[0432]Throughout the assays, incubation and/or washing steps may be required after each combination of reagents. Incubation steps can vary from about 5 seconds to several hours, preferably from about 5 minutes to about 24 hours. However, the incubation time will depend upon the assay format, analyte, volume of solution, concentrations, and the like. Usually, the assays will be carried out at ambient temperature, although they can be conducted over a range of temperatures.

A. Non-Competitive Binding Assays:

[0433]Immunological binding assays can be of the non-competitive type. These assays have an amount of captured analyte that is directly measured. For example, in one preferred "sandwich" assay, the capture agent (antibody or peptibody) can be bound directly to a solid substrate where it is immobilized. These immobilized capture agents then capture (bind to) antigen present in the test sample. The protein thus immobilized is then bound to a labeling agent, such as a second antibody having a label. In another preferred "sandwich" assay, the second antibody lacks a label, but can be bound by a labeled antibody specific for antibodies of the species from which the second antibody is derived. The second antibody also can be modified with a detectable moiety, such as biotin, to which a third labeled molecule can specifically bind, such as streptavidin. See Harlow and Lane, Antibodies, A Laboratory Manual, Ch 14, Cold Spring Harbor Laboratory, NY (1988), incorporated herein by reference.

B. Competitive Binding Assays:

[0434]Immunological binding assays can be of the competitive type. The amount of analyte present in the sample is measure indirectly by measuring the amount of an added analyte displaced, or competed away, from a capture agent (antibody or peptibody) by the analyte present in the sample. In one preferred competitive binding assay, a known amount of analyte, usually labeled, is added to the sample and the sample is then contacted with the capture agent. The amount of labeled analyze bound to the antibody is inversely proportional to the concentration of analyte present in the sample (See, Harlow and Lane, Antibodies, A Laboratory Manual, Ch 14, pp. 579-583, supra).

[0435]In another preferred competitive binding assay, the capture agent is immobilized on a solid substrate. The amount of protein bound to the capture agent may be determined either by measuring the amount of protein present in a protein/antibody complex, or alternatively by measuring the amount of remaining uncomplexed protein. The amount of protein may be detected by providing a labeled protein. Harlow and Lane (supra).

[0436]Yet another preferred competitive binding assay, hapten inhibition is utilized. Here, a known analyte is immobilized on a solid substrate. A known amount of antibody is added to the sample, and the sample is contacted with the immobilized analyte. The amount of antibody bound to the immobilized analyte is inversely proportional to the amount of analyte present in the sample. The amount of immobilized antibody may be detected by detecting either the immobilized fraction of antibody or the fraction that remains in solution. Detection may be direct where the antibody is labeled or indirect by the subsequent addition of a labeled moiety that specifically binds to the antibody as described above.

C. Utilization of Competitive Binding Assays:

[0437]The competitive binding assays can be used for cross-reactivity determinations to permit a skilled artisan to determine if a protein or enzyme complex which is recognized by a peptibody of the invention is the desired protein and not a cross-reacting molecule or to determine whether the peptibody is specific for the antigen and does not bind unrelated antigens. In assays of this type, antigen can be immobilized to a solid support and an unknown protein mixture is added to the assay, which will compete with the binding of the peptibodies to the immobilized protein. The competing molecule also binds one or more antigens unrelated to the antigen. The ability of the proteins to compete with the binding of the peptibodies to the immobilized antigen is compared to the binding by the same protein that was immobilized to the solid support to determine the cross-reactivity of the protein mix.

D. Other Binding Assays

[0438]The present invention also provides Western blot methods to detect or quantify the presence of Ang-2 in a sample. The technique generally comprises separating sample proteins by gel electrophoresis on the basis of molecular weight and transferring the proteins to a suitable solid support, such as nitrocellulose filter, a nylon filter, or derivatized nylon filter. The sample is incubated with peptibodies or fragments thereof that specifically bind Ang-2 and the resulting complex is detected. These peptibodies may be directly labeled or alternatively may be subsequently detected using labeled antibodies that specifically bind to the peptibody.

Diagnostic Assays

[0439]The derivative binding agents, such as peptides and peptibodies or fragments thereof, of the present invention are useful for the diagnosis of conditions or diseases characterized by expression of Ang-2 or subunits, or in assays to monitor patients being treated with inducers of Ang-2, its fragments, agonists or inhibitors of Ang-2 activity. Diagnostic assays for Ang-2 include methods utilizing a peptibody and a label to detect Ang-2 in human body fluids or extracts of cells or tissues. The peptibodies of the present invention can be used with or without modification. In a preferred diagnostic assay, the peptibodies will be labeled by attaching, e.g., a label or a reporter molecule. A wide variety of labels and reporter molecules are known, some of which have been already described herein. In particular, the present invention is useful for diagnosis of human disease.

[0440]A variety of protocols for measuring Ang-2 proteins using peptibodies specific for the respective protein are known in the art. Examples include enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA) and fluorescence activated cell sorting (FACS). A two-site, monoclonal-based immunoassay utilizing monoclonal antibodies reactive to two non-interfering epitopes on Ang-2 is preferred, but a competitive binding assay can be employed. These assays are described, for example, in Maddox et al., J. Exp. Med., 158:1211 (1983).

[0441]In order to provide a basis for diagnosis, normal or standard values for human Ang-2 expression are usually established. This determination can be accomplished by combining body fluids or cell extracts from normal subjects, preferably human, with a peptibody to Ang-2, under conditions suitable for complex formation that are well known in the art. The amount of standard complex formation can be quantified by comparing the binding of the peptibodies to known quantities of Ang-2 protein, with both control and disease samples. Then, standard values obtained from normal samples can be compared with values obtained from samples from subjects potentially affected by disease. Deviation between standard and subject values suggests a role for Ang-2 in the disease state.

[0442]For diagnostic applications, in certain embodiments peptibodies or peptides of the present invention typically will be labeled with a detectable moiety. The detectable moiety can be any one that is capable of producing, either directly or indirectly, a detectable signal. For example, the detectable moiety may be a radioisotope, such as ³H, ¹⁴C, ³²P, ³5S, or ¹²⁵I, a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate, rhodamine, or luciferin; or an enzyme, such as alkaline phosphatase, β-galactosidase, or horseradish peroxidase. Bayer et al., Meth. Enz., 184: 138-163, (1990).

Diseases

[0443]The present invention provides a binding agent such as a peptide, peptibody, or fragment, variant or derivative thereof that binds to Ang-2 that is useful for the treatment of human diseases and pathological conditions. Agents that modulate Ang-2 binding activity, or other cellular activity, may be used in combination with other therapeutic agents to enhance their therapeutic effects or decrease potential side effects.

[0444]In one aspect, the present invention provides reagents and methods useful for treating diseases and conditions characterized by undesirable or aberrant levels of Ang-2 activity in a cell. These diseases include cancers, and other hyperproliferative conditions, such as hyperplasia, psoriasis, contact dermatitis, immunological disorders, and infertility.

[0445]The present invention also provides methods of treating cancer in an animal, including humans, comprising administering to the animal an effective amount of a specific binding agent, such as a peptibody, that inhibits or decreases Ang-2 activity. The invention is further directed to methods of inhibiting cancer cell growth, including processes of cellular proliferation, invasiveness, and metastasis in biological systems. Methods include use of a compound of the invention as an inhibitor of cancer cell growth. Preferably, the methods are employed to inhibit or reduce cancer cell growth, invasiveness, metastasis, or tumor incidence in living animals, such as mammals. Methods of the invention are also readily adaptable for use in assay systems, e.g., assaying cancer cell growth and properties thereof, as well as identifying compounds that affect cancer cell growth.

[0446]The cancers treatable by methods of the present invention preferably occur in mammals. Mammals include, for example, humans and other primates, as well as pet or companion animals such as dogs and cats, laboratory animals such as rats, mice and rabbits, and farm animals such as horses, pigs, sheep, and cattle.

[0447]Tumors or neoplasms include growths of tissue cells in which the multiplication of the cells is uncontrolled and progressive. Some such growths are benign, but others are termed malignant and may lead to death of the organism. Malignant neoplasms or cancers are distinguished from benign growths in that, in addition to exhibiting aggressive cellular proliferation, they may invade surrounding tissues and metastasize. Moreover, malignant neoplasms are characterized in that they show a greater loss of differentiation (greater dedifferentiation), and of their organization relative to one another and their surrounding tissues. This property is also called "anaplasia."

[0448]Neoplasms treatable by the present invention also include solid tumors, i.e., carcinomas and sarcomas. Carcinomas include those malignant neoplasms derived from epithelial cells that infiltrate (invade) the surrounding tissues and give rise to metastases. Adenocarcinomas are carcinomas derived from glandular tissue, or which form recognizable glandular structures. Another broad category or cancers includes sarcomas, which are tumors whose cells are embedded in a fibrillar or homogeneous substance like embryonic connective tissue. The invention also enables treatment of cancers of the myeloid or lymphoid systems, including leukemias, lymphomas and other cancers that typically do not present as a tumor mass, but are distributed in the vascular or lymphoreticular systems.

[0449]The type of cancer or tumor cells amenable to treatment according to the invention include, for example, ACTH-producing tumor, acute lymphocytic leukemia, acute nonlymphocytic leukemia, cancer of the adrenal cortex, bladder cancer, brain cancer, breast cancer, cervical cancer, chronic lymphocytic leukemia, chronic myelocytic leukemia, colorectal cancer, cutaneous T-cell lymphoma, endometrial cancer, esophageal cancer, Ewing's sarcoma, gallbladder cancer, hairy cell leukemia, head and neck cancer, Hodgkin's lymphoma, Kaposi's sarcoma, kidney cancer, liver cancer, lung cancer (small and non-small cell), malignant peritoneal effusion, malignant pleural effusion, melanoma, mesothelioma, multiple myeloma, neuroblastoma, glioma, non-Hodgkin's lymphoma, osteosarcoma, ovarian cancer, ovarian (germ cell) cancer, pancreatic cancer, penile cancer, prostate cancer, retinoblastoma, skin cancer, soft tissue sarcoma, squamous cell carcinomas, stomach cancer, testicular cancer, thyroid cancer, trophoblastic neoplasms, uterine cancer, vaginal cancer, cancer of the vulva, and Wilms' tumor.

[0450]The invention is particularly illustrated herein in reference to treatment of certain types of experimentally defined cancers. In these illustrative treatments, standard state-of-the-art in vitro and in vivo models have been used. These methods can be used to identify agents that can be expected to be efficacious in in vivo treatment regimens. However, it will be understood that the method of the invention is not limited to the treatment of these tumor types, but extends to any solid tumor derived from any organ system. Cancers whose invasiveness or metastasis is associated with Ang-2 expression or activity are especially susceptible to being inhibited or even induced to regress by means of the invention.

[0451]The invention can also be practiced by including with a compound of the invention such as a peptibody in combination with another anti-cancer chemotherapeutic agent, such as any conventional chemotherapeutic agent. The combination of a specific binding agent with such other agents can potentiate the chemotherapeutic protocol. Numerous chemotherapeutic protocols will present themselves in the mind of the skilled practitioner as being capable of incorporation into the method of the invention. Any chemotherapeutic agent can be used, including alkylating agents, antimetabolites, hormones and antagonists, radioisotopes, as well as natural products. For example, the compound of the invention can be administered with antibiotics such as doxorubicin and other anthracycline analogs, nitrogen mustards such as cyclophosphamide, pyrimidine analogs such as 5-fluorouracil, cisplatin, hydroxyurea, taxol and its natural and synthetic derivatives, and the like. As another example, in the case of mixed tumors, such as adenocarcinoma of the breast, where the tumors include gonadotropin-dependent and gonadotropin-independent cells, the compound can be administered in conjunction with leuprolide or goserelin (synthetic peptide analogs of LH-RH). Other antineoplastic protocols include the use of a tetracycline compound with another treatment modality, e.g., surgery, radiation, etc., also referred to herein as "adjunct antineoplastic modalities." Thus, the method of the invention can be employed with such conventional regimens with the benefit of reducing side effects and enhancing efficacy.

[0452]The present invention thus provides compositions and methods useful for the treatment of a wide variety of cancers, including solid tumors and leukemias. Types of cancer that may be treated include, but are not limited to: adenocarcinoma of the breast, prostate, and colon; all forms of bronchogenic carcinoma of the lung; myeloid; melanoma; hepatoma; neuroblastoma; papilloma; apudoma; choristoma; branchioma; malignant carcinoid syndrome; carcinoid heart disease; carcinoma (e.g., Walker, basal cell, basosquamous, Brown-Pearce, ductal, Ehrlich tumor, Krebs 2, merkel cell, mucinous, non-small cell lung, oat cell, papillary, scirrhous, bronchiolar, bronchogenic, squamous cell, and transitional cell); histiocytic disorders; leukemia; histiocytosis malignant; Hodgkin's disease; immunoproliferative small lung cell carcinoma; non-Hodgkin's lymphoma; plasmacytoma; reticuloendotheliosis; melanoma; chondroblastoma; chondroma; chondrosarcoma; fibroma; fibrosarcoma; giant cell tumors; histiocytoma; lipoma; liposarcoma; mesothelioma; myxoma; myxosarcoma; osteoma; osteosarcoma; chordoma; craniopharyngioma; dysgerminoma; hamartoma; mesenchymoma; mesonephroma; myosarcoma; ameloblastoma; cementoma; odontoma; teratoma; thymoma; tophoblastic tumor. Further, the following types of cancers may also be treated: adenoma; cholangioma; cholesteatoma; cyclindroma; cystadenocarcinoma; cystadenoma; granulosa cell tumor; gynandroblastoma; hepatoma; hidradenoma; islet cell tumor; Leydig cell tumor; papilloma; Sertoli cell tumor; theca cell tumor; leiomyoma; leiomyosarcoma; myoblastoma; myoma; myosarcoma; rhabdomyoma; rhabdomyosarcoma; ependymoma; ganglioneuroma; glioma; medulloblastoma; meningioma; neurilemmoma; neuroblastoma; neuroepithelioma; neurofibroma; neuroma; paraganglioma; paraganglioma nonchromaffin; angiokeratoma; angiolymphoid hyperplasia with eosinophilia; angioma sclerosing; angiomatosis; glomangioma; hemangioendothelioma; hemangioma; hemangiopericytoma; hemangiosarcoma; lymphangioma; lymphangiomyoma; lymphangiosarcoma; pinealoma; carcinosarcoma; chondrosarcoma; cystosarcoma phyllodes; fibrosarcoma; hemangiosarcoma; leiomyosarcoma; leukosarcoma; liposarcoma; lymphangiosarcoma; myosarcoma; myxosarcoma; ovarian carcinoma; rhabdomyosarcoma; sarcoma; neoplasms; nerofibromatosis; and cervical dysplasia.

[0453]Another aspect of the present invention is using the materials and methods of the present invention to prevent and/or treat any hyperproliferative condition of the skin including psoriasis and contact dermatitis or other hyperproliferative diseases. It has been demonstrated that patients with psoriasis and contact dermatitis have elevated Ang-2 activity within these lesions [Ogoshi et al., J. Inv. Dermatol., 110:818-23 (1998)]. Preferably, specific binding agents specific for Ang-2 will be used in combination with other pharmaceutical agents to treat humans that express these clinical symptoms. The specific binding agents can be delivered using any of the various carriers through routes of administration described herein and others that are well known to those of skill in the art.

[0454]Other aspects of the present invention include treating various retinopathies (including diabetic retinopathy and age-related macular degeneration) in which angiogenesis is involved, as well as disorders/diseases of the female reproductive tract such as endometriosis, uterine fibroids, and other such conditions associated with dysfunctional vascular proliferation (including endometrial microvascular growth) during the female reproductive cycle.

[0455]Still another aspect of the present invention relates to treating abnormal vascular growth including cerebral arteriovenous malformations (AVMs) gastrointestinal mucosal injury and repair, ulceration of the gastroduodenal mucosa in patients with a history of peptic ulcer disease, including ischemia resulting from stroke, a wide spectrum of pulmonary vascular disorders in liver disease and portal hypertension in patients with nonhepatic portal hypertension.

[0456]Another aspect of present invention is the prevention of cancers utilizing the compositions and methods provided by the present invention. Such reagents will include specific binding agents such as peptibodies against Ang-2.

Pharmaceutical Compositions

[0457]Pharmaceutical compositions of Ang-2 specific binding agents such as peptibodies are within the scope of the present invention. Pharmaceutical compositions comprising antibodies are described in detail in, for example, U.S. Pat. No. 6,171,586, to Lam et al., issued Jan. 9, 2001. Such compositions comprise a therapeutically or prophylactically effective amount of a specific binding agent, such as an antibody, or a fragment, variant, derivative or fusion thereof as described herein, in admixture with a pharmaceutically acceptable agent. In a preferred embodiment, pharmaceutical compositions comprise antagonist specific binding agents that modulate partially or completely at least one biological activity of Ang-2 in admixture with a pharmaceutically acceptable agent. Typically, the specific binding agents will be sufficiently purified for administration to an animal.

[0458]The pharmaceutical composition may contain formulation materials for modifying, maintaining or preserving, for example, the pH, osmolarity, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition. Suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen-sulfite); buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates, other organic acids); bulking agents (such as mannitol or glycine), chelating agents [such as ethylenediamine tetraacetic acid (EDTA)]; complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxypropyl-beta-cyclodextrin); fillers; monosaccharides; disaccharides and other carbohydrates (such as glucose, mannose, or dextrins); proteins (such as serum albumin, gelatin or immunoglobulins); coloring; flavoring and diluting agents; emulsifying agents; hydrophilic polymers (such as polyvinylpyrrolidone); low molecular weight polypeptides; salt-forming counterions (such as sodium); preservatives (such as benzalkonium chloride, benzoic acid, salicylic acid, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid or hydrogen peroxide); solvents (such as glycerin, propylene glycol or polyethylene glycol); sugar alcohols (such as mannitol or sorbitol); suspending agents; surfactants or wetting agents (such as pluronics, PEG, sorbitan esters, polysorbates such as polysorbate 20, polysorbate 80, triton, tromethamine, lecithin, cholesterol, tyloxapal); stability enhancing agents (sucrose or sorbitol); tonicity enhancing agents (such as alkali metal halides (preferably sodium or potassium chloride, mannitol sorbitol); delivery vehicles; diluents; excipients and/or pharmaceutical adjuvants. (Remington's Pharmaceutical Sciences, 18th Edition, A. R. Gennaro, ed., Mack Publishing Company, 1990).

[0459]The optimal pharmaceutical composition will be determined by one skilled in the art depending upon, for example, the intended route of administration, delivery format, and desired dosage. See for example, Remington's Pharmaceutical Sciences, supra. Such compositions may influence the physical state, stability, rate of in vivo release, and rate of in vivo clearance of the specific binding agent.

[0460]The primary vehicle or carrier in a pharmaceutical composition may be either aqueous or non-aqueous in nature. For example, a suitable vehicle or carrier may be water for injection, physiological saline solution or artificial cerebrospinal fluid, possibly supplemented with other materials common in compositions for parenteral administration. Neutral buffered saline or saline mixed with serum albumin are further exemplary vehicles. Other exemplary pharmaceutical compositions comprise Tris buffer of about pH 7.0-8.5, or acetate buffer of about pH 4.0-5.5, which may further include sorbitol or a suitable substitute therefore. In one embodiment of the present invention, binding agent compositions may be prepared for storage by mixing the selected composition having the desired degree of purity with optional formulation agents (Remington's Pharmaceutical Sciences, supra) in the form of a lyophilized cake or an aqueous solution. Further, the binding agent product may be formulated as a lyophilizate using appropriate excipients such as sucrose.

[0461]The pharmaceutical compositions can be selected for parenteral delivery. Alternatively, the compositions may be selected for inhalation or for enteral delivery such as orally, aurally, opthalmically, rectally, or vaginally. The preparation of such pharmaceutically acceptable compositions is within the skill of the art.

[0462]The formulation components are present in concentrations that are acceptable to the site of administration. For example, buffers are used to maintain the composition at physiological pH or at slightly lower pH, typically within a pH range of from about 5 to about 8.

[0463]When parenteral administration is contemplated, the therapeutic compositions for use in this invention may be in the form of a pyrogen-free, parenterally acceptable aqueous solution comprising the desired specific binding agent in a pharmaceutically acceptable vehicle. A particularly suitable vehicle for parenteral injection is sterile distilled water in which a binding agent is formulated as a sterile, isotonic solution, properly preserved. Yet another preparation can involve the formulation of the desired molecule with an agent, such as injectable microspheres, bio-erodible particles, polymeric compounds (polylactic acid, polyglycolic acid), beads, or liposomes, that provides for the controlled or sustained release of the product which may then be delivered via a depot injection. Hyaluronic acid may also be used, and this may have the effect of promoting sustained duration in the circulation. Other suitable means for the introduction of the desired molecule include implantable drug delivery devices.

[0464]In another aspect, pharmaceutical formulations suitable for parenteral administration may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hanks' solution, ringer's solution, or physiologically buffered saline. Aqueous injection suspensions may contain substances that increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran. Additionally, suspensions of the active compounds may be prepared as appropriate oily injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils, such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate, triglycerides, or liposomes. Non-lipid polycationic amino polymers may also be used for delivery. Optionally, the suspension may also contain suitable stabilizers or agents to increase the solubility of the compounds and allow for the preparation of highly concentrated solutions.

[0465]In another embodiment, a pharmaceutical composition may be formulated for inhalation. For example, a binding agent may be formulated as a dry powder for inhalation. Polypeptide or nucleic acid molecule inhalation solutions may also be formulated with a propellant for aerosol delivery. In yet another embodiment, solutions may be nebulized. Pulmonary administration is further described in PCT Application No. PCT/US94/001875, which describes pulmonary delivery of chemically modified proteins.

[0466]It is also contemplated that certain formulations may be administered orally. In one embodiment of the present invention, binding agent molecules that are administered in this fashion can be formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules. For example, a capsule may be designed to release the active portion of the formulation at the point in the gastrointestinal tract when bioavailability is maximized and pre-systemic degradation is minimized. Additional agents can be included to facilitate absorption of the binding agent molecule. Diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders may also be employed.

[0467]Pharmaceutical compositions for oral administration can also be formulated using pharmaceutically acceptable carriers well known in the art in dosages suitable for oral administration. Such carriers enable the pharmaceutical compositions to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, and the like, for ingestion by the patient.

[0468]Pharmaceutical preparations for oral use can be obtained through combining active compounds with solid excipient and processing the resultant mixture of granules (optionally, after grinding) to obtain tablets or dragee cores. Suitable auxiliaries can be added, if desired. Suitable excipients include carbohydrate or protein fillers, such as sugars, including lactose, sucrose, mannitol, and sorbitol; starch from corn, wheat, rice, potato, or other plants; cellulose, such as methyl cellulose, hydroxypropylmethyl-cellulose, or sodium carboxymethylcellulose; gums, including arabic and tragacanth; and proteins, such as gelatin and collagen. If desired, disintegrating or solubilizing agents may be added, such as the cross-linked polyvinyl pyrrolidone, agar, and alginic acid or a salt thereof, such as sodium alginate.

[0469]Dragee cores may be used in conjunction with suitable coatings, such as concentrated sugar solutions, which may also contain gum arabic, talc, polyvinylpyrrolidone, carbopol gel, polyethylene glycol, and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures. Dyestuffs or pigments may be added to the tablets or dragee coatings for product identification or to characterize the quantity of active compound, i.e., dosage.

[0470]Pharmaceutical preparations that can be used orally also include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and a coating, such as glycerol or sorbitol. Push-fit capsules can contain active ingredients mixed with fillers or binders, such as lactose or starches, lubricants, such as talc or magnesium stearate, and, optionally, stabilizers. In soft capsules, the active compounds may be dissolved or suspended in suitable liquids, such as fatty oils, liquid, or liquid polyethylene glycol with or without stabilizers.

[0471]Another pharmaceutical composition may involve an effective quantity of binding agent in a mixture with non-toxic excipients that are suitable for the manufacture of tablets. By dissolving the tablets in sterile water, or other appropriate vehicle, solutions can be prepared in unit dose form. Suitable excipients include, but are not limited to, inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia; or lubricating agents such as magnesium stearate, stearic acid, or talc.

[0472]Additional pharmaceutical compositions will be evident to those skilled in the art, including formulations involving binding agent molecules in sustained- or controlled-delivery formulations. Techniques for formulating a variety of other sustained- or controlled-delivery means, such as liposome carriers, bio-erodible microparticles or porous beads and depot injections, are also known to those skilled in the art. See for example, PCT/US93/00829 that describes controlled release of porous polymeric microparticles for the delivery of pharmaceutical compositions. Additional examples of sustained-release preparations include semipermeable polymer matrices in the form of shaped articles, e.g. films, or microcapsules. Sustained release matrices may include polyesters, hydrogels, polylactides (U.S. Pat. No. 3,773,919, EP 58,481), copolymers of L-glutamic acid and gamma ethyl-L-glutamate [Sidman et al., Biopolymers, 22:547-556 (1983)], poly (2-hydroxyethyl-methacrylate) [Langer et al., J. Biomed. Mater. Res., 15:167-277, (1981)] and [Langer et al., Chem. Tech., 12:98-105 (1982)], ethylene vinyl acetate (Langer et al., supra) or poly-D(-)-3-hydroxybutyric acid (EP 133,988). Sustained-release compositions also include liposomes, which can be prepared by any of several methods known in the art. See e.g., Eppstein et al., Proc. Natl. Acad. Sci. (USA), 82:3688-3692 (1985); EP 36,676; EP 88,046; EP 143,949.

[0473]The pharmaceutical composition to be used for in vivo administration typically must be sterile. This may be accomplished by filtration through sterile filtration membranes. Where the composition is lyophilized, sterilization using this method may be conducted either prior to or following lyophilization and reconstitution. The composition for parenteral administration may be stored in lyophilized form or in solution. In addition, parenteral compositions generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.

[0474]Once the pharmaceutical composition has been formulated, it may be stored in sterile vials as a solution, suspension, gel, emulsion, solid, or a dehydrated or lyophilized powder. Such formulations may be stored either in a ready-to-use form or in a form (e.g., lyophilized) requiring reconstitution prior to administration.

[0475]In a specific embodiment, the present invention is directed to kits for producing a single-dose administration unit. The kits may each contain both a first container having a dried protein and a second container having an aqueous formulation. Also included within the scope of this invention are kits containing single and multi-chambered pre-filled syringes (e.g., liquid syringes and lyosyringes).

[0476]An effective amount of a pharmaceutical composition to be employed therapeutically will depend, for example, upon the therapeutic context and objectives. One skilled in the art will appreciate that the appropriate dosage levels for treatment will thus vary depending, in part, upon the molecule delivered, the indication for which the binding agent molecule is being used, the route of administration, and the size (body weight, body surface or organ size) and condition (the age and general health) of the patient. Accordingly, the clinician may titer the dosage and modify the route of administration to obtain the optimal therapeutic effect. A typical dosage may range from about 0.1 mg/kg to up to about 100 mg/kg or more, depending on the factors mentioned above. In other embodiments, the dosage may range from 0.1 mg/kg up to about 100 mg/kg; or 1 mg/kg up to about 100 mg/kg; or 5 mg/kg up to about 100 mg/kg.

[0477]For any compound, the therapeutically effective dose can be estimated initially either in cell culture assays or in animal models such as mice, rats, rabbits, dogs, pigs, or monkeys. An animal model may also be used to determine the appropriate concentration range and route of administration. Such information can then be used to determine useful doses and routes for administration in humans.

[0478]The exact dosage will be determined in light of factors related to the subject requiring treatment. Dosage and administration are adjusted to provide sufficient levels of the active compound or to maintain the desired effect. Factors that may be taken into account include the severity of the disease state, the general health of the subject, the age, weight, and gender of the subject, time and frequency of administration, drug combination(s), reaction sensitivities, and response to therapy. Long-acting pharmaceutical compositions may be administered every 3 to 4 days, every week, or biweekly depending on the half-life and clearance rate of the particular formulation.

[0479]The frequency of dosing will depend upon the pharmacokinetic parameters of the binding agent molecule in the formulation used. Typically, a composition is administered until a dosage is reached that achieves the desired effect. The composition may therefore be administered as a single dose, or as multiple doses (at the same or different concentrations/dosages) over time, or as a continuous infusion. Further refinement of the appropriate dosage is routinely made. Appropriate dosages may be ascertained through use of appropriate dose-response data.

[0480]The route of administration of the pharmaceutical composition is in accord with known methods, e.g. orally, through injection by intravenous, intraperitoneal, intracerebral (intra-parenchymal), intracerebroventricular, intramuscular, intra-ocular, intraarterial, intraportal, intralesional routes, intramedullary, intrathecal, intraventricular, transdermal, subcutaneous, intraperitoneal, intranasal, enteral, topical, sublingual, urethral, vaginal, or rectal means, by sustained release systems or by implantation devices. Where desired, the compositions may be administered by bolus injection or continuously by infusion, or by implantation device.

[0481]Alternatively or additionally, the composition may be administered locally via implantation of a membrane, sponge, or another appropriate material on to which the desired molecule has been absorbed or encapsulated. Where an implantation device is used, the device may be implanted into any suitable tissue or organ, and delivery of the desired molecule may be via diffusion, timed-release bolus, or continuous administration.

[0482]In some cases, it may be desirable to use pharmaceutical compositions in an ex vivo manner. In such instances, cells, tissues, or organs that have been removed from the patient are exposed to the pharmaceutical compositions after which the cells, tissues and/or organs are subsequently implanted back into the patient.

[0483]In other cases, a binding agent of the present invention such as a peptibody can be delivered by implanting certain cells that have been genetically engineered, using methods such as those described herein, to express and secrete the polypeptide. Such cells may be animal or human cells, and may be autologous, heterologous, or xenogeneic. Optionally, the cells may be immortalized. In order to decrease the chance of an immunological response, the cells may be encapsulated to avoid infiltration of surrounding tissues. The encapsulation materials are typically biocompatible, semi-permeable polymeric enclosures or membranes that allow the release of the protein product(s) but prevent the destruction of the cells by the patient's immune system or by other detrimental factors from the surrounding tissues.

Combination Therapy

[0484]Specific binding agents of the invention such as peptibodies can be utilized in combination with other therapeutics in the treatment of diseases associated with Ang-2 expression. These other therapeutics include, for example radiation treatment, chemotherapy, and targeted therapies such as Herceptin®, Rituxan®, Gleevec®, and the like. Additional combination therapies not specifically listed herein are also within the scope of the present invention.

[0485]Chemotherapy treatment can employ anti-neoplastic agents including, for example, alkylating agents including: nitrogen mustards, such as mechlorethamine, cyclophosphamide, ifosfamide, melphalan and chlorambucil; nitrosoureas, such as carmustine (BCNU), lomustine (CCNU), and semustine (methyl-CCNU); ethylenimines/methylmelamine such as thriethylenemelamine (TEM), triethylene, thiophosphoramide (thiotepa), hexamethylmelamine (HMM, altretamine); alkyl sulfonates such as busulfan; triazines such as dacarbazine (DTIC); antimetabolites including folic acid analogs such as methotrexate and trimetrexate, pyrimidine analogs such as 5-fluorouracil, fluorodeoxyuridine, gemcitabine, cytosine arabinoside (AraC, cytarabine), 5-azacytidine, 2,2'-difluorodeoxycytidine, purine analogs such as 6-mercaptopurine, 6-thioguanine, azathioprine, 2'-deoxycoformycin (pentostatin), erythrohydroxynonyladenine (EHNA), fludarabine phosphate, and 2-chlorodeoxyadenosine (cladribine, 2-CdA); natural products including antimitotic drugs such as paclitaxel, vinca alkaloids including vinblastine (VLB), vincristine, and vinorelbine, taxotere, estramustine, and estramustine phosphate; ppipodophylotoxins such as etoposide and teniposide; antibiotics such as actimomycin D, daunomycin (rubidomycin), doxorubicin, mitoxantrone, idarubicin, bleomycins, plicamycin (mithramycin), mitomycinC, and actinomycin; enzymes such as L-asparaginase; biological response modifiers such as interferon-alpha, IL-2, G-CSF and GM-CSF; miscellaneous agents including platinium coordination complexes such as cisplatin and carboplatin, anthracenediones such as mitoxantrone, substituted urea such as hydroxyurea, methylhydrazine derivatives including N-methylhydrazine (MIH) and procarbazine, adrenocortical suppressants such as mitotane (o,p'-DDD) and aminoglutethimide; hormones and antagonists including adrenocorticosteroid antagonists such as prednisone and equivalents, dexamethasone and aminoglutethimide; progestin such as hydroxyprogesterone caproate, medroxyprogesterone acetate and megestrol acetate; estrogen such as diethylstilbestrol and ethinyl estradiol equivalents; antiestrogen such as tamoxifen; androgens including testosterone propionate and fluoxymesterone/equivalents; antiandrogens such as flutamide, gonadotropin-releasing hormone analogs and leuprolide; and non-steroidal antiandrogens such as flutamide.

[0486]Combination therapy with growth factors can include cytokines, lymphokines, growth factors, or other hematopoietic factors such as M-CSF, GM-CSF, TNF, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IFN, TNF0, TNF1, TNF2, G-CSF, Meg-CSF, GM-CSF, thrombopoietin, stem cell factor, and erythropoietin. Other are compositions can include known angiopoietins, for example Ang-1, -2, -4, -Y, and/or the human Ang-like polypeptide, and/or vascular endothelial growth factor (VEGF). Growth factors include angiogenin, bone morphogenic protein-1, bone morphogenic protein-2, bone morphogenic protein-3, bone morphogenic protein-4, bone morphogenic protein-5, bone morphogenic protein-6, bone morphogenic protein-7, bone morphogenic protein-8, bone morphogenic protein-9, bone morphogenic protein-10, bone morphogenic protein-11, bone morphogenic protein-12, bone morphogenic protein-13, bone morphogenic protein-14, bone morphogenic protein-15, bone morphogenic protein receptor IA, bone morphogenic protein receptor IB, brain derived neurotrophic factor, ciliary neutrophic factor, ciliary neutrophic factor receptor, cytokine-induced neutrophil chemotactic factor 1, cytokine-induced neutrophil, chemotactic factor 2, cytokine-induced neutrophil chemotactic factor 2, endothelial cell growth factor, endothelin 1, epidermal growth factor, epithelial-derived neutrophil attractant, fibroblast growth factor 4, fibroblast growth factor 5, fibroblast growth factor 6, fibroblast growth factor 7, fibroblast growth factor 8, fibroblast growth factor 8b, fibroblast growth factor 8c, fibroblast growth factor 9, fibroblast growth factor 10, fibroblast growth factor acidic, fibroblast growth factor basic, glial cell line-derived neutrophic factor receptor-1, glial cell line-derived neutrophic factor receptor-2, growth related protein, growth related protein-1, growth related protein-2, growth related protein-3, heparin binding epidermal growth factor, hepatocyte growth factor, hepatocyte growth factor receptor, insulin-like growth factor I, insulin-like growth factor receptor, insulin-like growth factor II, insulin-like growth factor binding protein, keratinocyte growth factor, leukemia inhibitory factor, leukemia inhibitory factor receptor-1, nerve growth factor nerve growth factor receptor, neurotrophin-3, neurotrophin-4, placenta growth factor, placenta growth factor 2, platelet-derived endothelial cell growth factor, platelet derived growth factor, platelet derived growth factor A chain, platelet derived growth factor AA, platelet derived growth factor AB, platelet derived growth factor B chain, platelet derived growth factor BB, platelet derived growth factor receptor-1, platelet derived growth factor receptor-2, pre-B cell growth stimulating factor, stem cell factor, stem cell factor receptor, transforming growth factor-1, transforming growth factor-2, transforming growth factor-1, transforming growth factor-1.2, transforming growth factor-2, transforming growth factor-3, transforming growth factor-S, latent transforming growth factor-1, transforming growth factor-1 binding protein I, transforming growth factor-1 binding protein II, transforming growth factor-1 binding protein III, tumor necrosis factor receptor type I, tumor necrosis factor receptor type II, urokinase-type plasminogen activator receptor, vascular endothelial growth factor, and chimeric proteins and biologically or immunologically active fragments thereof.

Immunotherapeutics

[0487]Immunotherapeutics generally rely on the use of immune effector cells and molecules to target and destroy cancer cells. The immune effectors may be, for example, a peptibody of the present invention that recognizes some marker on the surface of a target cell. The peptibody alone may serve as an effector of therapy or it may recruit other cells to actually effect cell killing. The peptibody may also be conjugated to a drug or toxin (chemotherapeutic, radionuclide, ricin A chain, cholera toxin, pertussis toxin, etc.) and thus may merely serve as a targeting agent.

[0488]According to the present invention, mutant forms of Ang-2 may be targeted by immunotherapy either peptibodies or peptibody conjugates of the invention. It is particularly contemplated that the peptibody compositions of the invention may be used in a combined therapy approach in conjunction with Ang-2 targeted therapy.

[0489]Passive immunotherapy has proved to be particularly effective against a number of cancers. See, for example, WO 98/39027.

[0490]The following examples are intended for illustration purposes only, and should not be construed as limiting the scope of the invention in any way.

EXAMPLE 1

Ang-2 Expression in Pathological and Normal Tissue

[0491]Ang-2 expression was examined in normal and pathological tissue using in situ hybridization. Fragments of the human (Genbank Accession Number: AF004327, nucleotides 1274-1726) and murine (Genbank Accession Number: AF004326, nucleotides 1135-1588) Ang-2 sequences were amplified by reverse transcriptase-PCR from human or murine fetal lung cDNA, cloned into the pGEM-T plasmid and verified by sequencing. ³³P-labeled antisense RNA probes were transcribed from linearized plasmid templates using ³³P-UTP and RNA polymerase. Blocks of formaldehyde-fixed, paraffin-embedded tissues were sectioned at 5 μm and collected on charged slides. Prior to in situ hybridization, tissues were permeabilized with 0.2M HCL, followed by digestion with Proteinase K, and acetylation with triethanolamine and acetic anhydride. Sections were hybridized with the radio labeled probe overnight at 55° C. then subjected to RNase digestion and a high stringency wash in about 0.1×SSC at 55° C. Slides were dipped in Kodak NTB2 emulsion, exposed at 4° C. for 2-3 weeks, developed, and counterstained. Sections were examined with dark field and standard illumination to allow simultaneous evaluation of tissue morphology and hybridization signal.

[0492]The results indicated that in the normal postnatal human, Ang-2 expression is restricted to the few tissues containing angiogenic vasculature, such as the ovary, placenta, and uterus. No Ang-2 expression was detectable in normal adult human heart, brain, kidney, liver, lung, pancreas, spleen, muscle, tonsil, thymus, appendix, lymph node, gall bladder, prostate or testis. In five-week-old mouse (but not adult monkey or human), kidneys displayed prominent Ang-2 expression in the vasa recta. To determine whether this expression was a remnant of embryonic development, this experiment was repeated on kidneys derived from mice ranging in age up to one-year-old using the murine Ang-2 probe and conditions described above. Ang-2 expression was observed to decrease during neonatal development, but was still evident in kidneys of one-year-old mice.

[0493]Ang-2 expression was also detected in virtually all tumor types tested, including, primary human tumors such as colon carcinoma (5 cases), breast carcinoma (10 cases), lung carcinoma (8 cases), glioblastoma (1 case), metastatic human tumors such as breast carcinoma (2 cases), lung carcinoma (2 cases) and ovarian carcinoma (2 cases) which had metastized to brain, and rodent tumor models such as C6 (rat glioma), HT29 (human colon carcinoma), Colo-205 (human colon carcinoma), HCT116 (human colon carcinoma), A431 (human epidermoid carcinoma), A673 (human rhabdomyosarcoma), HT1080 (human fibrosarcoma), PC-3 (human prostate carcinoma), B16F10 (murine melanoma), MethA (murine sarcoma), and Lewis lung carcinoma mets. Additionally, Ang-2 expression was detected in neovessels growing into a Matrigel plug in response to VEGF and in a mouse hypoxia model of retinopathy of prematurity.

EXAMPLE 2

Molecular Assays to Evaluate Ang-2 Peptibodies

[0494]Molecular assays (Affinity ELISA, Neutralization ELISA, and BIAcore) were developed to assess direct peptibody binding to Ang-2 and related family members, and the effect of peptibodies on the Ang-2:Tie-2 interaction. These in vitro assays are described as follows.

Affinity ELISA

[0495]For the initial screening of candidate anti-Ang-2 peptibodies, purified human Ang-2 (R&D Systems, Inc; catalog number 623-AN; Ang-2 is provided as a mixture of 2 truncated versions) or murine Ang-2 polypeptide (prepared as described above) were used. For confirmatory binding assays, human Ang-2 was obtained from conditioned media of human 293T cells transfected with full length human Ang-2 DNA and cultured in serum free Dulbecco's Modified Eagle Medium (DMEM) containing about 50 micrograms per ml of bovine serum albumin (BSA).

[0496]Using microtiter plates, approximately 100 microliters per well of Ang-2 was added to each well and the plates were incubated about 2 hours, after which the plates were washed with phosphate buffered saline (PBS) containing about 0.1 percent Tween-20 four times. The wells were then blocked using about 250 microliters per well of about 5 percent BSA in PBS, and the plates were incubated at room temperature for about 2 hours. After incubation, excess blocking solution was discarded, and about 100 microliters of each candidate anti-Ang-2 peptibody was added to a well in a dilution series starting at a concentration of about 40 nanomolar and then serially diluting 4-fold in PBS containing about 1 percent BSA. The plates were then incubated overnight at room temperature. After incubation, plates were washed with PBS containing about 0.1 percent Tween-20. Washing was repeated four additional times, after which about 100 microliters per well of goat anti-human IgG(Fc)-HRP (Pierce Chemical Co., catalog #31416) previously diluted 1:5000 in PBS containing 1 percent BSA was added. Plated were incubated approximately 1 hour at room temperature. Plates were then washed five times in PBS containing about 0.1 percent Tween-20, after which about 100 microliters per well of TMB (3,3',5,5'-Tetramethylbenzidine Liquid Substrate System; Sigma Chemical Company, St. Louis, Mo., catalog number T8665) substrate was added and plates were incubated about 5-15 minutes until blue color developed. Absorbance was then read in a spectrophotometer at about 370 nm.

Neutralization ELISA

[0497]Microtiter plates to which human Ang-2 polypeptide was bound were prepared as described for the Affinity ELISA. Candidate anti-Ang-2 peptibodies were titrated from 1000 nM to 0.2 μM in 4-fold dilutions in a solution of PBS containing about 1% BSA and about 1 nM Tie-2 (provided as a Tie-2-Fc molecule where the Tie-2 portion contains only the soluble extracellular portion of the molecule; R&D Systems, catalog number 313-TI). After about 100 microliters of the antibody/Tie-2 solution was added to each well, the plates were incubated overnight at room temperature, and then washed five times in PBS containing about 0.1 percent Tween-20. After washing, about 100 microliters per well of anti-Tie-2 antibody (Pharmingen Inc., catalog #557039) was added to a final concentration of about 1 microgram per ml, and the plates were incubated about 1 hour at room temperature. Next, about 100 microliters per well of goat anti-mouse-IgG-HRP (Pierce Chemical CO., catalog #31432) was added at a dilution of 1:10,000 in PBS containing about 1 percent BSA. Plates were incubated at room temperature for about 1 hour, after which they were washed five times with PBS containing about 0.1 percent Tween-20. About 100 microliters per well of TMB substrate (described above) was then added and color was allowed to develop. Absorbance was then read in a spectrophotomer at 370 nm.

Affinity BIAcore

[0498]An affinity analysis of each candidate Ang-2 peptibody was performed on a BIAcore®2000 (Biacore, Inc., Piscataway, N.J.) with PBS and 0.005 percent P20 surfactant (Biacore, Inc.) as running buffer. Recombinant Protein G (Repligen, Needham, Mass.) was immobilized to a research grade CM5 sensor chip (Biacore, Inc.) via primary amine groups using the Amine Coupling Kit (Biacore, Inc.) according to the manufacturer's suggested protocol.

[0499]Binding assays were carried out by first capturing about 100 Ru of each candidate anti-Ang-2 peptibody to the immobilized Protein G, after which various concentrations (0-100 nM) of huAng-2 or mAng-2 were injected over the bound antibody surface at a flow rate of 50 μl/min for 3 minutes. Peptibody binding kinetic parameters including k_a (association rate constant), k_d (dissociation rate constant) and K_D (dissociation equilibrium constant) were determined using the BIA evaluation 3.1 computer program (Biacore, Inc.). Lower dissociation equilibrium constants indicated greater affinity of the peptibody for Ang-2.

EXAMPLE 3

Identification of Ang-2 Binding Peptides

1. Ang-2-Coated Magnetic Bead Preparation

A. Ang-2 Immobilization on Magnetic Beads

[0500]For non-specific elution, the biotinylated Ang-2 protein (Biotinylated Recombinant Human Angiopoietin-2, R&D Systems, Inc.; catalog number BT 623) was immobilized on the Streptavidin Dynabeads (Dynal, Lake Success, N.Y.) at a concentration of about 4 μg of the biotinylated Ang-2 protein per 100 μl of the bead stock from the manufacturer for all three rounds of selection. For antigen (Ang-2) and receptor (Tie-2) elutions, 2 μg of biotinylated Ang-2 protein was immobilized on 50 μl of the Streptavidin Dynabeads for the second rounds of selection. The coating concentration was reduced to about 1 μg of biotinylated Ang-2 protein per 50 μl of the bead stock for the third round of selection. By drawing the beads to one side of a tube using a magnet and pipetting away the liquid, the beads were washed five times with the phosphate buffer saline (PBS) and resuspended in PBS. The biotinylated Ang-2 protein was added to the washed beads at the above concentration and incubated with rotation for 1 hour at room temperature, followed by a few hours to an overnight incubation at 4° C. with rotation. Ang-2-coated beads were then blocked by adding BSA to about 1% final concentration and incubating overnight at 4° C. with rotation. The resulting Ang-2 coated beads were then washed five times with PBS before being subjected to the selection procedures.

B. Negative Selection Bead Preparation

[0501]Additional beads were also prepared for negative selections. For each panning condition, 500 μl of the bead stock from the manufacturer was subjected to the above procedure (section 1A) except that the incubation step with biotinylated Ang-2 was omitted. In the last washing step, the beads were divided into five 100 μl aliquots.

2. Selection of Ang-2 Binding Phage

A. Overall Strategy

[0502]Three filamentous phage libraries, designated as "TN8-IX" (5×10⁹ independent transformants), "TN12-I" (1.4×10⁹ independent transformants), and "Linear" (2.3×10⁹ independent transformants) (all from Dyax Corp.), were used to select for Ang-2 binding phage. Each library was then subjected to either non-specific elution, Ang-2 elution, and receptor elution (Tie-2). Nine different panning conditions were carried out for Ang-2 (TN8-IX using the non-specific elution method, TN8-IX using the Ang-2 elution method, TN8-IX using the Tie-2 elution method, TN12-I using the non-specific elution method, TN12-I using the Ang-2 elution method, and TN12-I using the Tie-2 elution method, Linear using the non-specific elution method, Linear using the Ang-2 elution method, and Linear using the Tie-2 elution method). For all three libraries, the phage from the first round of selection were eluted only in a non-specific manner for further rounds of selection. The Ang-2 and Tie-2 elutions were used in the second and third rounds of selection. For the Linear library, the selection was carried to only the second round for the Ang-2 and Tie-2 elutions.

B. Negative Selection

[0503]For each panning condition, about 100 random library equivalents for TN8-IX and TN12-I libraries (about 5×10¹¹ pfu for TN8-IX, and about 1.4×10¹¹ pfu for TN12-I) and about 10 random library equivalents for the linear library (about 1×10¹¹ pfu) were aliquoted from the library stock and diluted to about 400 μl with PBST (PBS with 0.05% Tween-20). After the last washing, liquid was drawn out from the first 100 μl aliquot of the beads prepared for negative selection (section 1B), the approximately 400 μl diluted library stock was added to the beads. The resulting mixture was incubated for about 10 minutes at room temperature with rotation. The phage supernatant was drawn out using the magnet and added to the second 100 μl aliquot for another negative selection step. In this way, five negative selection steps were performed.

C. Selection Using the Ang-2 Protein Coated Beads

[0504]The phage supernatant after the last negative selection step (section 1B) was added to the Ang-2 coated beads (section 1A). This mixture was incubated with rotation for one to two hours at room temperature, allowing phage to bind to the target protein. After the supernatant was discarded, the beads were washed about ten times with PBST followed by two washes with PBS.

D. Non-Specific Elution

[0505]After the final washing liquid was drawn out (section 2C), about 1 ml of Min A salts solution (60 mM K₂HPO₄, 33 mM KH₂PO₄, 7.6 mM (NH₄)SO₄, and 1.7 mM sodium citrate) was added to the beads. This bead mixture was added directly to a concentrated bacteria sample for infection (see below section 3A and 3B).

E. Antigen (Ang-2) Elution of Bound Phage

[0506]For round 2, after the last washing step (section 2C), the bound phage were eluted from the magnetic beads by adding 100 μl of 1 μM, 0.1 nM, and 10 nM recombinant Ang-2 protein (Recombinant Human Angiopoietin-2, R&D Systems, Inc., Minneapolis, Minn.) successively with a 30-minute incubation for each condition. The remaining phage were eluted non-specifically (section 2D). The eluted phage from 10 nM and non-specific elutions were combined, and they were subjected to the third round of selection (see Section 4, below).

[0507]For round 3, after the last washing step (section 2C), the bound phage were eluted from the magnetic beads by adding about 1 nM recombinant Ang-2 protein, and 10 nM recombinant Ang-2 protein successively with a 30-minute incubation for each condition. In addition, the phage were eluted with 1 ml of 100 mM triethylamine solution (Sigma, St. Louis, Mo.) for about 10 minutes on a rotator. The pH of the phage-containing the triethylamine solution was neutralized with 0.5 ml of 1 M Tris-HCl (pH 7.5). After the last elution with 100 mM triethylamine solution, the remaining phage were eluted by adding beads to the bacteria (section 2D).

F. Receptor (Tie-2) Elution of Bound Phage

[0508]For round 2, after the last washing step (section 2C), the bound phage were eluted from the magnetic beads by adding about 100 μl of 1 pM, 0.1 nM, and 10 nM recombinant Tie-2 protein (Recombinant Human Tie-2-Fc Chimera, R&D Systems, Inc., Minneapolis, Minn.) successively with a 30-minute incubation for each condition. The remaining phage were eluted non-specifically (section 2D). The eluted phage from 10 nM and non-specific elutions were combined and they were subjected to the third round of selection (see below section 4).

[0509]For round 3, after the last washing step (section 2C), the bound phage were eluted from the magnetic beads by adding about 1 nM of recombinant Ang-2 protein, and 10 nM recombinant Tie-2 protein successively with a 30-minute incubation for each condition. In addition, the phage were eluted with 1 ml of 100 mM triethylamine solution (Sigma, St. Louis, Mo.) for 10 minutes on a rotator. The pH of the phage containing the triethylamine solution was neutralized with 0.5 ml of 1 M Tris-HCl (pH 7.5). After the last elution with 100 mM triethylamine solution, the remaining phage were eluted by adding beads to the bacteria (section 2D).

3. Amplification

A. Preparation of Plating Cells

[0510]Fresh E. Coli. (XL-1 Blue MRF') culture was grown to an OD₆₀₀ of about 0.5 in LB media containing about 12.5 μg/ml tetracycline. For each panning condition, about 20 ml of this culture was chilled on ice and centrifuged. The bacteria pellet was resuspended in about 1 ml of the Min A Salts solution.

B. Transduction

[0511]Each mixture from each different elution method set forth above (sections 2D, 2E and 2F) was added to a concentrated bacteria sample (section 3A) and incubated at about 37° C. for about 15 minutes. Approximately 2 ml of NZCYM media (2XNZCYM, 50 μg/ml Ampicillin) was added to each mixture and incubated at about 37° C. for 15 minutes. The resulting 4 ml solution was plated on a large NZCYM agar plate containing about 50 μg/ml Ampicillin and incubated overnight at 37° C.

C. Phage Harvesting

[0512]Each bacteria/phage mixture was grown overnight on a large NZCYM agar plate (section 3B), after which they were scraped off into about 35 ml of LB media. The agar plate was further rinsed with additional 35 ml of LB media. The resulting bacteria/phage mixture in LB media was centrifuged to pellet the bacteria away. Approximately 50 ml of the phage supernatant was then transferred to a fresh tube, and about 12.5 ml of PEG solution (20% PEG8000, 3.5M ammonium acetate) was added and incubated on ice for 2 hours to precipitate phage. The precipitated phage were centrifuged down and resuspended in 6 ml of the phage resuspension buffer (250 mM NaCl, 100 mM Tris pH8, 1 mM EDTA). This phage solution was further purified by centrifuging away the remaining bacteria and precipitating the phage for the second time by adding about 1.5 ml of the PEG solution. After a centrifugation step, the phage pellet was resuspended in about 400 μl of PBS. This solution was subjected to a final centrifugation to rid the solution of any remaining bacterial debris. The resulting phage preparation was titered using standard plaque forming assays.

4. Additional Selection and Amplification

[0513]In the second round, the amplified phage preparation (about 10¹⁰ pfu) from the first round (section 3C) was used as the input phage to perform the selection and amplification steps (sections 2 and 3). For the Ang-2 and Tie-2 elutions, phage from 10 nM and non-specific elutions were combined and amplified for the third round of selection. The amplified phage preparation (about 10⁹ pfu) from the 2^nd round in turn was used as the input phage to perform 3^rd round of selection and amplification (sections 2 and 3). After the elution steps (sections 2D, 2E, and 2F) of the 3^rd round, a small fraction of the eluted phage was plated out as in the plaque formation assay (section 3C). Individual plaques were picked and placed into 96 well microtiter plates containing 100 μl of TE buffer in each well. These master plates were incubated at 4° C. overnight to allow phage to elute into the TE buffer.

5. Clonal Analysis

[0514]The phage clones were analyzed by phage ELISA and DNA sequencing. The sequences were ranked based on the combined results from these two assays.

A. Phage ELISA

[0515]An XL-1 Blue MRF' culture was grown until OD₆₀₀ reached about 0.5. About thirty μl of this culture was aliquoted into each well of a 96-well microtiter plate. About 10 μl of eluted phage (section 4) was added to each well and allowed to infect bacteria for about 15 minutes at room temperature. About 100 μL of LB media containing approximately 12.5 μg/ml of tetracycline and approximately 50 μg/ml of ampicillin were added to each well. The microtiter plate was then incubated with shaking overnight at about 37° C. The recombinant Ang-2 protein (about 1 μg/ml in PBS) was allowed to bind to the 96 well Maxisorp plates (NUNC) overnight at about 4° C. As a control, the pure streptavidin was coated onto a separate Maxisorp plate at about 2 μg/ml in PBS.

[0516]On the following day, liquid in the protein coated Maxisorp plates was discarded, and each well was blocked with about 300 μl of 5% milk solution at about 4° C. overnight (alternatively, 1 hour at room temperature). The milk solution was then discarded, and the wells were washed three times with the PBST solution. After the last washing step, about 50 μl of PBST-4% milk was added to each well of the protein coated Maxisorp plates. About 50 μl of overnight cultures from each well in the 96 well microtiter plate was transferred to the corresponding wells of the Ang-2 coated plates as well as the control streptavidin coated plates. The 100 μl mixture in the each type of plate was incubated for bout 1 hour at room temperature. The liquid was discarded from the Maxisorp plates, and the wells were washed about three times with PBST. The HRP-conjugated anti-M13 antibody (Amersham Pharmacia Biotech) was diluted to about 1:7,500, and about 100 μl of the diluted solution was added to each well of the Maxisorp plates for an approximately 1 hour incubation at room temperature. The liquid was again discarded and the wells were washed about five times with PBST. About 100 μl of TMB substrate (Sigma) was then added to each well, and the reaction was stopped with about 50 μl of the 5N H₂SO₄ solution. The OD₄₅₀ was read on a spectrophotometer (Molecular Devices).

B. Sequencing of the Phage Clones

[0517]For each phage clone, the sequencing template was prepared using PCR. The following oligonucleotide pair was used to amplify an approximately 500 nucleotide fragment:

TABLE-US-00022 (SEQ ID NO: 54) Primer 1: 5'-CGGCGCAACTATCGGTATCAAGCTG-3' (SEQ ID NO: 55) Primer 2: 5'-CATGTACCGTAACACTGAGTTTCGTC-3'

[0518]The following mixture was prepared for each clone:

TABLE-US-00023 Reagents Volume (μL)/Tube dH₂O 26.25 50% glycerol 10 10× PCR Buffer (w/o MgCl₂) 5 25 mM MgCl₂ 4 10 mM dNTP mix 1 100 μM primer 1 0.25 100 μM primer 2 0.25 Taq polymerase 0.25 Phage in TE (section 4) 3 Final reaction volume 50

[0519]For PCR, a thermocycler (GeneAmp PCR System 9700, Applied Biosystems) was used to run the following program: 94° C. for 5 minutes; (94° C. for 30 sec, 55° C. for 30 sec, 72° C. for 45 sec.)×30 cycles; 72° C. for 7 minutes; cool to 4° C. The PCR product from each reaction was purified using the QIAquick Multiwell PCR Purification kit (Qiagen), following the manufacturer's protocol. Purified PCR product was then assayed by running about 10 μl of each PCR reaction mix with about 1 μl of dye (10×BBXS agarose gel loading dye) on a 1% agarose gel. The remaining product was then sequenced using the ABI 377 Sequencer (Perkin Elmer) following the manufacturer recommended protocol.

6. Sequence Ranking and Consensus Sequence Determination

A. Sequence Ranking and Analysis

[0520]The peptide sequences that were translated from variable nucleotide sequences (section 5B) were correlated to ELISA data. The clones that showed a high OD₄₅₀ in the Ang-2 coated wells and a low OD₄₅₀ in the streptavidin coated wells were given a higher priority ranking. The sequences that occurred multiple times were also given a high priority ranking. Candidate sequences were chosen based on these criteria for further analysis as peptides or peptibodies.

B. Consensus Sequence Determination

[0521]Three different classes of consensus motifs were generated from the TN8-IX library as follows:

TABLE-US-00024 K R P C E E X W G G C X Y X (SEQ ID NO: 56) K R P C E E X F G G C X Y X (SEQ ID NO: 57) X X X C X D X Y W Y C X X X (SEQ ID NO: 61) X X X C X D X Y T Y C X X X (SEQ ID NO: 62) X X X C X D X F W Y C X X X (SEQ ID NO: 63) X X X C X D X F T Y C X X X (SEQ ID NO: 64) X X X C X W D P W T C E X M (SEQ ID NO: 58)

[0522]One consensus motif was generated from the TN12-I library:

TABLE-US-00025 (SEQ ID NO: 59) W S X C A W F X G X X X X X C R R X

[0523]For all consensus motif sequences, the underlined "core amino acid sequences" from each consensus sequence were obtained by determining the most frequently occurring amino acid in each position. "X" refers to any naturally occurring amino acid. The two cysteines adjacent to the core sequences were fixed amino acids in the TN8-IX and TN12-I libraries.

[0524]The peptides identified as binding to Ang-2 are set forth in Table 3 below.

TABLE-US-00026 TABLE 3 Ang-2 Binding Peptides Peptide Seq Id No. Sequence TN8-8 1 KRPCEEMWGGCNYD TN8-14 2 HQICKWDPWTCKHW TN8-Con1 3 KRPCEEIFGGCTYQ TN8-Con4 4 QEECEWDPWTCEHM TN12-9 5 FDYCEGVEDPFTFGCDNH L1 6 KFNPLDELEETLYEQFTFQQ C17 7 QYGCDGFLYGCMIN

EXAMPLE 4

Construction of DNA Encoding Peptibodies

[0525]The modified peptides selected as potentially inhibitory to Ang-2:Tie-2 binding (see Table 3) were used to construct fusion proteins in which either a monomer of each peptide or a tandem dimer of each peptide (with a linker between the monomer units) was fused in-frame to DNA encoding a linker followed by the Fc region of human IgG1. Each modified peptide was constructed by annealing pairs of oligonucleotides ("oligos") to generate a polynucleotide duplex encoding the peptide together with a linker comprised, depending on the peptide, of either five glycine residues, eight glycine residues or one lysine residue; these constructs were generates as NdeI to XhoI fragments. These duplex polynucleotide molecules were ligated into the vector (pAMG21-Fc N-terminal, described further below) containing the human Fc gene, which had been previously digested with NdeI and XhoI. The resulting ligation mixtures were transformed by electroporation into E. coli strain 2596 cells (GM221, described further below) using standard procedures. Clones were screened for the ability to produce the recombinant protein product and to possess the gene fusion having a correct nucleotide sequence. A single such clone was selected for each of the modified peptides (i.e., Fc-peptide fusion products).

Construction of pAMG21-Fc N-Terminal VectorpAMG21

[0526]Expression plasmid pAMG21 (ATCC No. 98113) is derived from expression vector pCFM1656 (ATCC No. 69576) and the expression vector system described in U.S. Pat. No. 4,710,473, by following the procedure described in published International Patent Application WO 00/24782 (see the portion of Example 2 therein extending from pages 100-103, as well as FIGS. 17A and 17B).

Fc N-Terminal Vector

[0527]The Fc N-terminal vector was created using E. coli strain 3788, pAMG21 Tpo_Gly5_Fc monomer, as a template. Information on the cloning of this strain can be found in WO 00/24782 (See Example 2 and FIG. 10 therein). A 5' PCR primer (described further below) was designed to remove the Tpo peptide sequence in pAMG Tpo Gly5 and replace it with a polylinker containing ApaLI and XhoI sites. Using strain 3788 as a template, PCR was performed with Expand Long Polymerase, using the oligonucleotide of SEQ ID NO: 8, below, as the 5' primer and a universal 3' primer, SEQ ID NO: 9, below. The resulting PCR product was gel purified and digested with restriction enzymes NdeI and BsrGI. Both the plasmid and the polynucleotide encoding the peptide of interest together with its linker were gel purified using Qiagen (Chatsworth, Calif.) gel purification spin columns. The plasmid and insert were then ligated using standard ligation procedures, and the resulting ligation mixture was transformed into E. coli cells (strain 2596). Single clones were selected and DNA sequencing was performed. A correct clone was identified and this was used as a vector source for the modified peptides described herein.

TABLE-US-00027 5'Primer: (SEQ ID NO: 8) ACAAACAAACATATGGGTGCACAGAAAGCGGCCGCAAAAAAA CTCGAGGGTGGAGGCGGTGGGGACA 3' Primer: (SEQ ID NO: 9) GGTCATTACTGGACCGGATC

[0528]In addition to making these modified peptides as N-terminal fusions to Fc (N-terminal peptibodies), some of them were also made as C-terminal fusion products (C-terminal peptibodies). The vector used for making the C-terminal fusions is described below.

Construction of Fc C-Terminal Vector

[0529]The Fc C-terminal vector for modified peptides was created using E. coli strain 3728, pAMG21 Fc_Gly5_Tpo monomer, as a template. Information on the cloning of this strain can be found in WO 00/24782 (See Example 2 and FIG. 7 therein). A 3' PCR primer (SEQ ID NO: 10) was designed to remove the Tpo peptide sequence and to replace it with a polylinker containing ApaLI and XhoI sites. Using strain 3728 as a template, PCR was performed with Expand Long Polymerase using a universal 5' primer (SEQ ID NO: 11) and the aforementioned 3' primer. The resulting PCR product was gel purified and digested with restriction enzymes BsrGI and BamHI. Both the plasmid and the polynucleotide encoding each peptides of interest with its linker were gel purified via Qiagen gel purification spin columns. The plasmid and insert were then ligated using standard ligation procedures, and the resulting ligation mixture was transformed into E. coli (strain 2596) cells. Single clones were selected and DNA sequencing was performed. A correct clone was identified and used as a source of vector for modified peptides described herein.

TABLE-US-00028 5' Primer: (SEQ ID NO: 10) CGTACAGGTTTACGCAAGAAAATGG 3' Primer: (SEQ ID NO: 11) TTTGTTGGATCCATTACTCGAGTTTTTTTGCGGCCGCTTTCTGTG CACCACCACCTCCACCTTTAC

[0530]GM221 (#2596). Host strain #2596, used for expressing Fc-peptide fusion proteins, is an E. coli K-12 strain modified to contain the lux promoter, and both the temperature sensitive lambda repressor cI857s7 in the early ebg region and the lacIq repressor in the late ebg region. The presence of these two repressor genes allows the use of this host with a variety of expression systems The ATCC designation for this strain is 202174.

EXAMPLE 5

Production of Peptibodies

[0531]Expression in E. Coli. Cultures of each of the pAMG21-Fc fusion constructs in E. coli GM221 were grown at 37° C. in Terrific Broth medium (See Tartof and Hobbs, "Improved media for growing plasmid and cosmid clones", Bethesda Research Labs Focus, Volume 9, page 12, 1987, cited in aforementioned Sambrook et al. reference). Induction of gene product expression from the luxPR promoter was achieved following the addition of the synthetic autoinducer, N-(3-oxohexanoyl)-DL-homoserine lactone, to the culture medium to a final concentration of 20 nanograms per milliliter (ng/ml). Cultures were incubated at 37° C. for an additional six hours. The bacterial cultures were then examined by microscopy for the presence of inclusion bodies and collected by centrifugation. Refractile inclusion bodies were observed in induced cultures, indicating that the Fc-fusions were most likely produced in the insoluble fraction in E. coli. Cell pellets were lysed directly by resuspension in Laemmli sample buffer containing 10% β-mercaptoethanol and then analyzed by SDS-PAGE. In most cases, an intense coomassie-stained band of the appropriate molecular weight was observed on an SDS-PAGE gel.

[0532]Purification. Cells were broken in water (1/10) using high pressure homogenization (two passes at 14,000 PSI), and inclusion bodies were harvested by centrifugation (4000 RPM in a J-6B centrifuge, for one hour). Inclusion bodies were solubilized in 6 M guanidine, 50 mM Tris, 10 mM DTT, pH 8.5, for one hour at a 1/10 ratio. For linear peptides fused to Fc, the solubilized mixture was diluted twenty-five times into 2 M urea, 50 mM Tris, 160 mM arginine, 2 mM cysteine, pH 8.5. The oxidation was allowed to proceed for two days at 4° C., allowing formation of the disulfide-linked compound (i.e., Fc-peptide homodimer). For cyclic peptides fused to Fc, this same protocol was followed with the addition of the following three folding conditions: (1) 2 M urea, 50 mM Tris, 160 mM arginine, 4 mM cysteine, 1 mM cystamine, pH 8.5; (2) 4 M urea, 20% glycerol, 50 mM Tris, 160 mM arginine, 2 mM cysteine, pH 8.5; and (3) 4 M urea, 20% glycerol, 50 mM Tris, 160 mM arginine, 4 mM cysteine, 1 mM cystamine, pH 8.5. The refolded protein was dialyzed against 1.5 M urea, 50 mM NaCl, 50 mM Tris, pH 9.0. The pH of this mixture was lowered to pH 5 with acetic acid. The precipitate was removed by centrifugation, and the supernatant was adjusted to a pH of from 5 to 6.5, depending on the isoelectric point of each fusion product. The protein was filtered and loaded at 4° C. onto an SP-Sepharose HP column equilibrated in 20 mM NaAc, 50 mM NaCl at the pH determined for each construct. The protein was eluted using a 20-column volume linear gradient in the same buffer ranging from 50 mM NaCl to 500 mM NaCl. The peak was pooled and filtered.

[0533]The peptibodies generated using the procedures above are set forth in Table 4 below.

TABLE-US-00029 TABLE 4 Peptibody Peptibody Sequence L1 (N) MGAQKCFNPLDELEETLYEQFTFQQLEGGGGG-Fc (SEQ ID NO: 12) L1 (N) WT MKFNPLDELEETLYEQFTFQQLEGGGGG-Fc (SEQ ID NO: 13) L1 (N) 1K WT MKFNPLDELEETLYEQFTFQQGSGSATGGSGSTASSGS GSATHLEGGGGG-Fc (SEQ ID NO: 14) 2xL1 (N) MGAQKFNPLDELEETLYEQFTFQQGGGGGGGGKFNPL DELEETLYEQFTFQQLEGGGGG-Fc (SEQ ID NO: 15) 2xL1 (N) WT MKFNPLDELEETLYEQFTFQQGGGGGGGKFNPLDELEE TLYEQFTFQQLEGGGGG-Fc (SEQ ID NO: 16) Con4 (N) MGAQQEECEWDPWTCEHMLEGGGGG-Fc (SEQ ID NO: 17) Con4 (N) 1K-WT MQEECEWDPWTCEHMGSGSATGGSGSTASSGSGSATH LEGGGGG-Fc (SEQ ID NO: 18) 2xCon4 (N) 1K MGAQQEECEWDPWTCEHMGSGSATGGSGSTASSGSGS ATHQEECEWDPWTCEHMLEGGGGG-Fc (SEQ ID NO: 19) L1 (C) M-Fc-GGGGGAQKFNPLDELEETLYEQFTFQQLE (SEQ ID NO: 20) L1 (C) 1K M-Fc- GGGGGAQGSGSATGGSGSTASSGSGSATHKFNPLDELE ETLYEQFTFQQLE (SEQ ID NO: 21) 2xL1 (C) M-Fc- GGGGGAQKFNPLDELEETLYEQFTFQQGGGGGGGGKF NPLDELEETLYEQFTFQQLE (SEQ ID NO: 22) Con4 (C) M-Fc-GGGGGAQQEECEWDPWTCEHMLE (SEQ ID NO: 23) Con4 (C) 1K M-Fc- GGGGGAQGSGSATGGSGSTASSGSGSATHQEECEWDP WTCEHMLE (SEQ ID NO: 24) 2xCon4 (C) 1K M-Fc- GGGGGAQQEECEWDPWTCEHMGSGSATGGSGSTASS GSGSATHQEECEWDPWTCEHMLE (SEQ ID NO: 25) Con4-L1 (N) MGAQEECEWDPWTCEHMGGGGGGGGKFNPLDELEET LYEQFTFQQGSGSATGGSGSTASSGSGSATHLEGGGGG- Fc (SEQ ID NO: 26) Con4-L1 (C) M-Fc- GGGGGAQGSGSATGGSGSTASSGSGSATHKFNPLDELE ETLYEQFTFQQGGGGGQEECEWDPWTCEHMLE (SEQ ID NO: 27) TN-12-9 (N) MGAQ-FDYCEGVEDPFTFGCDNHLE-GGGGG-Fc (SEQ ID NO: 28) C17 (N) MGAQ-QYGCDGFLYGCMINLE-GGGGG-Fc (SEQ ID NO: 29) TN8-8 (N) MGAQ-KRPCEEMWGGCNYDLEGGGGG-Fc (SEQ ID NO: 30) TN8-14 (N) MGAQ-HQICKWDPWTCKHWLEGGGGG-Fc (SEQ ID NO: 31) Con1 (N) MGAQ-KRPCEEIFGGCTYQLEGGGGG-Fc (SEQ ID NO: 32)

[0534]In Table 4, "Fc" refers to the human Fc IgG1 sequence. Column two sets forth the amino acid sequence of the peptibody. The Fc portion thereof is labeled "Fc", and is as set forth in SEQ ID NO: 60 below. It will be appreciated that where a label is used, for example, "Con4" or "Con-4", this refers to the Con-4 peptide, whereas use of the suffix "C", "(C)", or "--C"; or "N", "(N)", or "--N" thereon indicates that the molecule is a peptibody as described herein. The suffixes "N", "(N)", or "--N" in a peptibody name indicate that the Ang-2-binding peptide (or peptides) is/are N-terminal to the Fc domain, and the suffixes "C", "(C)" or "--C" indicate that the Ang-2-binding peptide (or peptides) is/are C-terminal to the Fc domain. Furthermore, 2×Con4 (C) 1K, as defined in SEQ ID NO: 25, may also be referred to without the "1K" suffix herein.

[0535]The amino acid sequence of the Fc portion of each peptibody is as follows (from amino terminus to carboxyl terminus):

TABLE-US-00030 (SEQ ID NO: 60) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK

[0536]The DNA sequence (SEQ ID Nos: 33-53) encoding peptibodies corresponding to peptibody SEQ ID NOs: 12-32, respectively, in Table 4) is set forth below:

TABLE-US-00031 SEQ ID NO: 33 ATGGGTGCACAGAAATTCAACCCGCTGGACGAACTGGAAGAAACTCT GTACGAACAGTTCACTTTCCAGCAGCTCGAGGGTGGAGGCGGTGGGG ACAAAACTCACACATGTCCACCTTGCCCAGCACCTGAACTCCTGGGGG GACCGTCAGTTTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGAT CTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGA AGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGC ATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTAC CGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGC AAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATC GAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGT GTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAG CCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGA GTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTC CCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGT GGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGAT GCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTC TCCGGGTAAATAATGGATCC SEQ ID NO: 34 ATGAAATTCAACCCGCTGGACGAACTGGAAGAAACTCTGTACGAACA GTTCACTTTCCAGCAGCTCGAGGGTGGAGGCGGTGGGGACAAAACTCA CACATGTCCACCTTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGT TTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACC CCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGA GGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAA GACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCA GCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACA AGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCA TCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTG CCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGC CTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGC AATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGA CTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAG CAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGC TCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAA ATAA SEQ ID NO: 35 ATGAAATTCAACCCGCTGGACGAACTGGAAGAAACTCTGTACGAACA GTTCACTTTCCAGCAGGGATCCGGTTCTGCTACTGGTGGTTCCGGCTCC ACCGCAAGCTCTGGTTCAGGCAGTGCGACTCATCTCGAGGGTGGAGGC GGTGGGGACAAAACTCACACATGTCCACCTTGCCCAGCACCTGAACTC CTGGGGGGACCGTCAGTTTTCCTCTTCCCCCCAAAACCCAAGGACACC CTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTG AGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGT GGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACA GCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGC TGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCA GCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGA ACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAA CCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACAT CGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGA CCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAA GCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCAT GCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCC TCTCCCTGTCTCCGGGTAAATAA SEQ ID NO: 36 ATGGGTGCACAGAAATTCAACCCGCTGGACGAACTGGAAGAAACTCT GTACGAACAGTTCACTTTCCAGCAGGGTGGTGGTGGTGGTGGCGGTGG TAAGTTCAACCCACTGGATGAGCTGGAAGAGACTCTGTATGAACAGTT CACTTTCCAGCAACTCGAGGGTGGAGGCGGTGGGGACAAAACTCACA CATGTCCACCTTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTTT TCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCC CTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAG GTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAG ACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAG CGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAA GTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCAT CTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGC CCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCC TGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCA ATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGAC TCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGC AGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCT CTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA TAA SEQ ID NO: 37 ATGAAATTCAACCCGCTGGACGAACTGGAAGAAACTCTGTACGAACA GTTCACTTTCCAGCAGGGTGGTGGTGGTGGCGGTGGTAAGTTCAACCC ACTGGATGAGCTGGAAGAGACTCTGTATGAACAGTTCACTTTCCAGCA ACTCGAGGGTGGAGGCGGTGGGGACAAAACTCACACATGTCCACCTT GCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTTTTCCTCTTCCCCCC AAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATG CGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTG GTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGG AGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCC TGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCC AACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAA AGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGG ATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCT TCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCG GAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCC TTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAG GGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCAC TACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATAA SEQ ID NO: 38 ATGGGTGCACAGCAGGAAGAATGCGAATGGGACCCATGGACTTGCGA ACACATGCTCGAGGGTGGAGGCGGTGGGGACAAAACTCACACATGTC CACCTTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTTTTCCTCTT CCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGT CACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTT CAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGC CGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTC ACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAA GGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAA AGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCAT CCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCA AAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGG CAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGAC GGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGG CAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCAC AACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATAA SEQ ID NO: 39 ATGCAGGAAGAATGCGAATGGGACCCATGGACTTGCGAACACATGGG ATCCGGTTCTGCTACTGGTGGTTCCGGCTCCACCGCAAGCTCTGGTTCA GGCAGTGCGACTCATCTCGAGGGTGGAGGCGGTGGGGACAAAACTCA CACATGTCCACCTTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGT TTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACC CCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGA GGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAA GACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCA GCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACA AGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCA TCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTG CCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGC CTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGC AATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGA CTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAG CAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGC TCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAA

ATAA SEQ ID NO: 40 ATGGGTGCACAGCAGGAAGAATGCGAATGGGACCCATGGACTTGCGA ACACATGGGATCCGGTTCTGCTACTGGTGGTTCCGGCTCCACCGCAAG CTCTGGTTCAGGCAGTGCGACTCATCAGGAAGAATGCGAATGGGACCC ATGGACTTGCGAACACATGCTCGAGGGTGGAGGCGGTGGGGACAAAA CTCACACATGTCCACCTTGCCCAGCACCTGAACTCCTGGGGGGACCGT CAGTTTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCG GACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACC CTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATG CCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTG GTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAG TACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAA ACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACAC CCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGAC CTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGA GAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGC TGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACA AGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATG AGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGG GTAAATAA SEQ ID NO: 41 ATGGACAAAACTCACACATGTCCACCTTGCCCAGCACCTGAACTCCTG GGGGGACCGTCAGTTTTCCTCTTCCCCCCAAAACCCAAGGACACCCTC ATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGC CACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGA GGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCA CGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGA ATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCC CCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACC ACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCA GGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGC CGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCA CGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCT CACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTC CGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTC CCTGTCTCCGGGTAAAGGTGGAGGTGGTGGTGCACAGAAATTCAACCC GCTGGACGAGCTGGAAGAGACTCTGTACGAACAGTTTACTTTTCAACA GCTCGAGTAA SEQ ID NO: 42 ATGGACAAAACTCACACATGTCCACCTTGCCCAGCACCTGAACTCCTG GGGGGACCGTCAGTTTTCCTCTTCCCCCCAAAACCCAAGGACACCCTC ATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGC CACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGA GGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCA CGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGA ATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCC CCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACC ACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCA GGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGC CGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCA CGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCT CACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTC CGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTC CCTGTCTCCGGGTAAAGGTGGAGGTGGTGGTGCACAGGGATCCGGTTC TGCTACTGGTGGTTCCGGCTCCACCGCAAGCTCTGGTTCAGGCAGTGC GACTCATAAATTCAACCCGCTGGACGAACTGGAAGAAACTCTGTACGA ACAGTTCACTTTCCAGCAACTCGAGTAA SEQ ID NO: 43 ATGGACAAAACTCACACATGTCCACCTTGCCCAGCACCTGAACTCCTG GGGGGACCGTCAGTTTTCCTCTTCCCCCCAAAACCCAAGGACACCCTC ATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGC CACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGA GGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCA CGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGA ATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCC CCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACC ACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCA GGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGC CGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCA CGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCT CACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTC CGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTC CCTGTCTCCGGGTAAAGGTGGAGGTGGTGGTGCACAGAAATTCAACCC GCTGGACGAACTGGAAGAAACTCTGTACGAACAGTTCACTTTCCAGCA GGGTGGTGGTGGTGGTGGCGGTGGTAAGTTCAACCCACTGGATGAGCT GGAAGAGACTCTGTATGAACAGTTCACTTTCCAGCAACTCGAGTAA SEQ ID NO: 44 ATGGACAAAACTCACACATGTCCACCTTGCCCAGCACCTGAACTCCTG GGGGGACCGTCAGTTTTCCTCTTCCCCCCAAAACCCAAGGACACCCTC ATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGC CACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGA GGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCA CGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGA ATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCC CCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACC ACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCA GGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGC CGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCA CGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCT CACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTC CGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTC CCTGTCTCCGGGTAAAGGTGGAGGTGGTGGTGCACAGCAGGAAGAAT GCGAATGGGACCCATGGACTTGCGAACACATGCTCGAGTAA SEQ ID NO: 45 ATGGACAAAACTCACACATGTCCACCTTGCCCAGCACCTGAACTCCTG GGGGGACCGTCAGTTTTCCTCTTCCCCCCAAAACCCAAGGACACCCTC ATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGC CACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGA GGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCA CGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGA ATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCC CCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACC ACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCA GGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGC CGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCA CGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCT CACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTC CGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTC CCTGTCTCCGGGTAAAGGTGGAGGTGGTGGTGCACAGGGATCCGGTTC TGCTACTGGTGGTTCCGGCTCCACCGCAAGCTCTGGTTCAGGCAGTGC GACTCATCAGGAAGAATGCGAATGGGACCCATGGACTTGCGAACACA TGCTCGAGTAA SEQ ID NO: 46 ATGGACAAAACTCACACATGTCCACCTTGCCCAGCACCTGAACTCCTG GGGGGACCGTCAGTTTTCCTCTTCCCCCCAAAACCCAAGGACACCCTC ATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGC CACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGA GGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCA CGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGA ATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCC CCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACC ACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCA GGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGC CGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCA CGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCT CACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTC CGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTC CCTGTCTCCGGGTAAAGGTGGAGGTGGTGGTGCACAGCAGGAAGAAT

GCGAATGGGACCCATGGACTTGCGAACACATGGGATCCGGTTCTGCTA CTGGTGGTTCCGGCTCCACCGCAAGCTCTGGTTCAGGCAGCGCGACTC ATCAGGAAGAATGCGAATGGGACCCATGGACTTGCGAACACATGCTC GAGTAA SEQ ID NO: 47 ATGGGTGCACAGGAAGAATGCGAATGGGACCCATGGACTTGCGAACA CATGGGTGGTGGTGGTGGTGGCGGTGGTAAATTCAACCCGCTGGACGA ACTGGAAGAAACTCTGTACGAACAGTTCACTTTCCAGCAGGGATCCGG TTCTGCTACTGGTGGTTCCGGCTCCACCGCAAGCTCTGGTTCAGGCAGT GCGACTCATCTCGAGGGTGGAGGCGGTGGgGACAAAACTCACACATGT CCACCTTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTTTTCCTCT TCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGG TCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGT TCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAG CCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTC ACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAA GGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAA AGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCAT CCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCA AAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGG CAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGAC GGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGG CAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCAC AACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATAA SEQ ID NO: 48 ATGGACAAAACTCACACATGTCCACCTTGCCCAGCACCTGAACTCCTG GGGGGACCGTCAGTTTTCCTCTTCCCCCCAAAACCCAAGGACACCCTC ATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGC CACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGA GGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCA CGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGA ATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCC CCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACC ACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCA GGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGC CGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCA CGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCT CACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTC CGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTC CCTGTCTCCGGGTAAAGGTGGAGGTGGTGGTGCACAGGGATCCGGTTC TGCTACTGGTGGTTCCGGCTCCACCGCAAGCTCTGGTTCAGGCAGTGC GACTCATAAATTCAACCCGCTGGACGAACTGGAAGAAACTCTGTACGA ACAGTTCACTTTCCAGCAGGGTGGTGGCGGTGGTCAGGAAGAATGCGA ATGGGACCCATGGACTTGCGAACACATGCTCGAGTAA SEQ ID NO: 49 ATGGGTGCACAGTTCGACTACTGCGAAGGTGTTGAAGACCCGTTCACT TTCGGTTGCGACAACCACCTCGAGGGTGGAGGCGGTGGGGACAAAAC TCACACATGTCCACCTTGCCCAGCACCTGAACTCCTGGGGGGACCGTC AGTTTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGG ACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCT GAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCC AAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGT CAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTA CAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAAC CATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCC TGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCT GCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGA GCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTG GACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAG AGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAG GCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGT AAATAA SEQ ID NO: 50 ATGGGTGCACAGCAGTACGGTTGCGACGGTTTTCTGTACGGTTGCATG ATCAACCTCGAGGGTGGAGGCGGTGGGGACAAAACTCACACATGTCC ACCTTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTTTTCCTCTTC CCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTC ACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTC AACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCC GCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCA CCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAG GTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAA GCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCC CGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAA AGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGC AGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGAC GGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGG CAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCAC AACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATAA SEQ ID NO: 51 ATGGGTGCACAGAAACGCCCATGCGAAGAAATGTGGGGTGGTTGCAA CTACGACCTCGAGGGTGGAGGCGGTGGGGACAAAACTCACACATGTC CACCTTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTTTTCCTCTT CCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGT CACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTT CAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGC CGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTC ACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAA GGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAA AGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCAT CCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCA AAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGG CAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGAC GGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGG CAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCAC AACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATAA SEQ ID NO: 52 ATGGGTGCACAGCACCAGATCTGCAAATGGGACCCGTGGACCTGCAA ACACTGGCTCGAGGGTGGAGGCGGTGGGGACAAAACTCACACATGTC CACCTTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTTTTCCTCTT CCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGT CACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTT CAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGC CGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTC ACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAA GGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAA AGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCAT CCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCA AAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGG CAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGAC GGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGG CAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCAC AACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATAA SEQ ID NO: 53 ATGGGTGCACAGAAACGTCCATGCGAAGAAATCTTCGGTGGTTGCACC TACCAGCTCGAGGGTGGAGGCGGTGGGGACAAAACTCACACATGTCC ACCTTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTTTTCCTCTTC CCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTC ACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTC AACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCC GCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCA CCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAG GTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAA GCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCC CGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAA AGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGC AGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGAC GGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGG CAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCAC

AACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATAA

EXAMPLE 6

Peptibody Assays

[0537]Fourteen of the peptibodies were tested using the neutralization ELISA, and three of the peptibodies were tested using the affinity ELISA. The results are set forth in Table 5.

TABLE-US-00032 TABLE 5 hAng-2 mAng-2 hAng-1 IC 50 EC 50 EC 50 IC 50 EC 50 Peptibody (nM) (nM) IC 50 (nM) (nM) (nM) (nM) 2xCon4 (C) 1K 0.04 0.02 Con4-L1 (C) 0.05 0.04 Con4 (C) 0.20 0.30 2xL1 (N) 0.65 0.80 Con4 (N) 0.85 0.03 0.72 0.07 No Inhibition No Binding 2xL1 (C) 0.90 1.0 Con4 (N) 1K- 1.9 WT L1 (N) 6 11 No Inhibition C17 (N) 9 13 No Inhibition 12-9 (N) 21 7.7 No Inhibition Con1 (N) 26 ~200 No Inhibition 8-14 (N) 45 33 No Inhibition L1 (C) 65 37 8-8 (N) 80 ~700 No Inhibition Negative No No No Inhibition No No Inhibition No Binding Control Inhibition Binding Binding Peptibody 4883

[0538]The amino acid sequence of negative control peptibody 4883 is as follows (the Fc portion is underlined, the linker is "GGGGG", and the peptide portion is in bold):

TABLE-US-00033 (SEQ ID NO: 243) MDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK-GGGGG-CTAGYHWNSDCECCRRN

[0539]It will be appreciated that use of the term "No Inhibition" herein is not meant to indicate that the compounds have no inhibitory qualities. Rather, "No Inhibition" as used herein refers to those compounds which when tested using the neutralization ELISA assay under the conditions described herein exhibited an IC₅₀ value of greater than 1000 nM, which was the highest concentration at which these compounds were screened. While significant inhibitory qualities were not observed for the molecules labeled as exhibiting "no inhibition", it will be appreciated that those molecules may in fact demonstrate inhibitory qualities under different assay conditions, or in different assays. In a preferred embodiment, it will be appreciated that the invention relates to peptibodies that have inhibitory qualities using the assays described herein.

[0540]Two of the peptibodies were tested using the affinity BIAcore assay (as described in Example 2). The results are set forth in Table 6 below.

TABLE-US-00034 TABLE 6 Peptibody (Pb) Affinities for hAng-2 and mAng-2 hAng-2 mAng-2 Peptibody K_D (nM) k_a (1/Ms) k_d (1/s) K_D (nM) k_a (1/Ms) k_d (1/s) Pb L1 (N) 3.1 2.9 × 10⁵ 9.1 × 10^-4 0.42 5.6 × 10⁵ 2.3 × 10^-4 Con4 (N) 0.67 3.3 × 10⁵ 2.2 × 10^-4 0.60 7.3 × 10⁵ 4.4 × 10^-4 TN12-9 (N) 8.2 1.2 × 10⁵ 1.0 × 10^-3 0.32 7.2 × 10⁵ 2.3 × 10^-4

EXAMPLE 7

Therapeutic Efficacy Studies with Systemically Administered Ang-2 Peptibody

[0541]Ang-2 peptibody, TN8-Con4-C, was administered subcutaneously to A431 tumor-bearing mice at a once-per-day schedule 72 hours after tumor challenge. The doses of peptibody used were 1000, 200, 40 and 8 ug/mouse/day. A total of 20 doses was given to all animals. Tumor volumes and body weights were recorded three times/week. At the end of the study, animals were sacrificed, and their sera were collected for measuring peptibody levels by ELISA. Tumors and a panel of normal tissues were collected from all groups.

[0542]The results are shown in FIG. 1. As can be seen, significant differences in tumor growth were observed between the Ang-2 peptibody treated group and vehicle control. All four doses of Ang-2 peptibody inhibited tumor growth as compared to vehicle controls (p<0.0001 vs. vehicle control using repeated measure ANOVA). In contrast, tumors in the control group continued to grow at a much greater rate. Treatment with this peptibody had no significant effect on terminal body weights, organ weights or hematology parameters of the animals treated at the above doses.

EXAMPLE 8

1. Construction of Ang-2 Secondary Peptide Libraries

[0543]A. Electrocompetent E. coli Cells

[0544]Epicurian Coli® XL1-Blue MRF' electroporation competent cells (Stratagene #200158) were purchased from Stratagene (Stratagene Cloning Systems, La Jolla, Calif.).

B. Modification of pCES1 Vector

[0545]PCR was performed using Extend Long Template PCR Systems (Roche Diagnostics Corp., Indianapolis, Ind.) with 1 μg of pCES1 vector (TargetQuest Inc.) as a template. PCR mixture volume was 100 μl which contained 1×PCR buffer, 200 nM of each of the two primers: 5'-CAAACGAATGGATCCTCATTAAAGCCAGA-3' (SEQ ID NO: 244) and 5'-GGTGGTGCGGCCGCACTCGAGACTGTTGAAAGTTGTTTAGCA-3' (SEQ ID NO: 245), 200 nM dNTP, and 3 units (U) of Tag DNA polymerase. The TRIO-Thermoblock (Biometra) PCR system was run as follows: 94° C. for 5 minutes; 30 cycles of 94° C. for 30 seconds, 50° C. for 30 seconds, 72° C. for 45 seconds; and 72° C. for 10 minutes; cool to 4° C.

[0546]The PCR products were then run on a 1% agarose gel and purified with QIAGEN Spin Column (QIAGEN Inc., Valencia, Calif.) according to the manufacturer's protocols. A second PCR reaction was performed with 5 μl of PCR products and 200 nM of each of the two primer 5'-CAAACGAATGGATCCTCATTAAAGCCAGA-3' (SEQ ID NO: 246) and 5'-AACACAAAAGTGCACAGGGTGGAGGTGGTGGTGCGGCCGCACT-3' (SEQ ID NO: 247) under the same PCR conditions as described above.

[0547]The PCR products and original pCES1 vector were then digested separately in a 100 μl reaction containing 1×NEB2 buffer, 60 U of ApaLI (New England Biolabs, Beverly, Mass.), 60 U of BamHI (New England Biolabs) at 37° C. for 1 hour. The digested DNA was then purified using a QIAGEN Spin Column and ligated together in a 40 μl reaction containing 1× ligation buffer and 40 U of T4 DNA ligase (New England Biolabs) at room temperature overnight.

[0548]The vectors were transfected into E. coli and incubated at 37° C. overnight. Isolated single colonies were selected and plasmid was then purified using a QIAGEN Spin Column. The correct insert was confirmed by DNA sequencing.

C. Preparation of Vector DNA

[0549]One microgram of modified pCES1 vector DNA (from section 1B above) was transformed into 40 μl of electrocompetent XL1-blue E. coli (from section 1A above) using the Gene Pulser II (BIO-RAD, Hercules, Calif.) set at 2500V, 25 PF, and 200 ohms. The transformed bacteria sample was then transferred immediately into a tube containing 960 μl of SOC (2% tryptone, 0.5% yeast extract, 10 mM NaCl, 2.5 mM KCl, 20 mM glucose, 10 mM MgSO₄, 10 mM MgCl₂), and the culture was allowed to grow at 37° C. with shaking for 1 hour.

[0550]The cells were then spread onto the 2xYTAGT (2xYT with 100 ug/ml ampicillin, 12.5 ug/ml tetracycline and 2% glucose) agar plate and incubated at 37° C. overnight. A single colony was confirmed by sequencing and used to inoculate 2 liters of 2xYTAGT media at 37° C. with shaking overnight. The plasmid vector DNA was purified with QIAGEN Plasmid Maxi Kit according to the manufacturer's protocols.

D. Digestion of Vector DNA

[0551]Total about 2000 micrograms of vector DNA (from section 1C above) was digested in 5000 μl reaction containing 1×NEB buffer2, 300 U of ApaLI, and 300 U of XhoI at 37° C. overnight. The restriction digest reaction was incubated overnight at 37° C. and analyzed in a pre-made 0.8% agarose gel (Embi Tec, San Diego, Calif.). The linearized vector DNA was then excised from the gel and extracted with QIAquick Gel Extraction Kit (QIAGEN Inc.) according to the manufacturer's directions.

E. Preparation of Library Oligonucleotides

[0552]Six library oligonucleotides (1 fixed and 5 doped) were designed based on the sequences that derived from the results described above. The one fixed library oligonucleotides was:

TABLE-US-00035 (SEQ ID NO: 248) 5'-CACAGTGCACAGGGTNNKNNKNNKNNKNNKNNKNNKS ARTGGGATCCGTGGASCNNKNNKNNKNNKNNKNNKNNKCATT CTCTCGAGATCA-3' (library number 20);

and two of the 70% doped library oligonucleotides were as follows:

TABLE-US-00036 (SEQ ID NO: 249) 5'-CACAGTGCACAGGGTNNKNNKNNKaaKcgKccKNNKga KgaKatKttKggKggKNNKacKtaKcaKNNKNNKNNKCATTCTC TCGAGATCA-3' (library number 27);; (SEQ ID NO: 250) 5'-CACAGTGCACAGGGTNNKaaKttKaaKccKctKgaKgaKctKgaKga KacKctKtaKgaKcaKttKacKttKcaKcaKNNKCATTCTCTCGAGATC A-3' (library number 99);;

[0553]Lower case letters represent a mixture of 70% of the indicated base and 10% of each of the other three nucleotides). The other three of the 91% doped library oligonucleotides were as follows:

TABLE-US-00037 (SEQ ID NO: 251) 5'-CACAGTGCACAGGGTNNKNNKNNKcaKgaKgaKTGCgaKtg KgaKccKtgKacKTGCgaKcaKatKNNKNNKNNKCATTCTCTCGAGA TC A-3' (library number 94);; (SEQ ID NO: 252) 5'-CACAGTGCACAGGGTNNKttKgaKtaKNNKgaKggKgtKgaKgaKcc KttKacKttKggKNNKgaKaaKcaKNNKCATTCTCTCGAGATCA-3' (library number 25);; and (SEQ ID NO: 253) 5'-CACAGTGCACAGGGTNNKaaKttKaaKccKctKgaKgaKctKgaKga KacKctKtaKgaKcaKttKacKttKcaKcaKNNKCATTCTCTCGAGATC A-3' (library number 26);;

[0554]For the oligos above, those skilled in the art will appreciate that "N" indicates that each of the four nucleotides (A, T, C, and G) are equally represented during oligo synthesis, and "K" indicates that nucleotides G and T were equally represented during oligo synthesis. Lower case letters represent a mixture of 91% of the indicated base and 3% of each of the other three nucleotides. Each of these oligonucleotides was used as templates in PCR.

[0555]Expand High Fidelity PCR System kit (Roche Diagnostics Corp.) was used for the PCR reactions. Each library oligo was amplified in a ninety six well 50 μl PCR reaction which contained 1 nM of a library oligonucleotide, 1×PCR buffer, 300 nM of each of the primers:

TABLE-US-00038 5'-CACAGTGCACAGGGT-3'; (SEQ ID NO: 254) and 5'-TGATCTCGAGAGAATG-3',; (SEQ ID NO: 255)

[0556]200 μM dNTP, 1.5 mM MgCl₂, and 350 U of the Expand polymerase. The thermocycler (GeneAmp PCR System 9700, Applied Biosystems) was used to run the following program: 94° C. for 5 minutes; 25 cycles of (94° C. for 30 seconds, 52.5° C. for 60 seconds, 72° C. for 30 seconds); 72° C. for 10 minutes; cool to 4° C. The free nucleotides were then removed using the QIAquick PCR Purification Kit (QIAGEN Inc. Cat#28104) according to the manufacturer's protocols.

F. Digestion of Library Oligonucleotides

[0557]For each library the PCR products (section 1E) were digested in a 1200 μl reaction that contained 1×NEB buffer2, 750 U of ApaLI, and 750 U of XhoI at 37° C. overnight. The digested DNA was separated on a pre-made 3% agarose gel (Embi Tec). The DNA band of interest from each reaction was cut from the gel and extracted with COSTAR Spin-X centrifuge tube filter, 0.22 μm cellulose acetate (Corning Inc., Cat# 8160).

G. Ligation of Vector with Library Oligonucleotides

[0558]The 450 μl ligation reaction contained the linearized vector (section 1D) and each digested library PCR product (section 1F) at 1:5 molar ratio, 1×NEB ligation buffer, and 20,000 U of the T4 DNA ligase at 16° C. overnight. The ligated products were incubated at 65° C. for 20 minutes to inactivate the T4 DNA ligase and further incubated with 100 U NotI at 37° C. for 2 hours to minimize vector self-ligation. The ligated products were then purified by a standard phenol/chloroform extraction (Molecular Cloning: A Laboratory Manual, Maniatis et al., 3^rd Edition, Cold Spring Harbor Laboratory Press, 2000) and resuspended in 120 μl of H₂O.

H. Electroporation Transformation

[0559]For each library, twelve electroporation reactions were performed. For each transformation, 10 μl of the ligated vector DNA (section 1G) and 300 μl of XL1-BLUE MRF' cells (section 1A) were mixed in a 0.2-cm cuvette (BIO-RAD). The resulting mixture was pulsed by the Gene Pulser II setting at 2500 V, 25 uF, and 200 ohms. The transformed bacteria from the twelve electroporation reactions were then combined and transferred into a flask containing 26 ml of SOC for incubation at 37° C. for 1 hour. The cells were added to 450 ml 2xYTAG and grown at 37° C. with shaking for 5 hours. The cells were centrifuged at 4000 rpm for 15 minutes at 4° C. The cell pellets were then resuspended in 12 ml of 15% glycerol/2xYT and stored at -80° C. This was the primary stock of the libraries. Titers showed library sizes of 5.0×10⁹ (library number 20), 3.3×10¹⁰ (library number 94), 4.7×10⁹ (library number 25), 5.0×10⁹ (library number 26), 3.0×10⁹ (library number 27), and 4.2×10⁹ (library number 99) independent transformants.

2. Amplification of the Libraries

A. Making Secondary Stock of the Libraries

[0560]From the primary library cell stock (from section 1H above), sufficient cells to cover a 10× excess of each library size were used to inoculate 2xYTAGT (2YT with 100 ug/ml ampicillin, 12.5 ug/ml tetracycline and 2% glucose) media so that the starting OD₆₀₀ was 0.1. The cultures were allowed to grow at 37° C. with shaking for several hours until the OD₆₀₀=0.5. A one-tenth aliquot from each library was taken out and grown up in separate flasks for another two hours at 37° C. These sub-cultures were then centrifuged at 4000 rpm using a Beckman JA-14 rotor for 10 minutes at 4° C., and the bacteria pellets resuspended in 7.0 ml (for each library) of 15% glycerol/2xYT for storage at -80° C.

B. Phage Induction

[0561]M13KO7 helper phage aliquots (Amersham Pharmacia Biotech) were added to the remaining bacteria cultures at OD₆₀₀=0.5 (from Section 2A above) to the final concentration of 3×10⁹ pfu/ml. The helper phage were allowed to infect bacteria at 37° C. for 30 minutes without shaking and 30 minutes with slow shaking. The infected cells were centrifuged with 5000 rpm for 15 minutes at 4° C. The cell pellets were resuspended in the same volume (from section 2A above) with the 2xYTAK media (2YT with 100 ug/ml ampicillin and 40 ug/ml kanamycin). The phagemid production was allowed to occur at 30° C. overnight while shaking.

C. Harvest of Phage

[0562]The bacteria cultures from section 2B above were centrifuged at 5000 rpm for 15 minutes at 4° C. The supernatants were then transferred into new bottles, and 0.2 volume of 20% PEG/2.5M NaCl were added and incubated on ice for 1 hour to precipitate the phagemids. Precipitated phagemids were centrifuged at 10,000 rpm for 30 minutes at 4° C. and carefully resuspended with 100 ml of cold PBS. The phagemid solution was further purified by centrifuging away the remaining cells with 4000 rpm for 10 minutes at 4° C. and precipitating the phagemids by adding 0.2 volume of 20% PEG/2.5M NaCl. The phagemids were centrifuged at 10,000 rpm for 30 minutes at 4° C., and the phagemid pellets resuspended with 18 ml of cold PBS. Six ml of 60% glycerol solution was added to the phagemid solution for storage at -80° C. The phagemid titers were determined by a standard procedure (Molecular Cloning, Maniatis et al 3^rd Edition).

3. Selection of Ang-2 Binding Phage

A. Immobilization of Ang-2 on Magnetic Beads

[0563]The biotinylated Ang-2 (from section 3A above) was immobilized on the Dynabead M-280 Streptavidin (DYNAL, Lake Success, N.Y.) at a concentration of 2000 ng Ang-2 protein per 100 μl of the bead stock from the manufacturer. After drawing the beads to one side of a tube using a magnet and pipetting away the liquid, the beads were washed twice with phosphate buffer saline (PBS) and resuspended in PBS. The biotinylated Ang-2 protein was added to the washed beads at the above concentration and incubated with rotation for 1 hour at room temperature. The Ang-2 coated beads were then blocked by adding BSA to 2% final concentration and incubating overnight at 4° C. with rotation. The resulting Ang-2 coated beads were then washed twice with PBST (PBS with 0.05% Tween-20) before being subjected to the selection procedures.

B. Selection Using the Ang-2 Coated Beads

[0564]About 1000-fold library equivalent phagemids (from section 2C above) were blocked for one hour with 1 ml of PBS containing 2% BSA. The blocked phagemid sample was subjected to three negative selection steps by adding it to blank beads (same beads as section 3A but with no Ang-2 protein coating), and this mixture was incubated at room temperature for 15 minutes with rotation. The phagemid containing supernatant was drawn out using magnet and transferred to a second tube containing blank beads (the same beads as described in section 3A above but without Ang-2 protein coated thereon), and this mixture incubated at room temperature for 15 minutes with rotation.

[0565]The procedure was repeated. The phagemid containing supernatant was then drawn out using magnet and transferred to a new tube containing Ang-2 protein coated beads (from section 3A), and the mixture was incubated at room temperature for 1 hour with rotation. After the supernatant was discarded, the phagemid-bound-beads were washed 10 times with 2% milk-PBS; 10 times with 2% BSA-PBS; 10 times with PBST and twice with PBS. The phagemids were then allowed to elute in 1 ml of 100 mM triethylamine solution (Sigma, St. Louis, Mo.) for 10 minutes on a rotator. The pH of the phagemid containing solution was neutralized by adding 0.5 ml of 1 M Tris-HCl (pH 7.5). The resulting phagemids were used to infect 10 ml of freshly grown XL1-Blue MRF' bacteria (OD₆₀₀ about 0.5) at 37° C. for 30 minutes without shaking and 30 minutes with slow shaking. All of the infected XL1-BLUE MRF' cells were then plated on a 15×15 cm 2xYTAG plate and incubated at 30° C. overnight.

C. Induction and Harvesting of Phage

[0566]A 10 ml aliquot of 2xYTAGT media was added to the plate (from section 3B) to resuspend XL1-BLUE MRF' cells. All XL1-BLUE MRF' cells were collected in a tube, and a 250 μl aliquot of these cells was added to 25 ml of 2xYTAGT and grown at 37° C. until OD₆₀₀=0.5. The M13KO7 helper phage were added to a final concentration of 3×10⁹ cfu/ml and incubated at 37° C. for 30 minutes without shaking and 30 minutes with slow shaking. The cells were centrifuged with 5000 rpm for 10 minute at 4° C. and resuspended with 25 ml of 2xYTAK. These bacteria were allowed to grow at 30° C. overnight with shaking. The induced phagemids were harvest and purified as in section 2C.

D. Second Round Selection

[0567]The second round selection was performed as outlined in section 3B to 3C except for the following. About 100-fold library equivalent phagemids resulting from section 3C was used as the input phagemid. The amount of biotinylated Ang-2 protein (section 3A) coat onto the Dynabead M-280 Streptavidin was 4 decreased to 20 ng. The phage-bound-beads were then washed 10 times with 2% milk-PBS; 10 times with 2% BSA-PBS; 10 times with PBST, where the final wash involved 60 minutes incubation at room temperature in PBST. The beads were washed twice with PBS. The elution conditions were same as the first round (section 3B).

E. Third Round Selection

[0568]The third round selection was performed as outlined in section 3B to 3C above except the following. About 10 fold library equivalent phagemids resulting from section 3D was used as the input phagemid. About 2 ng of biotinylated Ang-2 protein (from section 3A) was used to coat onto the Dynabead M-280 Streptavidin. The phage-bound-beads were washed 10 times with 2% milk-PBS; 10 times with 2% BSA-PBS; 10 times with PBST, where the final wash involved 60 minutes incubation at room temperature in PBST. The beads were washed twice with PBS. The elution conditions were same as the first round (section 3B).

F. Fourth Round Selection

[0569]The fourth round selection was performed as outlined in section 3B to 3C above except for the following. Library equivalent phagemids resulting from section 3E were used as the input phagemid. The amount of biotinylated Ang-2 protein (section 3A) coat onto the Dynabead M-280 Streptavidin was decreased to 0.4 ng for libraries 25, 26, and 27. For libraries 20 and 94, the coating amount was kept as the third round at 2 ng. The library 99 was not carried to the fourth round selection step. The elution conditions were same as the first round (section 3B).

4. Clonal Analysis

A. Preparation of Master Plate

[0570]Single colonies from the second round selection were picked and inoculated into 96 well plates containing 120 μl of 2xYTAGT per well. The 96 well plates were incubated in 30° C. shaker for overnight. Forty microliters of 60% glycerol were added per well for storage at -80° C.

B. Phagemid ELISA

[0571]About 2 μl aliquots of cells from the master plate (from section 4A above) were inoculated into a fresh Costar® 96 well plate (Corning incorporated, Corning, N.Y., cat. #9794) which contained 100 μl of 2xYTAGT per well, and this new plate of cells was grown at 37° C. until approximate OD₆₀₀=0.5.

[0572]Forty μl of 2xYTAGT containing M13KO7 helper phage (1.5×10¹³ cfu/ml) was added to each well, and the 96 well plate was incubated at 37° C. for 30 minutes without shaking and another 30 minutes with slow shaking. The plate was centrifuged at 2000 rpm (Beckman CS-6R tabletop centrifuge) for 10 minutes at 4° C. The supernatants were removed from the wells, and each cell pellet was resuspended using 150 μl of 2xYTAK per well. The plate was incubated at 30° C. overnight for phagemid expression.

[0573]Human Ang-2 protein was coated onto the 96 well Maxisorp plate (NUNC) at 1 μg/ml in 1×PBS at 4° C. overnight. As a control, 2% BSA (Sigma) was coated onto a separate Maxisorp plate. On the following day, the overnight cell cultures were centrifuged at 2000 rpm for 10 minutes at 4° C. Ten μl of supernatant from each well was transferred to a new 96 well plate which containing BSA/PBS solution to dilute the supernatant at 1:10. The resulting mixtures were incubated for 1 hour at room temperature with shaking to block the phagemids. Meanwhile, the Ang-2 protein coated plate was blocked with 400 μl of 2% BSA/PBS solution per well for 1 hour at room temperature while shaking. The BSA solution was discarded, and each well was washed three times with PBS solution. After the last washing step, 100 μl of blocked phagemid solutions was added to each well of the Ang-2 protein coated plate as well as the control plate and incubated for 1 hour at room temperature with shaking. The liquid was discarded, and each well was washed three times with PBST solution. One hundred μl of the HRP-conjugated anti-M13 mAb (Amersham Pharmacia Biotech) at 15,000 dilution was added to each well of the Ang-2 protein coated and control plates, and these plates were incubated for 1 hour at room temperature with shaking. The liquid was discarded again, and each well was washed three times with PBST solution. One hundred μl of LumiGLO chemiluminescent substrates (Kirkegaard & Perry Laboratories, Gaithersburg, Md.) was added to the wells, and each well was read by Luminoskan Ascent DLRearly machine (Labsystems, Franklin, Mass.).

C. Sequencing of the Phage Clones

[0574]PCR reaction was performed using 1 μl of bacteria from each well of the master plate (section 4A) as a template. The volume of each PCR mixture was 50 μl which contains 1×PCR buffer, 300 nM of each of the two primers:

TABLE-US-00039 5'-GTTAGCTCACTCATTAGGCAC-3' (SEQ ID NO: 256) and 5'-GTACCGTAACACTGAGTTTCG-3',; (SEQ ID NO: 257)

[0575]200 μM dNTP, 2 mM MgCl₂, and 2.5 U taq DNA polymerase (Roche Molecular Biochemicals). The GeneAmp PCR System 9700 (Applied Biosystems) was used to run the following program: 94° C. for 5 minutes; 40 cycles of (94° C. for 45 seconds, 55° C. for 45 seconds, 72° C. for 90 seconds); 72° C. for 10 minutes; cool to 4° C. The PCR products were purified with QIAquick 96 PCR Purification Kit (QIAGEN Inc.) according to the manufacturer's directions. All purified PCR products were sequenced with primer 5'-TTACACTTTATGCTTCCG-3' (SEQ ID NO: 258) using the ABI 3770 Sequencer (Perkin Elmer) according to the manufacturer's directions.

5. Sequence Ranking

[0576]The peptide sequences that were translated from nucleotide sequences (from section 4C above) were correlated to ELISA data. The clones that showed high OD reading in the Ang-2 coated wells and low OD reading in the BSA coated wells were considered more important. The sequences that occurred multiple times were also considered important. Twenty four peptide sequences from library 20, 26 peptide sequences from library 94, 7 peptide sequences from library 25, 18 peptide sequences from library 26, 6 peptide sequences from library 27, and 4 peptide sequences from library 99 were chosen for further analysis and peptibody generation. Additionally, eleven consensus sequences from libraries 20 and 94, three consensus sequences from libraries 26 and 99, and two from library 25 were deduced and used to generate peptibodies. The peptibodies in Table 7 were evaluated using the Neutralization ELISA protocol described in Example 10 herein. The results are shown in Table 7.

TABLE-US-00040 TABLE 7 Con4 Derived Affinity- Matured hAng-2:Tie2 Peptibody Sequence Pbs IC₅₀ (nM) (Seq Id No:) Con4-44 (C) 0.09 M-Fc-GGGGGAQ- PIRQEECDWDPWTCEHMWEV-LE (SEQ ID NO: 259) Con4-40 (C) 0.10 M-Fc-GGGGGAQ- TNIQEECEWDPWTCDHMPGK-LE (SEQ ID NO: 260) Con4-4 (C) 0.12 M-Fc-GGGGGAQ- WYEQDACEWDPWTCEHMAEV-LE (SEQ ID NO: 261) Con4-31 (C) 0.16 M-Fc-GGGGGAQ- NRLQEVCEWDPWTCEHMENV-LE (SEQ ID NO: 262) Con4-C5 (C) 0.16 M-Fc-GGGGGAQ- AATQEECEWDPWTCEHMPRS-LE (SEQ ID NO: 263) Con4-42 (C) 0.17 M-Fc-GGGGGAQ- LRHQEGCEWDPWTCEHMFDW-LE (SEQ ID NO: 264) Con4-35 (C) 0.18 M-Fc-GGGGGAQ- VPRQKDCEWDPWTCEHMYVG-LE (SEQ ID NO: 265) Con4-43 (C) 0.18 M-Fc-GGGGGAQ- SISHEECEWDPWTCEHMQVG-LE (SEQ ID NO: 266) Con4-49 (C) 0.19 M-Fc-GGGGGAQ- WAAQEECEWDPWTCEHMGRM-LE (SEQ ID NO: 267) Con4-27 (C) 0.22 M-Fc-GGGGGAQ- TWPQDKCEWDPWTCEHMGST-LE (SEQ ID NO: 268) Con4-48 (C) 0.26 M-Fc-GGGGGAQ- GHSQEECGWDPWTCEHMGTS-LE (SEQ ID NO: 269) Con4-46 (C) 0.26 M-Fc-GGGGGAQ- QHWQEECEWDPWTCDHMPSK-LE (SEQ ID NO: 270) Con4-41 (C) 0.26 M-Fc-GGGGGAQ- NVRQEKCEWDPWTCEHMPVR-LE (SEQ ID NO: 271) Con4-36 (C) 0.28 M-Fc-GGGGGAQ- KSGQVECNWDPWTCEHMPRN-LE (SEQ ID NO: 272) Con4-34 (C) 0.28 M-Fc-GGGGGAQ- VKTQEHCDWDPWTCEHMREW-LE (SEQ ID NO: 273) Con4-28 (C) 0.30 M-Fc-GGGGGAQ- AWGQEGCDWDPWTCEHMLPM-LE (SEQ ID NO: 274) Con4-39 (C) 0.30 M-Fc-GGGGGAQ- PVNQEDCEWDPWTCEHMPPM-LE (SEQ ID NO: 275) Con4-25 (C) 0.31 M-Fc-GGGGGAQ- RAPQEDCEWDPWTCAHMDIK-LE (SEQ ID NO: 276) Con4-50 (C) 0.38 M-Fc-GGGGGAQ- HGQNMECEWDPWTCEHMFRY-LE (SEQ ID NO: 277) Con4-38 (C) 0.40 M-Fc-GGGGGAQ- PRLQEECVWDPWTCEHMPLR-LE (SEQ ID NO: 278) Con4-29 (C) 0.41 M-Fc-GGGGGAQ- RTTQEKCEWDPWTCEHMESQ-LE (SEQ ID NO: 279) Con4-47 (C) 0.44 M-Fc-GGGGGAQ- QTSQEDCVWDPWTCDHMVSS-LE (SEQ ID NO: 280) Con4-20 (C) 0.48 M-Fc-GGGGGAQ- QVIGRPCEWDPWTCEHLEGL-LE (SEQ ID NO: 281) Con4-45 (C) 0.48 M-Fc-GGGGGAQ- WAQQEECAWDPWTCDHMVGL-LE (SEQ ID NO: 282) Con4-37 (C) 0.49 M-Fc-GGGGGAQ- LPGQEDCEWDPWTCEHMVRS-LE (SEQ ID NO: 283) Con4-33 (C) 0.52 M-Fc-GGGGGAQ- PMNQVECDWDPWTCEHMPRS-LE (SEQ ID NO: 284) AC2-Con4 (C) 0.52 M-Fc-GGGGGAQ- FGWSHGCEWDPWTCEHMGST-LE (SEQ ID NO: 285) Con4-32 (C) 0.75 M-Fc-GGGGGAQ- KSTQDDCDWDPWTCEHMVGP-LE (SEQ ID NO: 286) Con4-17 (C) 0.96 M-Fc-GGGGGAQ- GPRISTCQWDPWTCEHMDQL-LE (SEQ ID NO: 287) Con4-8 (C) 1.20 M-Fc-GGGGGAQ- STIGDMCEWDPWTCAHMQVD-LE (SEQ ID NO: 288) AC4-Con4 (C) 1.54 M-Fc-GGGGGAQ- VLGGQGCEWDPWTCRLLQGW-LE (SEQ ID NO: 289) Con4-1 (C) 2.47 M-Fc-GGGGGAQ- VLGGQGCQWDPWTCSHLEDG-LE (SEQ ID NO: 290) Con4-C1 (C) 2.75 M-Fc-GGGGGAQ- TTIGSMCEWDPWTCAHMQGG-LE (SEQ ID NO: 291) Con4-21 (C) 3.21 M-Fc-GGGGGAQ- TKGKSVCQWDPWTCSHMQSG-LE (SEQ ID NO: 292) Con4-C2 (C) 3.75 M-Fc-GGGGGAQ- TTIGSMCQWDPWTCAHMQGG-LE (SEQ ID NO: 293) Con4-18 (C) 4.80 M-Fc-GGGGGAQ- WVNEVVCEWDPWTCNHWDTP-LE (SEQ ID NO: 294) Con4-19 (C) 5.76 M-Fc-GGGGGAQ- VVQVGMCQWDPWTCKHMRLQ-LE (SEQ ID NO: 295) Con4-16 (C) 6.94 M-Fc-GGGGGAQ- AVGSQTCEWDPWTCAHLVEV-LE (SEQ ID NO: 296) Con4-11 (C) 9.70 M-Fc-GGGGGAQ- QGMKMFCEWDPWTCAHIVYR-LE (SEQ ID NO: 297) Con4-C4 (C) 9.80 M-Fc-GGGGGAQ- TTIGSMCQWDPWTCEHMQGG-LE (SEQ ID NO: 298) Con4-23 (C) 9.88 M-Fc-GGGGGAQ- TSQRVGCEWDPWTCQHLTYT-LE (SEQ ID NO: 299) Con4-15 (C) 15.00 M-Fc-GGGGGAQ- QWSWPPCEWDPWTCQTVWPS-LE (SEQ ID NO: 300) Con4-9 (C) 20.11 M-Fc-GGGGGAQ- GTSPSFCQWDPWTCSHMVQG-LE (SEQ ID NO: 301) Con4-10 (C) 86.61 M-Fc-GGGGGAQ- TQGLHQCEWDPWTCKVLWPS-LE (SEQ ID NO: 302) Con4-22 (C) 150.00 M-Fc-GGGGGAQ- VWRSQVCQWDPWTCNLGGDW-LE (SEQ ID NO: 303) Con4-3 (C) 281.50 M-Fc-GGGGGAQ- DKILEECQWDPWTCQFFYGA-LE (SEQ ID NO: 304) Con4-5 (C) No Inhibition M-Fc-GGGGGAQ- ATFARQCQWDPWTCALGGNW-LE (SEQ ID NO: 305) Con4-30 (C) No Inhibition M-Fc-GGGGGAQ- GPAQEECEWDPWTCEPLPLM-LE (SEQ ID NO: 306) Con4-26 (C) No Inhibition M-Fc-GGGGGAQ- RPEDMCSQWDPWTWHLQGYC-LE (SEQ ID NO: 307) Con4-7 (C) No Inhibition M-Fc-GGGGGAQ- LWQLAVCQWDPQTCDHMGAL-LE (SEQ ID NO: 308) Con4-12 (C) No Inhibition M-Fc-GGGGGAQ- TQLVSLCEWDPWTCRLLDGW-LE (SEQ ID NO: 309) Con4-13 (C) No Inhibition M-Fc-GGGGGAQ- MGGAGRCEWDPWTCQLLQGW-LE (SEQ ID NO: 310) Con4-14 (C) No Inhibition M-Fc-GGGGGAQ- MFLPNECQWDPWTCSNLPEA-LE (SEQ ID NO: 311) Con4-2 (C) No Inhibition M-Fc-GGGGGAQ- FGWSHGCEWDPWTCRLLQGW-LE (SEQ ID NO: 312) Con4-6 (C) No Inhibition M-Fc-GGGGGAQ- WPQTEGCQWDPWTCRLLHGW-LE (SEQ ID NO: 313) Con4-24 (C) No Inhibition M-Fc-GGGGGAQ- PDTRQGCQWDPWTCRLYGMW-LE (SEQ ID NO: 314) AC1-Con4 (C) No Inhibition M-Fc-GGGGGAQ- TWPQDKCEWDPWTCRLLQGW-LE (SEQ ID NO: 315) AC3-Con4 (C) No Inhibition M-Fc-GGGGGAQ- DKILEECEWDPWTCRLLQGW-LE (SEQ ID NO: 316) AC5-Con4 (C) No Inhibition M-Fc-GGGGGAQ- AATQEECEWDPWTCRLLQGW-LE (SEQ ID NO: 317) L1 Derived Affinity- Matured hAng-2:Tie2 Peptibody Sequence Pbs IC₅₀ (nM) (Seq Id No:) L1-7 (N) 0.03 MGAQ- TNFMPMDDLEQRLYEQFILQQG-

LEGGGGG-Fc (SEQ ID NO: 318) AC6-L1 (N) 0.03 MGAQ- TNYKPLDELDATLYEHWILQHS LEGGGGG-Fc (SEQ ID NO: 319) L1-15 (N) 0.04 MGAQ- QKYQPLDELDKTLYDQFMLQQG LEGGGGG-Fc (SEQ ID NO: 320) L1-2 (N) 0.04 MGAQ-LNFTPLDELEQTLYEQWT LQQSLEGGGGG-Fc (SEQ ID NO: 321) L1-10 (N) 0.05 MGAQ- QKFQPLDELEQTLYEQFMLQQA LEGGGGG-Fc (SEQ ID NO: 322) L1-13 (N) 0.05 MGAQ- QEYEPLDELDETLYNQWMFHQR LEGGGGG-Fc (SEQ ID NO: 323) L1-5 (N) 0.05 MGAQ-VKYKPLDELDEILYEQQT FQERLEGGGGG-Fc (SEQ ID NO: 324) L1-C2 (N) 0.05 MGAQ- TKFQPLDELDQTLYEQWTLQQR LEGGGGG-Fc (SEQ ID NO: 325) L1-C3 (N) 0.06 MGAQ- TNFQPLDELDQTLYEQWTLQQR LEGGGGG-Fc (SEQ ID NO: 326) L1-11 (N) 0.07 MGAQ- QNFKPMDELEDTLYKQFLFQHS LEGGGGG-Fc (SEQ ID NO: 327) L1-17 (N) 0.08 MGAQ- VKYKPLDELDEWLYHQFTLHHQ LEGGGGG-Fc (SEQ ID NO: 328) L1-12 (N) 0.08 MGAQ- YKFTPLDDLEQTLYEQWTLQHV LEGGGGG-Fc (SEQ ID NO: 329) L1-1 (N) 0.08 MGAQ-QNYKPLDELDATLYEHFIF HYTLEGGGGG-Fc (SEQ ID NO: 330) L1-4 (N) 0.08 MGAQ- VKFKPLDALEQTLYEHWMFQQA LEGGGGG-Fc (SEQ ID NO: 331) L1-20 (N) 0.09 MGAQ- EDYMPLDALDAQLYEQFILLHG LEGGGGG-Fc (SEQ ID NO: 332) L1-22 (N) 0.09 MGAQ- YKFNPMDELEQTLYEEFLFQHA LEGGGGG-Fc (SEQ ID NO: 333) L1-14 (N) 0.11 MGAQ- SNFMPLDELEQTLYEQFMLQHQ LEGGGGG-Fc (SEQ ID NO: 334) L1-16 (N) 0.11 MGAQ- QKFQPLDELEETLYKQWTLQQR LEGGGGG-Fc (SEQ ID NO: 335) L1-18 (N) 0.16 MGAQ-QKFMPLDELDEILYEQFMF QQSLEGGGGG-Fc (SEQ ID NO: 336) L1-3 (N) 0.16 MGAQ- TKFNPLDELEQTLYEQWTLQHQ LEGGGGG-Fc (SEQ ID NO: 337) L1-21 (N) 0.17 MGAQ- HTFQPLDELEETLYYQWLYDQL LEGGGGG-Fc (SEQ ID NO: 338) L1-C1 (N) 0.56 MGAQ- QKFKPLDELEQTLYEQWTLQQR LEGGGGG-Fc (SEQ ID NO: 339) L1-19 (N) 1.26 MGAQ- QTFQPLDDLEEYLYEQWIRRYH LEGGGGG-Fc (SEQ ID NO: 340) L1-9 (N) 1.62 MGAQ- SKFKPLDELEQTLYEQWTLQHA LEGGGGG-Fc (SEQ ID NO: 341) Con1 Derived Affinity- Matured hAng-2:Tie2 Peptibody Sequence Pbs IC₅₀ (nM) (Seq Id No:) Con1-4 (C) 1.68 M-Fc-GGGGGAQ- SGQLRPCEEIFGCGTQNLAL-LE (SEQ ID NO: 342) Con1-1 (C) 3.08 M-Fc-GGGGGAQ- AGGMRPYDGMLGWPNYDVQA-LE (SEQ ID NO: 343) Con1-6 (C) 8.60 M-Fc-GGGGGAQ- GQDLRPCEDMFGCGTKDWYG-LE (SEQ ID NO: 344) Con1-3 (C) 16.42 M-Fc-GGGGGAQ- APGQRPYDGMLGWPTYQRIV-LE (SEQ ID NO: 345) Con1-2 (C) No Inhibition M-Fc-GGGGGAQ- QTWDDPCMHILGPVTWRRCI-LE (SEQ ID NO: 346) Con1-5 (C) No Inhibition M-Fc-GGGGGAQ- FGDKRPLECMFGGPIQLCPR-LE (SEQ ID NO: 347) Parent: 26.00 M-Fc-GGGGGAQ-KRPCEEIFGG Con1 (C) CTYQ-LE (SEQ ID NO: 348) 12-9 Derived Affinity- Matured hAng-2:Tie2 Peptibody Sequence Pbs IC₅₀ (nM) (Seq Id No:) 12-9-3 (C) 0.81 M-Fc-GGGGGAQ- LQEWCEGVEDPFTFGCEKQR-LE (SEQ ID NO: 349) 12-9-7 (C) 0.93 M-Fc-GGGGGAQ- MLDYCEGMDDPFTFGCDKQM-LE (SEQ ID NO: 350) 12-9-6 (C) 0.95 M-Fc-GGGGGAQ- HQEYCEGMEDPFTFGCEYQG-LE (SEQ ID NO: 351) 12-9-C2 (C) 1.41 M-Fc-GGGGGAQ- LQDYCEGVEDPFTFGCENQR-LE (SEQ ID NO: 352) 12-9-5 (C) 1.56 M-Fc-GGGGGAQ- LLDYCEGVQDPFTFGCENLD-LE (SEQ ID NO: 353) 12-9-1 (C) 1.84 M-Fc-GGGGGAQ- GFEYCDGMEDPFTFGCDKQT-LE (SEQ ID NO: 354) 12-9-4 (C) 2.05 M-Fc-GGGGGAQ- AQDYCEGMEDPFTFGCEMQK-LE (SEQ ID NO: 355) 12-9-C1 (C) 2.68 M-Fc-GGGGGAQ- LQDYCEGVEDPFTFGCEKQR-LE (SEQ ID NO: 356) 12-9-2 (C) 8.42 M-Fc-GGGGGAQ- KLEYCDGMEDPFTQGCDNQS-LE (SEQ ID NO: 357) Parent: 15.00 M-Fc-GGGGGAQ- 12-9 (C) FDYCEGVEDPFTFGCDNH-LE (SEQ ID NO: 358)

EXAMPLE 9

[0577]Six samples of anti-Ang2 peptibodies were tested for their binding activity to huAng2 (R&D Systems, BNO12103A) on BIAcore. Protein G was immobilized to a CM5 chip according to the standard amine-coupling protocol (BIAcore Inc.), and the peptibodies were then injected over a protein G surface for capturing (RL˜100 Ru). To test binding between hAng2 and the captured peptibody, 0.3 nM to 40 nM of huAng2 was injected over the captured peptibody surfaces, and binding sensorgrams were analyzed using BIAevaluation 3.0 (BIAcore Inc.). Table 8 summarizes the results of this experiment.

TABLE-US-00041 TABLE 8 Peptibody Lot # KD (M) ka (1/Ms) kd (1/s) Con4-44 (C) 011702 2.1E-10 2.9E+05 5.9E-05 L1-7 (N) 022102 2.4E-10 3.7E+05 8.7E-05 L1-10 (N) 021302 7.7E-10 1.5E+05 1.1E-04 L1-21 (N) 021802 2.4E-10 5.6E+05 1.4E-04 Con4 (C) 33456-77 3.8E-10 5.3E+05 2.0E-04 2 × Con4 (C) 1K 092501 3.4E-10 4.8E+05 1.6E-04

EXAMPLE 10

Neutralization ELISA

[0578]The human, murine, cyno, and rat Ang-2 and human and murine Ang-1 conditioned media were diluted in DMEM/50 μg/ml BSA as follows: hAng-2--1:64 dilution; mAng-2--1:64 dilution; rat Ang-2--undiluted; cyno Ang-2--1:32 dilution; hAng-1--1:4 dilution; and mAng-1--1:4 dilution.

[0579]The extent to which each of these conditioned media was diluted was determined by their ability to bind 1 nM hTie2-Fc (provided as a Tie-2-Fc molecule where the Tie-2 portion contains only the soluble extracellular portion of the molecule; R&D Systems, catalog number 313-TI) at 50% of maximally achievable binding (i.e., plateau). Microtiter plates were coated with 100 μl of the diluted conditioned media. For Ang-2 neutralization ELISAs, candidate anti-Ang-2 peptibodies were titrated from 62.5 nM to 0.015 pM in 4-fold dilutions in a solution of PBS containing about 1% BSA and about 1 nM Tie-2 (provided as a Tie-2-Fc molecule where the Tie-2 portion contains only the soluble extracellular portion of the molecule; R&D Systems, catalog number 313-TI). For Ang-1 neutralization ELISAs, candidate anti-Ang-2 peptibodies were titrated from 1000 nM to 0.2 μM in 4-fold dilutions in a solution of PBS containing about 1% BSA and about 1 nM Tie-2 (provided as a Tie-2-Fc molecule where the Tie-2 portion contains only the soluble extracellular portion of the molecule; R&D Systems, catalog number 313-TI).

[0580]After about 100 microliters of the peptibody/Tie-2 solution was added to each well, the plates were incubated overnight at room temperature, and then washed five times in PBS containing about 0.1 percent Tween-20. After washing, about 100 microliters per well of anti-Tie-2 antibody (Pharmingen Inc., catalog #557039) was added to a final concentration of about 1 microgram per ml, and the plates were incubated about 1 hour at room temperature. Next, about 100 microliters per well of goat anti-mouse-IgG-HRP (Pierce Chemical Co., catalog #31432) was added at a dilution of 1:10,000 in PBS containing about 1% BSA.

[0581]Plates were incubated at room temperature for about 1 hour, after which they were washed five times with PBS containing about 0.1 percent Tween-20. About 100 microliters per well of TMB substrate (SIGMA, catalog #T8665) was then added and blue color was allowed to develop. Absorbance was then read in a spectrophotomer at 370 nm. The results are set forth in Table 9 below.

TABLE-US-00042 TABLE 9 Peptibody-Mediated Neutralization of Angiopoietin:Tie2 Interactions hAng-2 mAng-2 rAng-2 cAng-2 hAng-1 mAng-1 Peptibody IC₅₀ (nM) IC₅₀ (nM) IC₅₀ (nM) IC₅₀ (nM) IC₅₀ (nM) IC₅₀ (nM) 2xCon4 (C) 0.026 0.035 0.024 0.047 3.0 3.2 Con4 (C) 0.197 0.289 0.236 0.540 200 300 Con4-44 (C) 0.08 0.16 0.22 -- 43 -- Con4-40 (C) 0.20 0.27 0.35 -- >1000 -- L1-7 (N) 0.046 0.063 0.035 0.108 >1000 >1000 L1-21 (N) 0.179 0.249 0.204 0.608 >1000 >1000 L1-10 (N) 0.06 0.06 0.06 -- >1000 --

EXAMPLE 11

PK Study

Study Design

[0582]Male CD-1 mice, weighing 20-30 g, were randomly divided into each peptibody treatment group (2×Con4-C, L1-7-N, and L1-21-N). Animals received a single IV bolus (n=38/group) or a single SC administration of 50 μg peptibody (n=34/group). The injections were done via the tail vein and under the skin over the shoulders for IV and SC administrations, respectively.

Blood Sampling and Analytical Methods

[0583]Blood samples were collected for each anti-Ang2 peptibody concentration measurement predose, and at 1, 2, 4, 8, 16, 24, 48, 72, 96, 120, 144, 168, 216, 264, 312, and 336 hours after dose administration for the SC and IV groups. Additional samples were collected at 5 and 30 minutes postdose for IV groups. Two animals were bled per time point, and animals were sacrificed after sampling. Blood (approximately 0.50 mL) was collected from a cardiac puncture into polypropylene Microtainer® serum separator tubes. Samples were kept on ice for approximately 20 minutes or until clot formation occurred. Serum was separated from the blood samples by centrifugation for approximately 10 minutes at 2-8° C., and stored at approximately -70° C. until assayed. Samples were measured using a verified time resolved fluorescence (TRF) assay with a lower limit of quantification (LLOQ) of 100 ng/mL. NUNC fluoroMaxisorp microtiter plates were coated with recombinant mouse Ang-2 protein. The plates were then blocked with a protein solution to reduce nonspecific binding. Standards, quality controls and unknown samples were prepared in 10% mouse serum assay buffer and pipetted into wells of microtiter plates. The peptibodies were bound specifically to the immobilized Ang-2. After washing away any unbound substances (Kirkegaard & Perry Laboratories Inc.), a biotinylated goat anti-Human IgG (H+L) monoclonal antibody (Jackson ImmunoResearch Laboratories Inc.) was added to the wells. Following a wash step to remove any unbound biotinylated monoclonal antibody, europium labelled streptavidin was added to the wells. After washing off the unbound streptavidin europium, the bound europium was released from the streptavidin with an acidic solution pipetted into each well. Fluorescent signal was generated and read in the Wallac's fluorometric reader. The assay range for the analysis of anti-Ang-2 peptibody in mouse serum is 0.078-5 μg/mL.

Pharmacokinetic Analysis

[0584]The composite mean concentration-time data for each group were subjected to noncompartmental analysis using WinNonlin Professional (Version 3.3, Pharsight Corp., Mountain View, Calif.). The nominal sampling times were used for PK analysis, as samples were collected within 10% of the nominal time. All concentration values less than the LLOQ were set to zero before PK analysis. The following PK parameters were estimated: [0585]Terminal half-life (t₁/2) was calculated as

[0585] t 1 / 2 = ln ( 2 ) k el , ##EQU00001##

where k_el was the first-order terminal rate constant estimated via linear regression of the terminal log-linear decay phase. [0586]The area under the serum concentration-time curve (AUC.sub.(0-last)) was estimated using the linear/log trapezoidal method from time 0 to last, the time of the last quantifiable concentration (C_last). [0587]The area under the curve from time 0 to infinity (AUC.sub.(0-∞)) was estimated as the sum of the corresponding AUC.sub.(0-last) and the predicted C_last/k_el values:

[0587] AUC ( 0 - ∞ ) = AUC ( 0 - last ) + Predicted C last k el ##EQU00002## [0588]Absolute bioavailability (F) after SC administration was calculated as:

[0588] F = AUC ( 0 - ∞ ) SC AUC ( 0 - ∞ ) IV × 100 ##EQU00003##

[0589]The results are set forth in FIG. 2.

EXAMPLE 12

[0590]Female nude mice were injected subcutaneously with 1×10⁷ A431 cells on study day 0. At day 3, the Ang-2 peptibody 2×Con4-C was administered subcutaneously at a dose of 200 μg/mouse/day. Tumor volumes and body weights were recorded at regular intervals, as shown in the figure. Significant differences in tumor growth were observed between the Ang-2 peptibody-treated group versus vehicle control and control peptibody (p<0.0001 vs. each control using repeated measure ANOVA, with Scheffe's post hoc test). Treatment with this peptibody had no significant effect on body weights. The results are set forth in FIG. 3.

EXAMPLE 13

A431 In Vitro Growth Curve

[0591]A431 cells were seeded in 96-well tissue culture plates at 2000 cells per well, in 200 μl of DMEM supplemented with 10% fetal bovine serum (FBS). The medium was then aspirated 16 hours post seeding. The following were then added back into the wells and set up in triplicate: 100 μl per well of DMEM, 10% FBS, 1 mg/ml negative control peptibody 4883 or peptibody TN8-Con4. The same set-ups were repeated on 5 plates. Medium from one plate was aspirated at 24, 48, 72, 96, and 120 hours post treatment. One hundred μl of 10% trichloroacetic acid (TCA) per well were then added, and the plates were then stored at 4° C. All of the plates were collected when the last plate had been in 10% TCA for a minimum of 4 hours. The 10% TCA was shaken out, and the wells were rinsed 5 times with tap water. The cells were then stained with 100 μl 0.4% sulforhodamine B (Sigma S-9012) in 1% acetic acid (Sigma A-6283) for 10 minutes at room temperature, and then washed 5 times with 1% acetic acid. The plates were then air dried. The dye was solubilized with 300 μl 20 mM unbuffered Tris (pH>10) for 2 hours on a rotary shaker. Optical density (OD) was then read at 540 nm on a microtiter plate reader. The results are set forth in FIG. 4.

EXAMPLE 14

[0592]Female nude mice were injected subcutaneously with 2×10⁶ Colo-205 cells plus Matrigel (2:1) on study day 0. At day 3, the Ang-2 peptibodies L1-7-N, L1-21-N, Con4-C, and 2×Con4-C were administered subcutaneously at the dose of 14 μg/mouse, twice a week. Anti-Ang-2 antibody Ab536, 47 μg/mouse, three times a week, was administered as a positive control. Tumor volumes and body weights were recorded at regular intervals.

[0593]Significant differences in tumor growth were observed between each one of the Ang-2 peptibody treated group versus vehicle control and control peptibody (p<0.0001 vs. each control using repeated measure ANOVA, with Scheffe's post hoc test). Treatment with these peptibodies had no significant effect on body weights (results not shown). The results are set forth in FIG. 5.

EXAMPLE 15

Female nude mice were injected subcutaneously with 2×10⁶ Colo-205 cells plus Matrigel (2:1) on study day 0. At day 3, the Ang-2 peptibody 2×Con4-C was administered subcutaneously at the doses of 14, 2.8, and 0.56 μg/mouse, twice a week. Tumor volumes and body weights were recorded at regular intervals, as shown. Significant differences in tumor growth were observed between the two higher doses of the Ang-2 peptibody treated group versus vehicle control and control peptibody (p=0.003 for the intermediate dose and p<0.0001 for the high dose, using repeated measure ANOVA, with Scheffe's post hoc test). Treatment with these peptibodies had no significant effect on body weights. The dashed line represent a reduction of the total n of the group, from 10 to 9 mice, due to the death of one mouse for unknown reasons. The results are set forth in FIG. 6.

EXAMPLE 16

Anti-Ang-2 Peptibodies vs. Colo-205 Xenograft Tumors

[0594]Female nude mice were injected subcutaneously with 2×10⁶ Colo-205 cells plus Matrigel (2:1) on study day 0. At day 3, Ang-2 peptibody 2×Con4-C or control peptibody were administered subcutaneously at the dose of 350 μg/day. Tumors from groups treated with control peptibody (as described in Table 5) were harvested either at Day 14 (size-matched control) or Day 18 (time-matched control). Tumors from 2×Con4(C) treated group were then harvested at Day 18. Tumor volumes were recorded at regular intervals, as shown. Significant differences in tumor growth were observed between the time-matched control group and the 2×Con4-C treated group (p=0.0154 by repeated measure ANOVA, with Scheffe's post hoc test). Treatment with these peptibodies had no significant effect on body weight.

[0595]Tumors prepared for image analysis were bisected coronally and one-half snap frozen in OCT (Sakura Finetek USA Inc., Torrance, Calif.). Cryo-sections were immunohistochemically stained using anti-mouse CD31 (catalogue #553370, BD PharMingen, San Diego, Calif.) at 2 μg/ml, with DAB as the chromogen. The tumor sections were digitally photographed at 20× objective magnification. Four "compass-point" fields per tumor were captured, with ten tumors per treatment group. A MetaMorph (Universal Imaging Corporation, Downington, Pa.) image analysis system was used to threshold for the CD31 stained blood vessels within the images. The areas of CD31 positive staining were expressed as a ratio of the total tumor tissue within each field. The results are set forth in FIG. 7.

EXAMPLE 17

[0596]Female nude mice were injected subcutaneously with 2×10⁶ Colo-205 cells plus Matrigel (2:1) on study day 0. Treatment with 350 μg/mouse, s.c. twice a week, of the Ang-2 peptibody 2×Con4-C, or equivalent control peptibody started either at study day 3, 10 or 15. Tumor volumes and body weights were recorded at regular intervals. Significant differences in tumor growth were observed between all Ang-2 peptibody treated group versus vehicle control (p=0.089 for day 15 group and p<0.0001 for day 3 and 10 groups, using repeated measure ANOVA, with Scheffe's post hoc test). Treatment with these peptibodies had no significant effect on body weights. The results are set forth in FIG. 8 (body weights not shown).

EXAMPLE 18

[0597]A summary of complete response (CR) rates was obtained using antibody Ab536 at 47 μg/female nude mouse, administered intraperitoneally three times a week, or with peptibody 2×Con4(C), given subcutaneously at multiple dosing schedules in different long term studies (≧10 weeks of dosing) in both the A431 and Colo-205 xenograft models. CR as used herein refers to an outcome in which no measurable tumor remained following treatment. The results are set forth in FIG. 9.

EXAMPLE 19

a) Combination of Pb with Taxotere in the Colo-205 Tumor Model

[0598]Female nude mice were injected subcutaneously with 2×10⁶ Colo-205 cells plus Matrigel (2:1) on study day 0. At study day 14, treatments were started with a) 350 μg/mouse, s.c. twice a week, of the Ang-2 peptibody 2×Con4-C, b) 20 mg/kg qwx3 i.p. of taxotere, or c) a combination of both. Tumor volumes and body weights were recorded at regular intervals. Significant differences in tumor growth were observed between all treatment groups versus vehicle control (p<0.0001 using repeated measure ANOVA, with Scheffe's post hoc test). In addition, the combination therapy group was significantly different than either one of the monotherapy agents (p<0.0001 vs. 2×Con-4-C and p=0.0122 vs taxotere). The dashed line represents a reduction of the total n of the group, from 10 to 9 mice, due to the death of one mouse for unknown reasons. Treatment with these peptibodies had no significant effect on body weights. The results are set forth in FIG. 10A.

b) Combination of Pb with 5-FU in the Colo-205 Tumor Model

[0599]Female nude mice were injected subcutaneously with 2×10⁶ Colo-205 cells plus Matrigel (2:1) on study day 0. At study day 14 started treatments with a) 350 μg/mouse, s.c. twice a week, of the Ang-2 peptibody 2×Con4-C, b) 50 mg/kg qdx5 i.p. of 5-FU, or c) a combination of both. Tumor volumes and body weights were recorded at regular intervals, as shown.

[0600]Significant differences in tumor growth were observed between all treatment groups versus vehicle control (p<0.0001 using repeated measure ANOVA, with Scheffe's post hoc test). In addition, the combination therapy group was significantly different than either one of the monotherapy agents (p=0.0375 vs. 2×Con-4-C and p=0.0453 vs. 5-FU). A transient reduction in body weight was observed in the 5-FU treated group (18% at study day 20) as well as with the combination therapy group (16% at study day 20), followed by a complete recovery of the body weights. The results are set forth in FIG. 10B.

EXAMPLE 20

Adjuvant Arthritis Model

[0601]Male Lewis rats (120-130 g, Charles River, Wilmington Mass.) were housed two per filter-capped cage in an environmentally controlled room (temperature 23±2° C., relative humidity 50±20%) on a 12-hourlight/dark cycle. Animals were fed a commercial rodent chow (Formulation 8640; Tek Lab, Madison, Wis.) and received filter-purified tap water ad libitum. Dietary calcium and phosphorus contents were 1.2% and 1.0%, respectively.

[0602]Adjuvant arthritis was induced by a single 0.5 mg injection of heat-killed Mycobacterium tuberculosis H37Ra (Difco Laboratories, Detroit, Mich.) suspended in 0.05 mL paraffin oil (Crescent Chemical Co., Hauppauge, N.Y.) intradermally at the base of the tail. The clinical onset of arthritis was at day 9 as indicated by hind paw swelling and ambulatory difficulties. Except in the 2×Con4(c) treated group (which was treated from Day 1 after immunization), treatments were given as daily subcutaneous injections beginning at day 9 after immunization (prior to onset of arthritis) and continuing through day 18.

Clinical Monitoring of Adjuvant Arthritis.

[0603]The progression of inflammation was assessed clinically by the intermittent measurement of hind paw volume using water plethysmography according to the methods described by Feige et al., Cellular Molec. Life Sci., 57:1457-1470 (2000). Inhibition of paw inflammation was calculated based on the area under the curve (AUC) using the trapezoidal rule according to the formula:

[1-{(Treated AdA)-normal)/(Untreated AdA-normal)}]×100

[0604]In addition, total body weight was determined daily during the 9-day treatment regimen as a supplemental endpoint because body weight loss has been shown to parallel the progression of joint inflammation in this arthritis model. Animals were sacrificed under CO₂ on day 18.

[0605]Loss of bone mineral density (BMD) was examined at necropsy (day 18 post immunization). Hind paws were removed at the fur line (just proximal to the ankle (hock)), immersed in 70% ethanol, and then scanned in horizontal orientation using a fan beam X-ray densitometer (Model QDR-4500A; Hologic, Waltham, Mass.). See Feige et al., supra. After the scan, a rectangular box (29×25 mm) centered at the calcaneus was positioned to delineate the site to be analyzed, and proprietary algorithms (Hologic software) calculated bone area, bone mineral content, and bone mineral density.

[0606]All results were expressed as the mean±standard error. A p value of 0.05 was used to delineate significant differences between groups. A Kruskal-Wallis ANOVA and a Mann-Whitney U. test using commercial statistical software (Statsoft v3.0; Statsoft, Tulsa, Okla.) were performed on the clinical data (continuous variables).

[0607]The results are set forth in FIGS. 11a, 11b, and 11c, respectively.

EXAMPLE 21

Corneal Angiogenesis Model

Effect of CON4(C) on VEGF-Induced Angiogenesis in Rats

[0608]Ang-2 peptibody CON4(C) was evaluated in the corneal model of angiogenesis in rats. Angiogenesis was induced by implanting a VEGF- (or BSA control) soaked nylon disc into the corneal stroma (n=8/group). Peptibody TN8CON4-C was administered by sub-cutaneous injection at 1.0 or 0.1 mg/rat/day for seven days. Two other groups of animals were treated with the same dose of negative control peptibody 4883. All groups were pre-treated with a single loading dose of either 3.0 or 0.3 mg that was three times the maintenance dose of 1.0 or 0.1 mg (see figure). After seven days of treatment, two vascular endpoints were determined from each digital image of the rat cornea: the number of vessels intersecting the mid-point between the disc and the limbus, and the blood vessel area. Treatment with TN8CON4-C significantly inhibited VEGF-induced angiogenesis in a dose-dependent manner (p<0.04), whereas treatment with the control peptibody had no significant effect on either end-point. There was no evidence of overt toxicity based on body weights of the treated animals. The results are set forth in FIG. 12.

EXAMPLE 22

Epitope Mapping

[0609]Full-length (amino acids 1-495), N-terminal (amino acids 1-254) and C-terminal (amino acids 255-495) human Ang-2 (hAng-2) proteins were cloned into a CMV-driven mammalian expression vector with C-terminal 6×His tags. The three resultant constructs plus a vector control were transiently expressed into 293T cells. Conditioned media were then collected from the transfected cells, and the expression level of Ang-2 in the media was estimated by anti-6×his ELISA and Western blotting.

[0610]The binding epitope of anti-Ang-2 antibodies and peptibodies was determined by their ability to bind the three versions of human hAng-2 by ELISA according to the following protocol: a high-binding 96-well assay plate was coated with 100 μl of conditioned media per well, and incubated at 37° C. for 1 hour. Conditioned media was aspirated, and the plate was blocked with 200 μl per well of 5% BSA in PBS at room temperature for 1 hour. The blocking solution was then aspirated. 100 μl per well of antibody, peptibody, or Tie2-Fc was added at 1 μg/ml in 1% BSA in PBS, and incubated at room temperature for 1 hour. The wells were washed 4 times with 200 μl of 0.1% Tween in PBS. 100 μl per well of HRP-conjugated goat anti-human IgG or goat anti-mouse IgG were added, and incubated at room temperature for 45 minutes. The wells were then washed with 200 μl of 0.1% Tween in PBS 4 times. 100 μl per well of TMB substrate was then added. O.D. was read at 370 nm.

[0611]The results are set forth in FIG. 13A, FIG. 13B, and FIG. 13c.

EXAMPLE 23

[0612]Due to certain sensitivity limitations inherent in the BiaCore assay, binding affinity was also evaluated using a Sepidyne KinExA assay.

[0613]Binding of 2×CON4-C (Pb5714) to huAng-2 was tested on KinExA (Sapidyne, Boise, Id.). Reacti-Gel 6x beads (Pierce, Rockford, Ill.) were pre-coated with huAng-2 and blocked with BSA. 10 pM and 30 pM of 2xCON4-C samples were incubated with various concentrations (0.3 pM-3 nM) of huAng-2 at room temperature for 8 hours before run through the huAng-2-coated beads. The amount of the bead-bound peptibody was quantified by fluorescent (Cy5) labeled goat anti-human-Fc antibody (Jackson Immuno Research, West Grove, Pa.). The binding signal is proportional to the concentration of free peptibody at equilibrium.

[0614]The dissociation equilibrium constant (K_D) was obtained from nonlinear regression of the competition curves using a dual-curve one-site homogeneous binding model (KinEx® software). K_D was then determined to be approximately 2 pM for 2xCON4-C binding with huAng-2.

[0615]As is shown in FIG. 14, using the KinExA assay peptibody 2×Con4 was shown to have ˜2 pM affinity for hAng-2.

EXAMPLE 24

Pegylated Peptides

[0616]L1-7 peptide was synthesized with a 431 ABI synthesizer using a standard coupling protocol and double coupling from residue 14 (met) to the N-term residue 1 (Cys), numbering from the N-terminus to the C-terminus.

Conjugation of L1-7 Peptide with Methoxy-poly(ethylene glycol)-maleimide, MW: 5 KDa; termed "mPEG5K-(L1-7 Peptide)"

[0617]A solution of 0.8 mg of L1-7 peptide in 400 μL of buffer 1 (20 mM phosphate, 5 mM EDTA, pH 6.5) was treated with 13.5 mg of methoxy-poly(ethylene glycol)-maleimide (MW=5 KDa; Shearwater Corp.); 0.27 ml of a 50.0 mg/mL solution in buffer 1. The reaction mixture was incubated at 4° C. overnight, then diluted with 1.6 mL of buffer A (20 mM Tris hydrochloride, pH 7.2) and dialyzed in a Slide-A-Lyzer cassette (3500 MWCO, Pierce) against the same buffer. The dialyzed reaction mixture was purified by ion exchange chromatography on a 1.0 mL HiTrap Q Sepharose HP column (Amersham Biosciences Corp.). The product peak was eluted in two 1.0 mL fractions via a gradient from 100% buffer A to 100% buffer B (buffer A+0.5 M NaCl) over 40 column volumes. The combined product fractions were concentrated to 250 μL containing 0.23 mg protein/mL with a Microsep 1K Centrifugal Device (Pall Life Sciences).

Conjugation of L1-7 Peptide with 1,11-bis-maleimidotetraethyleneglycol; Termed "PEO4(L1-7 Peptide)₂"

[0618]A solution of 1.0 mg of L1-7 peptide in 500 μL of buffer 1 (20 mM phosphate, 5 mM EDTA, pH 6.5) was treated with 0.0375 mg of 1,11-bis-maleimidotetraethyleneglycol (Pierce) (0.375 mL of a 0.1 mg/mL solution in buffer 1). The reaction mixture was incubated at 4° C. for 3.33 hrs, then dialyzed in a Slide-A-Lyzer cassette (3500 MWCO, Pierce) against buffer A (20 mM Tris hydrochloride, pH 7.2). The dialyzed reaction mixture was purified by ion exchange chromatography on a 1.0 mL HiTrap Q Sepharose HP column (Amersham Biosciences Corp.). The dimeric product peak was eluted in three 1.0 mL fractions via a gradient from 100% buffer A to 100% buffer B (buffer A+0.5 M NaCl) over 40 column volumes. The combined product fractions were concentrated to 550 μL containing 0.12 mg protein/mL with a Microsep 1K Centrifugal Device (Pall Life Sciences).

Conjugation of L1-7 Peptide with Poly(ethylene glycol)-bis-maleimide: MW 3.4 KDa; Termed "PEG3.4K(L1-7 Peptide)₂"

[0619]A solution of 3.0 mg of L1-7 Peptide in 1.5 mL of buffer 1 (20 mM phosphate, 5 mM EDTA, pH 6.5) was treated with 1.125 mg of poly(ethylene glycol)-bis-maleimide (MW=3.4 KDa, Shearwater Corp.); 0.563 mL of a 2.0 mg/mL solution in buffer 1. The reaction mixture was incubated at 4° C. for overnight, then dialyzed in a Slide-A-Lyzer cassette (3500 MWCO, Pierce) against buffer A (20 mM Tris hydrochloride, pH 7.2). The dialyzed reaction mixture was purified by ion exchange chromatography on a 5.0 mL HiTrap Q Sepharose HP column (Amersham Biosciences Corp.). The product peak was eluted in three 3.0 mL fractions via a gradient from 100% buffer A to 100% buffer B (buffer A+0.5 M NaCl) over 40 column volumes. The combined product fractions were concentrated to 850 μL containing 0.24 mg protein/mL with two Microsep 1K Centrifugal Devices (Pall Life Sciences).

[0620]MALDI-TOF mass spectroscopy results were as follows:

TABLE-US-00043 Sample# Identity Exp. MS Obs. MS 1 L1-7 (unPEGylated Peptide) 3,545 3,538.7 2 mPEG5K-(L1-7 Peptide) 8,500 8,851 3 PEO4(L1-7 Peptide)₂ 7,443 7,446.29 4 PEG3.4K(L1-7 Peptide)₂ 10,550 10,552 6,882.61 3,550.13

[0621]It will be appreciated that the subscripted "₂" for the PEG3.4K(L1-7 Peptide) and PEO4(L1-7 Peptide) indicates that there are two peptides per polymer chain, one located on each end of the polymer.

IC₅₀ Determination

[0622]The IC₅₀ for inhibition of hAng2:hTie2-Fc interaction for the L1-7 free and PEGylated peptides were determined by the Neutralization ELISA as described in Example 2. For the Neutralization ELISA, microtiter plates to which human Ang-2 polypeptide was bound were prepared as described in Example 2 for the Affinity ELISA. Candidate anti-Ang-2 L1-7 PEGylated and Free peptides were titrated from 1000 nM to 0.2 pM in 4-fold dilutions in a solution of PBS containing about 1% BSA and about 1 nM Tie-2 (provided as a Tie-2-Fc molecule where the Tie-2 portion contains only the soluble extracellular portion of the molecule; R&D Systems, catalog number 313-TI). After about 100 microliters of the antibody/Tie-2 solution was added to each well, the plates were incubated overnight at room temperature, and then washed five times in PBS containing about 0.1 percent Tween-20. After washing, about 100 microliters per well of anti-Tie-2 antibody (Pharmingen Inc., catalog #557039) was added to a final concentration of about 1 microgram per ml, and the plates were incubated about 1 hour at room temperature. Next, about 100 microliters per well of goat anti-mouse-IgG-HRP (Pierce Chemical CO., catalog #31432) was added at a dilution of 1:10,000 in PBS containing about 1 percent BSA. Plates were incubated at room temperature for about 1 hour, after which they were washed five times with PBS containing about 0.1 percent Tween-20. About 100 microliters per well of TMB substrate (described above) was then added and color was allowed to develop. Absorbance was then read in a spectrophotomer at 370 nm.

[0623]L1-7 peptides (C-GGGGG-AQ-TNFMPMDDLEQRLYEQFILQQG-LE) (SEQ ID NO: 359) included: an N-terminal Cysteine for coupling to PEG; and a 5Gly linker. AQ and LE flanking sequences were present both in the original phage clone and in the peptibody. The hAng-2:Tie2 Inhibition IC₅₀ results were as follows:

TABLE-US-00044 Peptide IC₅₀ (nM) L1-7 Peptide 0.49 mPEG5K-(L1-7 Peptide) 11.7 PEO4(L1-7 Peptide)₂ 0.064 PEG3.4K(L1-7 Peptide)₂ 0.058

Sequence CWU 1

359114PRTArtificial SequenceAng-2 Binding Peptides 1Lys Arg Pro Cys Glu Glu Met Trp Gly Gly Cys Asn Tyr Asp1 5 10214PRTArtificial SequenceAng-2 Binding Peptides 2His Gln Ile Cys Lys Trp Asp Pro Trp Thr Cys Lys His Trp1 5 10314PRTArtificial SequenceAng-2 binding Polypeptide 3Lys Arg Pro Cys Glu Glu Ile Phe Gly Gly Cys Thr Tyr Gln1 5 10414PRTArtificial SequenceAng-2 binding Polypeptide 4Gln Glu Glu Cys Glu Trp Asp Pro Trp Thr Cys Glu His Met1 5 10518PRTArtificial SequenceAng-2 binding Polypeptide 5Phe Asp Tyr Cys Glu Gly Val Glu Asp Pro Phe Thr Phe Gly Cys Asp1 5 10 15Asn His620PRTArtificial SequenceAng-2 binding Polypeptide 6Lys Phe Asn Pro Leu Asp Glu Leu Glu Glu Thr Leu Tyr Glu Gln Phe1 5 10 15Thr Phe Gln Gln 20714PRTArtificial SequenceAng-2 Binding Peptides 7Gln Tyr Gly Cys Asp Gly Phe Leu Tyr Gly Cys Met Ile Asn1 5 10867DNAArtificial SequenceOligonucleotide 8acaaacaaac atatgggtgc acagaaagcg gccgcaaaaa aactcgaggg tggaggcggt 60ggggaca 67920DNAArtificial SequenceOligonucleotide 9ggtcattact ggaccggatc 201025DNAArtificial SequenceOligonucleotide 10cgtacaggtt tacgcaagaa aatgg 251166DNAArtificial SequenceOligonucleotide 11tttgttggat ccattactcg agtttttttg cggccgcttt ctgtgcacca ccacctccac 60ctttac 661232PRTArtificial SequencePeptibody capable of binding to Ang-2 12Met Gly Ala Gln Lys Phe Asn Pro Leu Asp Glu Leu Glu Glu Thr Leu1 5 10 15Tyr Glu Gln Phe Thr Phe Gln Gln Leu Glu Gly Gly Gly Gly Gly Xaa 20 25 301329PRTArtificial SequencePeptibody capable of binding to Ang-2 13Met Lys Phe Asn Pro Leu Asp Glu Leu Glu Glu Thr Leu Tyr Glu Gln1 5 10 15Phe Thr Phe Gln Gln Leu Glu Gly Gly Gly Gly Gly Xaa 20 251451PRTArtificial SequencePeptibody capable of binding to Ang-2 14Met Lys Phe Asn Pro Leu Asp Glu Leu Glu Glu Thr Leu Tyr Glu Gln1 5 10 15Phe Thr Phe Gln Gln Gly Ser Gly Ser Ala Thr Gly Gly Ser Gly Ser 20 25 30Thr Ala Ser Ser Gly Ser Gly Ser Ala Thr His Leu Glu Gly Gly Gly 35 40 45Gly Gly Xaa 501560PRTArtificial SequencePeptibody capable of binding to Ang-2 15Met Gly Ala Gln Lys Phe Asn Pro Leu Asp Glu Leu Glu Glu Thr Leu1 5 10 15Tyr Glu Gln Phe Thr Phe Gln Gln Gly Gly Gly Gly Gly Gly Gly Gly 20 25 30Lys Phe Asn Pro Leu Asp Glu Leu Glu Glu Thr Leu Tyr Glu Gln Phe 35 40 45Thr Phe Gln Gln Leu Glu Gly Gly Gly Gly Gly Xaa 50 55 601656PRTArtificial SequencePeptibody capable of binding to Ang-2 16Met Lys Phe Asn Pro Leu Asp Glu Leu Glu Glu Thr Leu Tyr Glu Gln1 5 10 15Phe Thr Phe Gln Gln Gly Gly Gly Gly Gly Gly Gly Lys Phe Asn Pro 20 25 30Leu Asp Glu Leu Glu Glu Thr Leu Tyr Glu Gln Phe Thr Phe Gln Gln 35 40 45Leu Glu Gly Gly Gly Gly Gly Xaa 50 551726PRTArtificial SequencePeptibody capable of binding to Ang-2 17Met Gly Ala Gln Gln Glu Glu Cys Glu Trp Asp Pro Trp Thr Cys Glu1 5 10 15His Met Leu Glu Gly Gly Gly Gly Gly Xaa 20 251845PRTArtificial SequencePeptibody capable of binding to Ang-2 18Met Gln Glu Glu Cys Glu Trp Asp Pro Trp Thr Cys Glu His Met Gly1 5 10 15Ser Gly Ser Ala Thr Gly Gly Ser Gly Ser Thr Ala Ser Ser Gly Ser 20 25 30Gly Ser Ala Thr His Leu Glu Gly Gly Gly Gly Gly Xaa 35 40 451962PRTArtificial SequencePeptibody capable of binding to Ang-2 19Met Gly Ala Gln Gln Glu Glu Cys Glu Trp Asp Pro Trp Thr Cys Glu1 5 10 15His Met Gly Ser Gly Ser Ala Thr Gly Gly Ser Gly Ser Thr Ala Ser 20 25 30Ser Gly Ser Gly Ser Ala Thr His Gln Glu Glu Cys Glu Trp Asp Pro 35 40 45Trp Thr Cys Glu His Met Leu Glu Gly Gly Gly Gly Gly Xaa 50 55 602031PRTArtificial SequencePeptibody capable of binding to Ang-2 20Met Xaa Gly Gly Gly Gly Gly Ala Gln Lys Phe Asn Pro Leu Asp Glu1 5 10 15Leu Glu Glu Thr Leu Tyr Glu Gln Phe Thr Phe Gln Gln Leu Glu 20 25 302153PRTArtificial SequencePeptibody capable of binding to Ang-2 21Met Xaa Gly Gly Gly Gly Gly Ala Gln Gly Ser Gly Ser Ala Thr Gly1 5 10 15Gly Ser Gly Ser Thr Ala Ser Ser Gly Ser Gly Ser Ala Thr His Lys 20 25 30Phe Asn Pro Leu Asp Glu Leu Glu Glu Thr Leu Tyr Glu Gln Phe Thr 35 40 45Phe Gln Gln Leu Glu 502259PRTArtificial SequencePeptibody capable of binding to Ang-2 22Met Xaa Gly Gly Gly Gly Gly Ala Gln Lys Phe Asn Pro Leu Asp Glu1 5 10 15Leu Glu Glu Thr Leu Tyr Glu Gln Phe Thr Phe Gln Gln Gly Gly Gly 20 25 30Gly Gly Gly Gly Gly Lys Phe Asn Pro Leu Asp Glu Leu Glu Glu Thr 35 40 45Leu Tyr Glu Gln Phe Thr Phe Gln Gln Leu Glu 50 552325PRTArtificial SequencePeptibody capable of binding to Ang-2 23Met Xaa Gly Gly Gly Gly Gly Ala Gln Gln Glu Glu Cys Glu Trp Asp1 5 10 15Pro Trp Thr Cys Glu His Met Leu Glu 20 252447PRTArtificial SequencePeptibody capable of binding to Ang-2 24Met Xaa Gly Gly Gly Gly Gly Ala Gln Gly Ser Gly Ser Ala Thr Gly1 5 10 15Gly Ser Gly Ser Thr Ala Ser Ser Gly Ser Gly Ser Ala Thr His Gln 20 25 30Glu Glu Cys Glu Trp Asp Pro Trp Thr Cys Glu His Met Leu Glu 35 40 452561PRTArtificial SequencePeptibody capable of binding to Ang-2 25Met Xaa Gly Gly Gly Gly Gly Ala Gln Gln Glu Glu Cys Glu Trp Asp1 5 10 15Pro Trp Thr Cys Glu His Met Gly Ser Gly Ser Ala Thr Gly Gly Ser 20 25 30Gly Ser Thr Ala Ser Ser Gly Ser Gly Ser Ala Thr His Gln Glu Glu 35 40 45Cys Glu Trp Asp Pro Trp Thr Cys Glu His Met Leu Glu 50 55 602675PRTArtificial SequencePeptibody capable of binding to Ang-2 26Met Gly Ala Gln Glu Glu Cys Glu Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Gly Gly Gly Gly Gly Gly Gly Gly Lys Phe Asn Pro Leu Asp Glu 20 25 30Leu Glu Glu Thr Leu Tyr Glu Gln Phe Thr Phe Gln Gln Gly Ser Gly 35 40 45Ser Ala Thr Gly Gly Ser Gly Ser Thr Ala Ser Ser Gly Ser Gly Ser 50 55 60Ala Thr His Leu Glu Gly Gly Gly Gly Gly Xaa65 70 752772PRTArtificial SequencePeptibody capable of binding to Ang-2 27Met Xaa Gly Gly Gly Gly Gly Ala Gln Gly Ser Gly Ser Ala Thr Gly1 5 10 15Gly Ser Gly Ser Thr Ala Ser Ser Gly Ser Gly Ser Ala Thr His Lys 20 25 30Phe Asn Pro Leu Asp Glu Leu Glu Glu Thr Leu Tyr Glu Gln Phe Thr 35 40 45Phe Gln Gln Gly Gly Gly Gly Gly Gln Glu Glu Cys Glu Trp Asp Pro 50 55 60Trp Thr Cys Glu His Met Leu Glu65 702830PRTArtificial SequencePeptibody capable of binding to Ang-2 28Met Gly Ala Gln Phe Asp Tyr Cys Glu Gly Val Glu Asp Pro Phe Thr1 5 10 15Phe Gly Cys Asp Asn His Leu Glu Gly Gly Gly Gly Gly Xaa 20 25 302926PRTArtificial SequencePeptibody capable of binding to Ang-2 29Met Gly Ala Gln Gln Tyr Gly Cys Asp Gly Phe Leu Tyr Gly Cys Met1 5 10 15Ile Asn Leu Glu Gly Gly Gly Gly Gly Xaa 20 253026PRTArtificial SequencePeptibody capable of binding to Ang-2 30Met Gly Ala Gln Lys Arg Pro Cys Glu Glu Met Trp Gly Gly Cys Asn1 5 10 15Tyr Asp Leu Glu Gly Gly Gly Gly Gly Xaa 20 253126PRTArtificial SequencePeptibody capable of binding to Ang-2 31Met Gly Ala Gln His Gln Ile Cys Lys Trp Asp Pro Trp Thr Cys Lys1 5 10 15His Trp Leu Glu Gly Gly Gly Gly Gly Xaa 20 253226PRTArtificial SequencePeptibody capable of binding to Ang-2 32Met Gly Ala Gln Lys Arg Pro Cys Glu Glu Ile Phe Gly Gly Cys Thr1 5 10 15Tyr Gln Leu Glu Gly Gly Gly Gly Gly Xaa 20 2533784DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 33atgggtgcac agaaattcaa cccgctggac gaactggaag aaactctgta cgaacagttc 60actttccagc agctcgaggg tggaggcggt ggggacaaaa ctcacacatg tccaccttgc 120ccagcacctg aactcctggg gggaccgtca gttttcctct tccccccaaa acccaaggac 180accctcatga tctcccggac ccctgaggtc acatgcgtgg tggtggacgt gagccacgaa 240gaccctgagg tcaagttcaa ctggtacgtg gacggcgtgg aggtgcataa tgccaagaca 300aagccgcggg aggagcagta caacagcacg taccgtgtgg tcagcgtcct caccgtcctg 360caccaggact ggctgaatgg caaggagtac aagtgcaagg tctccaacaa agccctccca 420gcccccatcg agaaaaccat ctccaaagcc aaagggcagc cccgagaacc acaggtgtac 480accctgcccc catcccggga tgagctgacc aagaaccagg tcagcctgac ctgcctggtc 540aaaggcttct atcccagcga catcgccgtg gagtgggaga gcaatgggca gccggagaac 600aactacaaga ccacgcctcc cgtgctggac tccgacggct ccttcttcct ctacagcaag 660ctcaccgtgg acaagagcag gtggcagcag gggaacgtct tctcatgctc cgtgatgcat 720gaggctctgc acaaccacta cacgcagaag agcctctccc tgtctccggg taaataatgg 780atcc 78434768DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 34atgaaattca acccgctgga cgaactggaa gaaactctgt acgaacagtt cactttccag 60cagctcgagg gtggaggcgg tggggacaaa actcacacat gtccaccttg cccagcacct 120gaactcctgg ggggaccgtc agttttcctc ttccccccaa aacccaagga caccctcatg 180atctcccgga cccctgaggt cacatgcgtg gtggtggacg tgagccacga agaccctgag 240gtcaagttca actggtacgt ggacggcgtg gaggtgcata atgccaagac aaagccgcgg 300gaggagcagt acaacagcac gtaccgtgtg gtcagcgtcc tcaccgtcct gcaccaggac 360tggctgaatg gcaaggagta caagtgcaag gtctccaaca aagccctccc agcccccatc 420gagaaaacca tctccaaagc caaagggcag ccccgagaac cacaggtgta caccctgccc 480ccatcccggg atgagctgac caagaaccag gtcagcctga cctgcctggt caaaggcttc 540tatcccagcg acatcgccgt ggagtgggag agcaatgggc agccggagaa caactacaag 600accacgcctc ccgtgctgga ctccgacggc tccttcttcc tctacagcaa gctcaccgtg 660gacaagagca ggtggcagca ggggaacgtc ttctcatgct ccgtgatgca tgaggctctg 720cacaaccact acacgcagaa gagcctctcc ctgtctccgg gtaaataa 76835834DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 35atgaaattca acccgctgga cgaactggaa gaaactctgt acgaacagtt cactttccag 60cagggatccg gttctgctac tggtggttcc ggctccaccg caagctctgg ttcaggcagt 120gcgactcatc tcgagggtgg aggcggtggg gacaaaactc acacatgtcc accttgccca 180gcacctgaac tcctgggggg accgtcagtt ttcctcttcc ccccaaaacc caaggacacc 240ctcatgatct cccggacccc tgaggtcaca tgcgtggtgg tggacgtgag ccacgaagac 300cctgaggtca agttcaactg gtacgtggac ggcgtggagg tgcataatgc caagacaaag 360ccgcgggagg agcagtacaa cagcacgtac cgtgtggtca gcgtcctcac cgtcctgcac 420caggactggc tgaatggcaa ggagtacaag tgcaaggtct ccaacaaagc cctcccagcc 480cccatcgaga aaaccatctc caaagccaaa gggcagcccc gagaaccaca ggtgtacacc 540ctgcccccat cccgggatga gctgaccaag aaccaggtca gcctgacctg cctggtcaaa 600ggcttctatc ccagcgacat cgccgtggag tgggagagca atgggcagcc ggagaacaac 660tacaagacca cgcctcccgt gctggactcc gacggctcct tcttcctcta cagcaagctc 720accgtggaca agagcaggtg gcagcagggg aacgtcttct catgctccgt gatgcatgag 780gctctgcaca accactacac gcagaagagc ctctccctgt ctccgggtaa ataa 83436861DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 36atgggtgcac agaaattcaa cccgctggac gaactggaag aaactctgta cgaacagttc 60actttccagc agggtggtgg tggtggtggc ggtggtaagt tcaacccact ggatgagctg 120gaagagactc tgtatgaaca gttcactttc cagcaactcg agggtggagg cggtggggac 180aaaactcaca catgtccacc ttgcccagca cctgaactcc tggggggacc gtcagttttc 240ctcttccccc caaaacccaa ggacaccctc atgatctccc ggacccctga ggtcacatgc 300gtggtggtgg acgtgagcca cgaagaccct gaggtcaagt tcaactggta cgtggacggc 360gtggaggtgc ataatgccaa gacaaagccg cgggaggagc agtacaacag cacgtaccgt 420gtggtcagcg tcctcaccgt cctgcaccag gactggctga atggcaagga gtacaagtgc 480aaggtctcca acaaagccct cccagccccc atcgagaaaa ccatctccaa agccaaaggg 540cagccccgag aaccacaggt gtacaccctg cccccatccc gggatgagct gaccaagaac 600caggtcagcc tgacctgcct ggtcaaaggc ttctatccca gcgacatcgc cgtggagtgg 660gagagcaatg ggcagccgga gaacaactac aagaccacgc ctcccgtgct ggactccgac 720ggctccttct tcctctacag caagctcacc gtggacaaga gcaggtggca gcaggggaac 780gtcttctcat gctccgtgat gcatgaggct ctgcacaacc actacacgca gaagagcctc 840tccctgtctc cgggtaaata a 86137849DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 37atgaaattca acccgctgga cgaactggaa gaaactctgt acgaacagtt cactttccag 60cagggtggtg gtggtggcgg tggtaagttc aacccactgg atgagctgga agagactctg 120tatgaacagt tcactttcca gcaactcgag ggtggaggcg gtggggacaa aactcacaca 180tgtccacctt gcccagcacc tgaactcctg gggggaccgt cagttttcct cttcccccca 240aaacccaagg acaccctcat gatctcccgg acccctgagg tcacatgcgt ggtggtggac 300gtgagccacg aagaccctga ggtcaagttc aactggtacg tggacggcgt ggaggtgcat 360aatgccaaga caaagccgcg ggaggagcag tacaacagca cgtaccgtgt ggtcagcgtc 420ctcaccgtcc tgcaccagga ctggctgaat ggcaaggagt acaagtgcaa ggtctccaac 480aaagccctcc cagcccccat cgagaaaacc atctccaaag ccaaagggca gccccgagaa 540ccacaggtgt acaccctgcc cccatcccgg gatgagctga ccaagaacca ggtcagcctg 600acctgcctgg tcaaaggctt ctatcccagc gacatcgccg tggagtggga gagcaatggg 660cagccggaga acaactacaa gaccacgcct cccgtgctgg actccgacgg ctccttcttc 720ctctacagca agctcaccgt ggacaagagc aggtggcagc aggggaacgt cttctcatgc 780tccgtgatgc atgaggctct gcacaaccac tacacgcaga agagcctctc cctgtctccg 840ggtaaataa 84938759DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 38atgggtgcac agcaggaaga atgcgaatgg gacccatgga cttgcgaaca catgctcgag 60ggtggaggcg gtggggacaa aactcacaca tgtccacctt gcccagcacc tgaactcctg 120gggggaccgt cagttttcct cttcccccca aaacccaagg acaccctcat gatctcccgg 180acccctgagg tcacatgcgt ggtggtggac gtgagccacg aagaccctga ggtcaagttc 240aactggtacg tggacggcgt ggaggtgcat aatgccaaga caaagccgcg ggaggagcag 300tacaacagca cgtaccgtgt ggtcagcgtc ctcaccgtcc tgcaccagga ctggctgaat 360ggcaaggagt acaagtgcaa ggtctccaac aaagccctcc cagcccccat cgagaaaacc 420atctccaaag ccaaagggca gccccgagaa ccacaggtgt acaccctgcc cccatcccgg 480gatgagctga ccaagaacca ggtcagcctg acctgcctgg tcaaaggctt ctatcccagc 540gacatcgccg tggagtggga gagcaatggg cagccggaga acaactacaa gaccacgcct 600cccgtgctgg actccgacgg ctccttcttc ctctacagca agctcaccgt ggacaagagc 660aggtggcagc aggggaacgt cttctcatgc tccgtgatgc atgaggctct gcacaaccac 720tacacgcaga agagcctctc cctgtctccg ggtaaataa 75939816DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 39atgcaggaag aatgcgaatg ggacccatgg acttgcgaac acatgggatc cggttctgct 60actggtggtt ccggctccac cgcaagctct ggttcaggca gtgcgactca tctcgagggt 120ggaggcggtg gggacaaaac tcacacatgt ccaccttgcc cagcacctga actcctgggg 180ggaccgtcag ttttcctctt ccccccaaaa cccaaggaca ccctcatgat ctcccggacc 240cctgaggtca catgcgtggt ggtggacgtg agccacgaag accctgaggt caagttcaac 300tggtacgtgg acggcgtgga ggtgcataat gccaagacaa agccgcggga ggagcagtac 360aacagcacgt accgtgtggt cagcgtcctc accgtcctgc accaggactg gctgaatggc 420aaggagtaca agtgcaaggt ctccaacaaa gccctcccag cccccatcga gaaaaccatc 480tccaaagcca aagggcagcc ccgagaacca caggtgtaca ccctgccccc atcccgggat 540gagctgacca agaaccaggt cagcctgacc tgcctggtca aaggcttcta tcccagcgac 600atcgccgtgg agtgggagag caatgggcag ccggagaaca actacaagac cacgcctccc 660gtgctggact ccgacggctc cttcttcctc tacagcaagc tcaccgtgga caagagcagg 720tggcagcagg ggaacgtctt ctcatgctcc gtgatgcatg aggctctgca caaccactac 780acgcagaaga gcctctccct gtctccgggt aaataa 81640867DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 40atgggtgcac agcaggaaga atgcgaatgg gacccatgga cttgcgaaca catgggatcc 60ggttctgcta ctggtggttc cggctccacc gcaagctctg gttcaggcag tgcgactcat 120caggaagaat gcgaatggga cccatggact tgcgaacaca tgctcgaggg tggaggcggt 180ggggacaaaa ctcacacatg tccaccttgc ccagcacctg aactcctggg gggaccgtca 240gttttcctct tccccccaaa acccaaggac accctcatga tctcccggac ccctgaggtc 300acatgcgtgg tggtggacgt gagccacgaa gaccctgagg tcaagttcaa

ctggtacgtg 360gacggcgtgg aggtgcataa tgccaagaca aagccgcggg aggagcagta caacagcacg 420taccgtgtgg tcagcgtcct caccgtcctg caccaggact ggctgaatgg caaggagtac 480aagtgcaagg tctccaacaa agccctccca gcccccatcg agaaaaccat ctccaaagcc 540aaagggcagc cccgagaacc acaggtgtac accctgcccc catcccggga tgagctgacc 600aagaaccagg tcagcctgac ctgcctggtc aaaggcttct atcccagcga catcgccgtg 660gagtgggaga gcaatgggca gccggagaac aactacaaga ccacgcctcc cgtgctggac 720tccgacggct ccttcttcct ctacagcaag ctcaccgtgg acaagagcag gtggcagcag 780gggaacgtct tctcatgctc cgtgatgcat gaggctctgc acaaccacta cacgcagaag 840agcctctccc tgtctccggg taaataa 86741774DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 41atggacaaaa ctcacacatg tccaccttgc ccagcacctg aactcctggg gggaccgtca 60gttttcctct tccccccaaa acccaaggac accctcatga tctcccggac ccctgaggtc 120acatgcgtgg tggtggacgt gagccacgaa gaccctgagg tcaagttcaa ctggtacgtg 180gacggcgtgg aggtgcataa tgccaagaca aagccgcggg aggagcagta caacagcacg 240taccgtgtgg tcagcgtcct caccgtcctg caccaggact ggctgaatgg caaggagtac 300aagtgcaagg tctccaacaa agccctccca gcccccatcg agaaaaccat ctccaaagcc 360aaagggcagc cccgagaacc acaggtgtac accctgcccc catcccggga tgagctgacc 420aagaaccagg tcagcctgac ctgcctggtc aaaggcttct atcccagcga catcgccgtg 480gagtgggaga gcaatgggca gccggagaac aactacaaga ccacgcctcc cgtgctggac 540tccgacggct ccttcttcct ctacagcaag ctcaccgtgg acaagagcag gtggcagcag 600gggaacgtct tctcatgctc cgtgatgcat gaggctctgc acaaccacta cacgcagaag 660agcctctccc tgtctccggg taaaggtgga ggtggtggtg cacagaaatt caacccgctg 720gacgagctgg aagagactct gtacgaacag tttacttttc aacagctcga gtaa 77442840DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 42atggacaaaa ctcacacatg tccaccttgc ccagcacctg aactcctggg gggaccgtca 60gttttcctct tccccccaaa acccaaggac accctcatga tctcccggac ccctgaggtc 120acatgcgtgg tggtggacgt gagccacgaa gaccctgagg tcaagttcaa ctggtacgtg 180gacggcgtgg aggtgcataa tgccaagaca aagccgcggg aggagcagta caacagcacg 240taccgtgtgg tcagcgtcct caccgtcctg caccaggact ggctgaatgg caaggagtac 300aagtgcaagg tctccaacaa agccctccca gcccccatcg agaaaaccat ctccaaagcc 360aaagggcagc cccgagaacc acaggtgtac accctgcccc catcccggga tgagctgacc 420aagaaccagg tcagcctgac ctgcctggtc aaaggcttct atcccagcga catcgccgtg 480gagtgggaga gcaatgggca gccggagaac aactacaaga ccacgcctcc cgtgctggac 540tccgacggct ccttcttcct ctacagcaag ctcaccgtgg acaagagcag gtggcagcag 600gggaacgtct tctcatgctc cgtgatgcat gaggctctgc acaaccacta cacgcagaag 660agcctctccc tgtctccggg taaaggtgga ggtggtggtg cacagggatc cggttctgct 720actggtggtt ccggctccac cgcaagctct ggttcaggca gtgcgactca taaattcaac 780ccgctggacg aactggaaga aactctgtac gaacagttca ctttccagca actcgagtaa 84043858DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 43atggacaaaa ctcacacatg tccaccttgc ccagcacctg aactcctggg gggaccgtca 60gttttcctct tccccccaaa acccaaggac accctcatga tctcccggac ccctgaggtc 120acatgcgtgg tggtggacgt gagccacgaa gaccctgagg tcaagttcaa ctggtacgtg 180gacggcgtgg aggtgcataa tgccaagaca aagccgcggg aggagcagta caacagcacg 240taccgtgtgg tcagcgtcct caccgtcctg caccaggact ggctgaatgg caaggagtac 300aagtgcaagg tctccaacaa agccctccca gcccccatcg agaaaaccat ctccaaagcc 360aaagggcagc cccgagaacc acaggtgtac accctgcccc catcccggga tgagctgacc 420aagaaccagg tcagcctgac ctgcctggtc aaaggcttct atcccagcga catcgccgtg 480gagtgggaga gcaatgggca gccggagaac aactacaaga ccacgcctcc cgtgctggac 540tccgacggct ccttcttcct ctacagcaag ctcaccgtgg acaagagcag gtggcagcag 600gggaacgtct tctcatgctc cgtgatgcat gaggctctgc acaaccacta cacgcagaag 660agcctctccc tgtctccggg taaaggtgga ggtggtggtg cacagaaatt caacccgctg 720gacgaactgg aagaaactct gtacgaacag ttcactttcc agcagggtgg tggtggtggt 780ggcggtggta agttcaaccc actggatgag ctggaagaga ctctgtatga acagttcact 840ttccagcaac tcgagtaa 85844756DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 44atggacaaaa ctcacacatg tccaccttgc ccagcacctg aactcctggg gggaccgtca 60gttttcctct tccccccaaa acccaaggac accctcatga tctcccggac ccctgaggtc 120acatgcgtgg tggtggacgt gagccacgaa gaccctgagg tcaagttcaa ctggtacgtg 180gacggcgtgg aggtgcataa tgccaagaca aagccgcggg aggagcagta caacagcacg 240taccgtgtgg tcagcgtcct caccgtcctg caccaggact ggctgaatgg caaggagtac 300aagtgcaagg tctccaacaa agccctccca gcccccatcg agaaaaccat ctccaaagcc 360aaagggcagc cccgagaacc acaggtgtac accctgcccc catcccggga tgagctgacc 420aagaaccagg tcagcctgac ctgcctggtc aaaggcttct atcccagcga catcgccgtg 480gagtgggaga gcaatgggca gccggagaac aactacaaga ccacgcctcc cgtgctggac 540tccgacggct ccttcttcct ctacagcaag ctcaccgtgg acaagagcag gtggcagcag 600gggaacgtct tctcatgctc cgtgatgcat gaggctctgc acaaccacta cacgcagaag 660agcctctccc tgtctccggg taaaggtgga ggtggtggtg cacagcagga agaatgcgaa 720tgggacccat ggacttgcga acacatgctc gagtaa 75645822DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 45atggacaaaa ctcacacatg tccaccttgc ccagcacctg aactcctggg gggaccgtca 60gttttcctct tccccccaaa acccaaggac accctcatga tctcccggac ccctgaggtc 120acatgcgtgg tggtggacgt gagccacgaa gaccctgagg tcaagttcaa ctggtacgtg 180gacggcgtgg aggtgcataa tgccaagaca aagccgcggg aggagcagta caacagcacg 240taccgtgtgg tcagcgtcct caccgtcctg caccaggact ggctgaatgg caaggagtac 300aagtgcaagg tctccaacaa agccctccca gcccccatcg agaaaaccat ctccaaagcc 360aaagggcagc cccgagaacc acaggtgtac accctgcccc catcccggga tgagctgacc 420aagaaccagg tcagcctgac ctgcctggtc aaaggcttct atcccagcga catcgccgtg 480gagtgggaga gcaatgggca gccggagaac aactacaaga ccacgcctcc cgtgctggac 540tccgacggct ccttcttcct ctacagcaag ctcaccgtgg acaagagcag gtggcagcag 600gggaacgtct tctcatgctc cgtgatgcat gaggctctgc acaaccacta cacgcagaag 660agcctctccc tgtctccggg taaaggtgga ggtggtggtg cacagggatc cggttctgct 720actggtggtt ccggctccac cgcaagctct ggttcaggca gtgcgactca tcaggaagaa 780tgcgaatggg acccatggac ttgcgaacac atgctcgagt aa 82246864DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 46atggacaaaa ctcacacatg tccaccttgc ccagcacctg aactcctggg gggaccgtca 60gttttcctct tccccccaaa acccaaggac accctcatga tctcccggac ccctgaggtc 120acatgcgtgg tggtggacgt gagccacgaa gaccctgagg tcaagttcaa ctggtacgtg 180gacggcgtgg aggtgcataa tgccaagaca aagccgcggg aggagcagta caacagcacg 240taccgtgtgg tcagcgtcct caccgtcctg caccaggact ggctgaatgg caaggagtac 300aagtgcaagg tctccaacaa agccctccca gcccccatcg agaaaaccat ctccaaagcc 360aaagggcagc cccgagaacc acaggtgtac accctgcccc catcccggga tgagctgacc 420aagaaccagg tcagcctgac ctgcctggtc aaaggcttct atcccagcga catcgccgtg 480gagtgggaga gcaatgggca gccggagaac aactacaaga ccacgcctcc cgtgctggac 540tccgacggct ccttcttcct ctacagcaag ctcaccgtgg acaagagcag gtggcagcag 600gggaacgtct tctcatgctc cgtgatgcat gaggctctgc acaaccacta cacgcagaag 660agcctctccc tgtctccggg taaaggtgga ggtggtggtg cacagcagga agaatgcgaa 720tgggacccat ggacttgcga acacatggga tccggttctg ctactggtgg ttccggctcc 780accgcaagct ctggttcagg cagcgcgact catcaggaag aatgcgaatg ggacccatgg 840acttgcgaac acatgctcga gtaa 86447906DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 47atgggtgcac aggaagaatg cgaatgggac ccatggactt gcgaacacat gggtggtggt 60ggtggtggcg gtggtaaatt caacccgctg gacgaactgg aagaaactct gtacgaacag 120ttcactttcc agcagggatc cggttctgct actggtggtt ccggctccac cgcaagctct 180ggttcaggca gtgcgactca tctcgagggt ggaggcggtg gggacaaaac tcacacatgt 240ccaccttgcc cagcacctga actcctgggg ggaccgtcag ttttcctctt ccccccaaaa 300cccaaggaca ccctcatgat ctcccggacc cctgaggtca catgcgtggt ggtggacgtg 360agccacgaag accctgaggt caagttcaac tggtacgtgg acggcgtgga ggtgcataat 420gccaagacaa agccgcggga ggagcagtac aacagcacgt accgtgtggt cagcgtcctc 480accgtcctgc accaggactg gctgaatggc aaggagtaca agtgcaaggt ctccaacaaa 540gccctcccag cccccatcga gaaaaccatc tccaaagcca aagggcagcc ccgagaacca 600caggtgtaca ccctgccccc atcccgggat gagctgacca agaaccaggt cagcctgacc 660tgcctggtca aaggcttcta tcccagcgac atcgccgtgg agtgggagag caatgggcag 720ccggagaaca actacaagac cacgcctccc gtgctggact ccgacggctc cttcttcctc 780tacagcaagc tcaccgtgga caagagcagg tggcagcagg ggaacgtctt ctcatgctcc 840gtgatgcatg aggctctgca caaccactac acgcagaaga gcctctccct gtctccgggt 900aaataa 90648897DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 48atggacaaaa ctcacacatg tccaccttgc ccagcacctg aactcctggg gggaccgtca 60gttttcctct tccccccaaa acccaaggac accctcatga tctcccggac ccctgaggtc 120acatgcgtgg tggtggacgt gagccacgaa gaccctgagg tcaagttcaa ctggtacgtg 180gacggcgtgg aggtgcataa tgccaagaca aagccgcggg aggagcagta caacagcacg 240taccgtgtgg tcagcgtcct caccgtcctg caccaggact ggctgaatgg caaggagtac 300aagtgcaagg tctccaacaa agccctccca gcccccatcg agaaaaccat ctccaaagcc 360aaagggcagc cccgagaacc acaggtgtac accctgcccc catcccggga tgagctgacc 420aagaaccagg tcagcctgac ctgcctggtc aaaggcttct atcccagcga catcgccgtg 480gagtgggaga gcaatgggca gccggagaac aactacaaga ccacgcctcc cgtgctggac 540tccgacggct ccttcttcct ctacagcaag ctcaccgtgg acaagagcag gtggcagcag 600gggaacgtct tctcatgctc cgtgatgcat gaggctctgc acaaccacta cacgcagaag 660agcctctccc tgtctccggg taaaggtgga ggtggtggtg cacagggatc cggttctgct 720actggtggtt ccggctccac cgcaagctct ggttcaggca gtgcgactca taaattcaac 780ccgctggacg aactggaaga aactctgtac gaacagttca ctttccagca gggtggtggc 840ggtggtcagg aagaatgcga atgggaccca tggacttgcg aacacatgct cgagtaa 89749771DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 49atgggtgcac agttcgacta ctgcgaaggt gttgaagacc cgttcacttt cggttgcgac 60aaccacctcg agggtggagg cggtggggac aaaactcaca catgtccacc ttgcccagca 120cctgaactcc tggggggacc gtcagttttc ctcttccccc caaaacccaa ggacaccctc 180atgatctccc ggacccctga ggtcacatgc gtggtggtgg acgtgagcca cgaagaccct 240gaggtcaagt tcaactggta cgtggacggc gtggaggtgc ataatgccaa gacaaagccg 300cgggaggagc agtacaacag cacgtaccgt gtggtcagcg tcctcaccgt cctgcaccag 360gactggctga atggcaagga gtacaagtgc aaggtctcca acaaagccct cccagccccc 420atcgagaaaa ccatctccaa agccaaaggg cagccccgag aaccacaggt gtacaccctg 480cccccatccc gggatgagct gaccaagaac caggtcagcc tgacctgcct ggtcaaaggc 540ttctatccca gcgacatcgc cgtggagtgg gagagcaatg ggcagccgga gaacaactac 600aagaccacgc ctcccgtgct ggactccgac ggctccttct tcctctacag caagctcacc 660gtggacaaga gcaggtggca gcaggggaac gtcttctcat gctccgtgat gcatgaggct 720ctgcacaacc actacacgca gaagagcctc tccctgtctc cgggtaaata a 77150759DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 50atgggtgcac agcagtacgg ttgcgacggt tttctgtacg gttgcatgat caacctcgag 60ggtggaggcg gtggggacaa aactcacaca tgtccacctt gcccagcacc tgaactcctg 120gggggaccgt cagttttcct cttcccccca aaacccaagg acaccctcat gatctcccgg 180acccctgagg tcacatgcgt ggtggtggac gtgagccacg aagaccctga ggtcaagttc 240aactggtacg tggacggcgt ggaggtgcat aatgccaaga caaagccgcg ggaggagcag 300tacaacagca cgtaccgtgt ggtcagcgtc ctcaccgtcc tgcaccagga ctggctgaat 360ggcaaggagt acaagtgcaa ggtctccaac aaagccctcc cagcccccat cgagaaaacc 420atctccaaag ccaaagggca gccccgagaa ccacaggtgt acaccctgcc cccatcccgg 480gatgagctga ccaagaacca ggtcagcctg acctgcctgg tcaaaggctt ctatcccagc 540gacatcgccg tggagtggga gagcaatggg cagccggaga acaactacaa gaccacgcct 600cccgtgctgg actccgacgg ctccttcttc ctctacagca agctcaccgt ggacaagagc 660aggtggcagc aggggaacgt cttctcatgc tccgtgatgc atgaggctct gcacaaccac 720tacacgcaga agagcctctc cctgtctccg ggtaaataa 75951759DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 51atgggtgcac agaaacgccc atgcgaagaa atgtggggtg gttgcaacta cgacctcgag 60ggtggaggcg gtggggacaa aactcacaca tgtccacctt gcccagcacc tgaactcctg 120gggggaccgt cagttttcct cttcccccca aaacccaagg acaccctcat gatctcccgg 180acccctgagg tcacatgcgt ggtggtggac gtgagccacg aagaccctga ggtcaagttc 240aactggtacg tggacggcgt ggaggtgcat aatgccaaga caaagccgcg ggaggagcag 300tacaacagca cgtaccgtgt ggtcagcgtc ctcaccgtcc tgcaccagga ctggctgaat 360ggcaaggagt acaagtgcaa ggtctccaac aaagccctcc cagcccccat cgagaaaacc 420atctccaaag ccaaagggca gccccgagaa ccacaggtgt acaccctgcc cccatcccgg 480gatgagctga ccaagaacca ggtcagcctg acctgcctgg tcaaaggctt ctatcccagc 540gacatcgccg tggagtggga gagcaatggg cagccggaga acaactacaa gaccacgcct 600cccgtgctgg actccgacgg ctccttcttc ctctacagca agctcaccgt ggacaagagc 660aggtggcagc aggggaacgt cttctcatgc tccgtgatgc atgaggctct gcacaaccac 720tacacgcaga agagcctctc cctgtctccg ggtaaataa 75952759DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 52atgggtgcac agcaccagat ctgcaaatgg gacccgtgga cctgcaaaca ctggctcgag 60ggtggaggcg gtggggacaa aactcacaca tgtccacctt gcccagcacc tgaactcctg 120gggggaccgt cagttttcct cttcccccca aaacccaagg acaccctcat gatctcccgg 180acccctgagg tcacatgcgt ggtggtggac gtgagccacg aagaccctga ggtcaagttc 240aactggtacg tggacggcgt ggaggtgcat aatgccaaga caaagccgcg ggaggagcag 300tacaacagca cgtaccgtgt ggtcagcgtc ctcaccgtcc tgcaccagga ctggctgaat 360ggcaaggagt acaagtgcaa ggtctccaac aaagccctcc cagcccccat cgagaaaacc 420atctccaaag ccaaagggca gccccgagaa ccacaggtgt acaccctgcc cccatcccgg 480gatgagctga ccaagaacca ggtcagcctg acctgcctgg tcaaaggctt ctatcccagc 540gacatcgccg tggagtggga gagcaatggg cagccggaga acaactacaa gaccacgcct 600cccgtgctgg actccgacgg ctccttcttc ctctacagca agctcaccgt ggacaagagc 660aggtggcagc aggggaacgt cttctcatgc tccgtgatgc atgaggctct gcacaaccac 720tacacgcaga agagcctctc cctgtctccg ggtaaataa 75953759DNAArtificial SequenceDNA encoding peptibodies capable of binding to Ang-2 53atgggtgcac agaaacgtcc atgcgaagaa atcttcggtg gttgcaccta ccagctcgag 60ggtggaggcg gtggggacaa aactcacaca tgtccacctt gcccagcacc tgaactcctg 120gggggaccgt cagttttcct cttcccccca aaacccaagg acaccctcat gatctcccgg 180acccctgagg tcacatgcgt ggtggtggac gtgagccacg aagaccctga ggtcaagttc 240aactggtacg tggacggcgt ggaggtgcat aatgccaaga caaagccgcg ggaggagcag 300tacaacagca cgtaccgtgt ggtcagcgtc ctcaccgtcc tgcaccagga ctggctgaat 360ggcaaggagt acaagtgcaa ggtctccaac aaagccctcc cagcccccat cgagaaaacc 420atctccaaag ccaaagggca gccccgagaa ccacaggtgt acaccctgcc cccatcccgg 480gatgagctga ccaagaacca ggtcagcctg acctgcctgg tcaaaggctt ctatcccagc 540gacatcgccg tggagtggga gagcaatggg cagccggaga acaactacaa gaccacgcct 600cccgtgctgg actccgacgg ctccttcttc ctctacagca agctcaccgt ggacaagagc 660aggtggcagc aggggaacgt cttctcatgc tccgtgatgc atgaggctct gcacaaccac 720tacacgcaga agagcctctc cctgtctccg ggtaaataa 7595425DNAArtificial SequenceOligonucleotide 54cggcgcaact atcggtatca agctg 255526DNAArtificial SequenceOligonucleotide 55catgtaccgt aacactgagt ttcgtc 265614PRTArtificial SequenceConsensus motifs generated from TN8-IX library 56Lys Arg Pro Cys Glu Glu Xaa Trp Gly Gly Cys Xaa Tyr Xaa1 5 105714PRTArtificial SequenceConsensus motifs generated from TN8-IX library 57Lys Arg Pro Cys Glu Glu Xaa Phe Gly Gly Cys Xaa Tyr Xaa1 5 105814PRTArtificial SequenceConsensus motifs generated from TN8-IX library 58Xaa Xaa Xaa Cys Xaa Trp Asp Pro Trp Thr Cys Glu Xaa Met1 5 105918PRTArtificial SequenceConsensus motif generated from TN12-I library 59Trp Ser Xaa Cys Ala Trp Phe Xaa Gly Xaa Xaa Xaa Xaa Xaa Cys Arg1 5 10 15Arg Xaa60227PRTArtificial SequenceHuman Fc IgG1 60Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly1 5 10 15Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met 20 25 30Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His 35 40 45Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val 50 55 60His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr65 70 75 80Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly 85 90 95Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile 100 105 110Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val 115 120 125Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser 130 135 140Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu145 150 155 160Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro 165 170 175Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val 180 185 190Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met 195 200 205His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser 210 215 220Pro Gly Lys2256114PRTArtificial SequenceConsensus motifs generated from TN8-IX library 61Xaa Xaa Xaa Cys Xaa Asp Xaa Tyr Trp Tyr Cys Xaa Xaa Xaa1 5 106214PRTArtificial SequenceConsensus motifs generated from TN8-IX library 62Xaa Xaa Xaa Cys Xaa Asp Xaa Tyr Thr Tyr Cys Xaa Xaa Xaa1 5 106314PRTArtificial SequenceConsensus motifs generated from TN8-IX library 63Xaa Xaa Xaa Cys Xaa Asp Xaa Phe Trp Tyr Cys Xaa Xaa Xaa1 5 106414PRTArtificial SequenceConsensus motifs

generated from TN8-IX library 64Xaa Xaa Xaa Cys Xaa Asp Xaa Phe Thr Tyr Cys Xaa Xaa Xaa1 5 10655PRTArtificial SequencePolypeptide capable of binding to Ang-2 65Trp Asp Pro Trp Thr1 5666PRTArtificial SequencePolypeptide capable of binding to Ang-2 66Trp Asp Pro Trp Thr Cys1 5677PRTArtificial SequencePolypeptide capable of binding to Ang-2 67Cys Xaa Trp Asp Pro Trp Thr1 5688PRTArtificial SequencePolypeptide capable of binding to Ang-2 68Cys Xaa Trp Asp Pro Trp Thr Cys1 56914PRTArtificial SequencePolypeptide capable of binding to Ang-2 69Xaa Xaa Xaa Cys Xaa Trp Asp Pro Trp Thr Cys Xaa Xaa Xaa1 5 107020PRTArtificial SequencePolypeptide capable of binding to Ang-2 70Xaa Xaa Xaa Xaa Xaa Xaa Cys Xaa Trp Asp Pro Trp Thr Cys Xaa Xaa1 5 10 15Xaa Xaa Xaa Xaa 207110PRTArtificial SequencePolypeptide capable of binding to Ang-2 71Pro Xaa Asp Xaa Leu Xaa Xaa Xaa Leu Tyr1 5 107222PRTArtificial SequencePolypeptide capable of binding to Ang-2 72Xaa Xaa Xaa Xaa Pro Xaa Asp Xaa Leu Xaa Xaa Xaa Leu Tyr Xaa Xaa1 5 10 15Xaa Xaa Xaa Xaa Xaa Xaa 20738PRTArtificial SequencePolypeptide capable of binding to Ang-2 73Arg Pro Xaa Xaa Xaa Xaa Xaa Gly1 57420PRTArtificial SequencePolypeptide capable of binding to Ang-2 74Xaa Xaa Xaa Xaa Arg Pro Xaa Xaa Xaa Xaa Xaa Gly Xaa Xaa Xaa Xaa1 5 10 15Xaa Xaa Xaa Xaa 207513PRTArtificial SequencePolypeptide capable of binding to Ang-2 75Cys Xaa Gly Xaa Xaa Asp Pro Phe Thr Xaa Gly Cys Xaa1 5 107620PRTArtificial SequencePolypeptide capable of binding to Ang-2 76Pro Ile Arg Gln Glu Glu Cys Asp Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Trp Glu Val 207720PRTArtificial SequencePolypeptide capable of binding to Ang-2 77Thr Asn Ile Gln Glu Glu Cys Glu Trp Asp Pro Trp Thr Cys Asp His1 5 10 15Met Pro Gly Lys 207820PRTArtificial SequencePolypeptide capable of binding to Ang-2 78Trp Tyr Glu Gln Asp Ala Cys Glu Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Ala Glu Val 207920PRTArtificial SequencePolypeptide capable of binding to Ang-2 79Asn Arg Leu Gln Glu Val Cys Glu Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Glu Asn Val 208020PRTArtificial SequencePolypeptide capable of binding to Ang-2 80Ala Ala Thr Gln Glu Glu Cys Glu Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Pro Arg Ser 208120PRTArtificial SequencePolypeptide capable of binding to Ang-2 81Leu Arg His Gln Glu Gly Cys Glu Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Phe Asp Trp 208220PRTArtificial SequencePolypeptide capable of binding to Ang-2 82Val Pro Arg Gln Lys Asp Cys Glu Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Tyr Val Gly 208320PRTArtificial SequencePolypeptide capable of binding to Ang-2 83Ser Ile Ser His Glu Glu Cys Glu Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Gln Val Gly 208420PRTArtificial SequencePolypeptide capable of binding to Ang-2 84Trp Ala Ala Gln Glu Glu Cys Glu Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Gly Arg Met 208520PRTArtificial SequencePolypeptide capable of binding to Ang-2 85Thr Trp Pro Gln Asp Lys Cys Glu Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Gly Ser Thr 208620PRTArtificial SequencePolypeptide capable of binding to Ang-2 86Gly His Ser Gln Glu Glu Cys Gly Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Gly Thr Ser 208720PRTArtificial SequencePolypeptide capable of binding to Ang-2 87Gln His Trp Gln Glu Glu Cys Glu Trp Asp Pro Trp Thr Cys Asp His1 5 10 15Met Pro Ser Lys 208820PRTArtificial SequencePolypeptide capable of binding to Ang-2 88Asn Val Arg Gln Glu Lys Cys Glu Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Pro Val Arg 208920PRTArtificial SequencePolypeptide capable of binding to Ang-2 89Lys Ser Gly Gln Val Glu Cys Asn Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Pro Arg Asn 209020PRTArtificial SequencePolypeptide capable of binding to Ang-2 90Val Lys Thr Gln Glu His Cys Asp Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Arg Glu Trp 209120PRTArtificial SequencePolypeptide capable of binding to Ang-2 91Ala Trp Gly Gln Glu Gly Cys Asp Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Leu Pro Met 209220PRTArtificial SequencePolypeptide capable of binding to Ang-2 92Pro Val Asn Gln Glu Asp Cys Glu Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Pro Pro Met 209320PRTArtificial SequencePolypeptide capable of binding to Ang-2 93Arg Ala Pro Gln Glu Asp Cys Glu Trp Asp Pro Trp Thr Cys Ala His1 5 10 15Met Asp Ile Lys 209420PRTArtificial SequencePolypeptide capable of binding to Ang-2 94His Gly Gln Asn Met Glu Cys Glu Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Phe Arg Tyr 209520PRTArtificial SequencePolypeptide capable of binding to Ang-2 95Pro Arg Leu Gln Glu Glu Cys Val Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Pro Leu Arg 209620PRTArtificial SequencePolypeptide capable of binding to Ang-2 96Arg Thr Thr Gln Glu Lys Cys Glu Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Glu Ser Gln 209720PRTArtificial SequencePolypeptide capable of binding to Ang-2 97Gln Thr Ser Gln Glu Asp Cys Val Trp Asp Pro Trp Thr Cys Asp His1 5 10 15Met Val Ser Ser 209820PRTArtificial SequencePolypeptide capable of binding to Ang-2 98Gln Val Ile Gly Arg Pro Cys Glu Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Leu Glu Gly Leu 209920PRTArtificial SequencePolypeptide capable of binding to Ang-2 99Trp Ala Gln Gln Glu Glu Cys Ala Trp Asp Pro Trp Thr Cys Asp His1 5 10 15Met Val Gly Leu 2010020PRTArtificial SequencePolypeptide capable of binding to Ang-2 100Leu Pro Gly Gln Glu Asp Cys Glu Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Val Arg Ser 2010120PRTArtificial SequencePolypeptide capable of binding to Ang-2 101Pro Met Asn Gln Val Glu Cys Asp Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Pro Arg Ser 2010220PRTArtificial SequencePolypeptide capable of binding to Ang-2 102Phe Gly Trp Ser His Gly Cys Glu Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Gly Ser Thr 2010320PRTArtificial SequencePolypeptide capable of binding to Ang-2 103Lys Ser Thr Gln Asp Asp Cys Asp Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Val Gly Pro 2010420PRTArtificial SequencePolypeptide capable of binding to Ang-2 104Gly Pro Arg Ile Ser Thr Cys Gln Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Asp Gln Leu 2010520PRTArtificial SequencePolypeptide capable of binding to Ang-2 105Ser Thr Ile Gly Asp Met Cys Glu Trp Asp Pro Trp Thr Cys Ala His1 5 10 15Met Gln Val Asp 2010620PRTArtificial SequencePolypeptide capable of binding to Ang-2 106Val Leu Gly Gly Gln Gly Cys Glu Trp Asp Pro Trp Thr Cys Arg Leu1 5 10 15Leu Gln Gly Trp 2010720PRTArtificial SequencePolypeptide capable of binding to Ang-2 107Val Leu Gly Gly Gln Gly Cys Gln Trp Asp Pro Trp Thr Cys Ser His1 5 10 15Leu Glu Asp Gly 2010820PRTArtificial SequencePolypeptide capable of binding to Ang-2 108Thr Thr Ile Gly Ser Met Cys Glu Trp Asp Pro Trp Thr Cys Ala His1 5 10 15Met Gln Gly Gly 2010920PRTArtificial SequencePolypeptide capable of binding to Ang-2 109Thr Lys Gly Lys Ser Val Cys Gln Trp Asp Pro Trp Thr Cys Ser His1 5 10 15Met Gln Ser Gly 2011020PRTArtificial SequencePolypeptide capable of binding to Ang-2 110Thr Thr Ile Gly Ser Met Cys Gln Trp Asp Pro Trp Thr Cys Ala His1 5 10 15Met Gln Gly Gly 2011120PRTArtificial SequencePolypeptide capable of binding to Ang-2 111Trp Val Asn Glu Val Val Cys Glu Trp Asp Pro Trp Thr Cys Asn His1 5 10 15Trp Asp Thr Pro 2011220PRTArtificial SequencePolypeptide capable of binding to Ang-2 112Val Val Gln Val Gly Met Cys Gln Trp Asp Pro Trp Thr Cys Lys His1 5 10 15Met Arg Leu Gln 2011320PRTArtificial SequencePolypeptide capable of binding to Ang-2 113Ala Val Gly Ser Gln Thr Cys Glu Trp Asp Pro Trp Thr Cys Ala His1 5 10 15Leu Val Glu Val 2011420PRTArtificial SequencePolypeptide capable of binding to Ang-2 114Gln Gly Met Lys Met Phe Cys Glu Trp Asp Pro Trp Thr Cys Ala His1 5 10 15Ile Val Tyr Arg 2011520PRTArtificial SequencePolypeptide capable of binding to Ang-2 115Thr Thr Ile Gly Ser Met Cys Gln Trp Asp Pro Trp Thr Cys Glu His1 5 10 15Met Gln Gly Gly 2011620PRTArtificial SequencePolypeptide capable of binding to Ang-2 116Thr Ser Gln Arg Val Gly Cys Glu Trp Asp Pro Trp Thr Cys Gln His1 5 10 15Leu Thr Tyr Thr 2011720PRTArtificial SequencePolypeptide capable of binding to Ang-2 117Gln Trp Ser Trp Pro Pro Cys Glu Trp Asp Pro Trp Thr Cys Gln Thr1 5 10 15Val Trp Pro Ser 2011820PRTArtificial SequencePolypeptide capable of binding to Ang-2 118Gly Thr Ser Pro Ser Phe Cys Gln Trp Asp Pro Trp Thr Cys Ser His1 5 10 15Met Val Gln Gly 2011922PRTArtificial SequencePolypeptide capable of binding to Ang-2 119Gln Asn Tyr Lys Pro Leu Asp Glu Leu Asp Ala Thr Leu Tyr Glu His1 5 10 15Phe Ile Phe His Tyr Thr 2012022PRTArtificial SequencePolypeptide capable of binding to Ang-2 120Leu Asn Phe Thr Pro Leu Asp Glu Leu Glu Gln Thr Leu Tyr Glu Gln1 5 10 15Trp Thr Leu Gln Gln Ser 2012122PRTArtificial SequencePolypeptide capable of binding to Ang-2 121Thr Lys Phe Asn Pro Leu Asp Glu Leu Glu Gln Thr Leu Tyr Glu Gln1 5 10 15Trp Thr Leu Gln His Gln 2012222PRTArtificial SequencePolypeptide capable of binding to Ang-2 122Val Lys Phe Lys Pro Leu Asp Ala Leu Glu Gln Thr Leu Tyr Glu His1 5 10 15Trp Met Phe Gln Gln Ala 2012322PRTArtificial SequencePolypeptide capable of binding to Ang-2 123Val Lys Tyr Lys Pro Leu Asp Glu Leu Asp Glu Ile Leu Tyr Glu Gln1 5 10 15Gln Thr Phe Gln Glu Arg 2012422PRTArtificial SequencePolypeptide capable of binding to Ang-2 124Thr Asn Phe Met Pro Met Asp Asp Leu Glu Gln Arg Leu Tyr Glu Gln1 5 10 15Phe Ile Leu Gln Gln Gly 2012522PRTArtificial SequencePolypeptide capable of binding to Ang-2 125Ser Lys Phe Lys Pro Leu Asp Glu Leu Glu Gln Thr Leu Tyr Glu Gln1 5 10 15Trp Thr Leu Gln His Ala 2012622PRTArtificial SequencePolypeptide capable of binding to Ang-2 126Gln Lys Phe Gln Pro Leu Asp Glu Leu Glu Gln Thr Leu Tyr Glu Gln1 5 10 15Phe Met Leu Gln Gln Ala 2012722PRTArtificial SequencePolypeptide capable of binding to Ang-2 127Gln Asn Phe Lys Pro Met Asp Glu Leu Glu Asp Thr Leu Tyr Lys Gln1 5 10 15Phe Leu Phe Gln His Ser 2012822PRTArtificial SequencePolypeptide capable of binding to Ang-2 128Tyr Lys Phe Thr Pro Leu Asp Asp Leu Glu Gln Thr Leu Tyr Glu Gln1 5 10 15Trp Thr Leu Gln His Val 2012922PRTArtificial SequencePolypeptide capable of binding to Ang-2 129Gln Glu Tyr Glu Pro Leu Asp Glu Leu Asp Glu Thr Leu Tyr Asn Gln1 5 10 15Trp Met Phe His Gln Arg 2013022PRTArtificial SequencePolypeptide capable of binding to Ang-2 130Ser Asn Phe Met Pro Leu Asp Glu Leu Glu Gln Thr Leu Tyr Glu Gln1 5 10 15Phe Met Leu Gln His Gln 2013122PRTArtificial SequencePolypeptide capable of binding to Ang-2 131Gln Lys Tyr Gln Pro Leu Asp Glu Leu Asp Lys Thr Leu Tyr Asp Gln1 5 10 15Phe Met Leu Gln Gln Gly 2013222PRTArtificial SequencePolypeptide capable of binding to Ang-2 132Gln Lys Phe Gln Pro Leu Asp Glu Leu Glu Glu Thr Leu Tyr Lys Gln1 5 10 15Trp Thr Leu Gln Gln Arg 2013322PRTArtificial SequencePolypeptide capable of binding to Ang-2 133Val Lys Tyr Lys Pro Leu Asp Glu Leu Asp Glu Trp Leu Tyr His Gln1 5 10 15Phe Thr Leu His His Gln 2013422PRTArtificial SequencePolypeptide capable of binding to Ang-2 134Gln Lys Phe Met Pro Leu Asp Glu Leu Asp Glu Ile Leu Tyr Glu Gln1 5 10 15Phe Met Phe Gln Gln Ser 2013522PRTArtificial SequencePolypeptide capable of binding to Ang-2 135Gln Thr Phe Gln Pro Leu Asp Asp Leu Glu Glu Tyr Leu Tyr Glu Gln1 5 10 15Trp Ile Arg Arg Tyr His 2013622PRTArtificial SequencePolypeptide capable of binding to Ang-2 136Glu Asp Tyr Met Pro Leu Asp Ala Leu Asp Ala Gln Leu Tyr Glu Gln1 5 10 15Phe Ile Leu Leu His Gly 2013722PRTArtificial SequencePolypeptide capable of binding to Ang-2 137His Thr Phe Gln Pro Leu Asp Glu Leu Glu Glu Thr Leu Tyr Tyr Gln1 5 10 15Trp Leu Tyr Asp Gln Leu 2013822PRTArtificial SequencePolypeptide capable of binding to Ang-2 138Tyr Lys Phe Asn Pro Met Asp Glu Leu Glu Gln Thr Leu Tyr Glu Glu1 5 10 15Phe Leu Phe Gln His Ala 2013922PRTArtificial SequencePolypeptide capable of binding to Ang-2 139Thr Asn Tyr Lys Pro Leu Asp Glu Leu Asp Ala Thr Leu Tyr Glu His1 5 10 15Trp Ile Leu Gln His Ser 2014022PRTArtificial SequencePolypeptide capable of binding to Ang-2 140Gln Lys Phe Lys Pro Leu Asp Glu Leu Glu Gln Thr Leu Tyr Glu Gln1 5 10 15Trp Thr Leu Gln Gln Arg 2014122PRTArtificial SequencePolypeptide capable of binding to Ang-2 141Thr Lys Phe Gln Pro Leu Asp Glu Leu Asp Gln Thr Leu Tyr Glu Gln1 5 10 15Trp Thr Leu Gln Gln Arg 2014222PRTArtificial SequencePolypeptide capable of binding to Ang-2 142Thr Asn Phe Gln Pro Leu Asp Glu Leu Asp Gln Thr Leu Tyr Glu Gln1 5 10 15Trp Thr Leu Gln Gln Arg 2014320PRTArtificial SequencePolypeptide capable of binding to Ang-2 143Ala Gly Gly Met Arg Pro Tyr Asp Gly Met Leu Gly Trp Pro Asn Tyr1 5 10 15Asp Val Gln Ala 2014420PRTArtificial SequencePolypeptide capable of binding to Ang-2 144Gln Thr Trp Asp Asp Pro Cys Met His Ile Leu Gly Pro Val Thr Trp1 5 10 15Arg Arg Cys Ile 2014520PRTArtificial SequencePolypeptide capable of binding to Ang-2 145Ala Pro Gly Gln Arg Pro Tyr Asp Gly Met Leu Gly Trp Pro Thr Tyr1 5 10 15Gln Arg Ile Val 2014620PRTArtificial SequencePolypeptide capable of binding to Ang-2 146Ser Gly Gln Leu Arg Pro Cys Glu Glu Ile Phe Gly Cys Gly Thr Gln1 5 10 15Asn Leu Ala Leu 2014720PRTArtificial SequencePolypeptide capable of binding to Ang-2 147Phe Gly Asp Lys Arg Pro Leu Glu Cys Met Phe Gly Gly Pro Ile Gln1 5 10 15Leu Cys Pro Arg 2014820PRTArtificial SequencePolypeptide capable of binding to Ang-2 148Gly Gln Asp Leu Arg Pro Cys Glu Asp Met Phe Gly Cys Gly Thr Lys1 5 10 15Asp Trp Tyr Gly 2014920PRTArtificial SequencePolypeptide capable of binding to Ang-2 149Gly Phe Glu Tyr Cys Asp Gly Met Glu Asp Pro Phe Thr Phe Gly Cys1

5 10 15Asp Lys Gln Thr 2015020PRTArtificial SequencePolypeptide capable of binding to Ang-2 150Lys Leu Glu Tyr Cys Asp Gly Met Glu Asp Pro Phe Thr Gln Gly Cys1 5 10 15Asp Asn Gln Ser 2015120PRTArtificial SequencePolypeptide capable of binding to Ang-2 151Leu Gln Glu Trp Cys Glu Gly Val Glu Asp Pro Phe Thr Phe Gly Cys1 5 10 15Glu Lys Gln Arg 2015220PRTArtificial SequencePolypeptide capable of binding to Ang-2 152Ala Gln Asp Tyr Cys Glu Gly Met Glu Asp Pro Phe Thr Phe Gly Cys1 5 10 15Glu Met Gln Lys 2015320PRTArtificial SequencePolypeptide capable of binding to Ang-2 153Leu Leu Asp Tyr Cys Glu Gly Val Gln Asp Pro Phe Thr Phe Gly Cys1 5 10 15Glu Asn Leu Asp 2015420PRTArtificial SequencePolypeptide capable of binding to Ang-2 154His Gln Glu Tyr Cys Glu Gly Met Glu Asp Pro Phe Thr Phe Gly Cys1 5 10 15Glu Tyr Gln Gly 2015520PRTArtificial SequencePolypeptide capable of binding to Ang-2 155Met Leu Asp Tyr Cys Glu Gly Met Asp Asp Pro Phe Thr Phe Gly Cys1 5 10 15Asp Lys Gln Met 2015620PRTArtificial SequencePolypeptide capable of binding to Ang-2 156Leu Gln Asp Tyr Cys Glu Gly Val Glu Asp Pro Phe Thr Phe Gly Cys1 5 10 15Glu Asn Gln Arg 2015720PRTArtificial SequencePolypeptide capable of binding to Ang-2 157Leu Gln Asp Tyr Cys Glu Gly Val Glu Asp Pro Phe Thr Phe Gly Cys1 5 10 15Glu Lys Gln Arg 2015820PRTArtificial SequencePolypeptide capable of binding to Ang-2 158Xaa Xaa Xaa Xaa Cys Xaa Gly Xaa Xaa Asp Pro Phe Thr Xaa Gly Cys1 5 10 15Xaa Xaa Xaa Xaa 2015960DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 159ccgatccgtc aggaagaatg cgactgggac ccgtggacct gcgaacacat gtgggaagtt 6016060DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 160accaacatcc aggaagaatg cgaatgggac ccgtggacct gcgaccacat gccgggtaaa 6016160DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 161tggtacgaac aggacgcttg cgaatgggac ccgtggacct gcgaacacat ggctgaagtt 6016260DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 162aaccgtctgc aggaagtttg cgaatgggac ccgtggacct gcgaacacat ggaaaacgtt 6016360DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 163gctgctaccc aggaagaatg cgaatgggac ccgtggacct gcgaacacat gccgcgttcc 6016460DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 164ctgcgtcacc aggaaggttg cgaatgggac ccgtggacct gcgaacacat gttcgactgg 6016560DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 165gttccgcgtc agaaagactg cgaatgggac ccgtggacct gcgaacacat gtacgttggt 6016660DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 166tgggctgctc aggaagaatg cgaatgggat ccgtggactt gcgaacacat gggtcgtatg 6016760DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 167acttggccgc aggacaaatg cgaatgggat ccgtggactt gcgaacacat gggttctact 6016860DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 168ggtcactccc aggaagaatg cggttgggac ccgtggacct gcgaacacat gggtacgtcc 6016960DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 169cagcactggc aggaagaatg cgaatgggac ccgtggacct gcgaccacat gccgtccaaa 6017060DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 170aacgttcgtc aggaaaaatg cgaatgggac ccgtggacct gcgaacacat gccggttcgt 6017160DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 171aaatccggtc aggttgaatg caactgggac ccgtggacct gcgaacacat gccgcgtaac 6017260DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 172gttaaaaccc aggaacactg cgactgggac ccgtggacct gcgaacacat gcgtgaatgg 6017360DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 173gcttggggtc aggaaggttg cgactgggac ccgtggacct gcgaacacat gctgccgatg 6017460DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 174ccggttaacc aggaagactg cgaatgggac ccgtggacct gcgaacacat gccgccgatg 6017560DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 175cgtgctccgc aggaagactg cgaatgggac ccgtggacct gcgctcacat ggacatcaaa 6017660DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 176cacggtcaga acatggaatg cgaatgggac ccgtggacct gcgaacacat gttccgttac 6017760DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 177ccgcgtctgc aggaagaatg cgtttgggac ccgtggacct gcgaacacat gccgctgcgt 6017860DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 178cgtaccaccc aggaaaaatg cgaatgggac ccgtggacct gcgaacacat ggaatcccag 6017960DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 179cagacctccc aggaagactg cgtttgggac ccgtggacct gcgaccacat ggtttcctcc 6018060DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 180caggttatcg gtcgtccgtg cgaatgggac ccgtggacct gcgaacacct ggaaggtctg 6018160DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 181tgggctcagc aggaagaatg cgcttgggac ccgtggacct gcgaccacat ggttggtctg 6018260DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 182ctgccgggtc aggaagactg cgaatgggac ccgtggacct gcgaacacat ggttcgttcc 6018360DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 183ccgatgaacc aggttgaatg cgactgggac ccgtggacct gcgaacacat gccgcgttcc 6018460DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 184ttcggttggt ctcacggttg cgaatgggat ccgtggactt gcgaacacat gggttctacc 6018560DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 185aaatccaccc aggacgactg cgactgggac ccgtggacct gcgaacacat ggttggtccg 6018660DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 186ggtccgcgta tctccacctg ccagtgggac ccgtggacct gcgaacacat ggaccagctg 6018760DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 187tccaccatcg gtgacatgtg cgaatgggac ccgtggacct gcgctcacat gcaggttgac 6018860DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 188gttctgggtg gtcagggttg cgaatgggac ccgtggacct gccgtctgct gcagggttgg 6018960DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 189gttctgggtg gtcagggttg ccagtgggac ccgtggacct gctcccacct ggaagacggt 6019060DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 190accaccatcg gttccatgtg cgaatgggac ccgtggacct gcgctcacat gcagggtggt 6019160DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 191accaaaggta aatccgtttg ccagtgggac ccgtggacct gctcccacat gcagtccggt 6019260DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 192accaccatcg gttccatgtg ccagtgggac ccgtggacct gcgctcacat gcagggtggt 6019360DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 193tgggttaacg aagttgtttg cgaatgggac ccgtggacct gcaaccactg ggacaccccg 6019460DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 194gttgttcagg ttggtatgtg ccagtgggac ccgtggacct gcaaacacat gcgtctgcag 6019560DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 195gctgttggtt cccagacctg cgaatgggac ccgtggacct gcgctcacct ggttgaagtt 6019660DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 196cagggtatga aaatgttctg cgaatgggac ccgtggacct gcgctcacat cgtttaccgt 6019760DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 197accaccatcg gttccatgtg ccagtgggac ccgtggacct gcgaacacat gcagggtggt 6019860DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 198acctcccagc gtgttggttg cgaatgggac ccgtggacct gccagcacct gacctacacc 6019960DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 199cagtggtcct ggccgccgtg cgaatgggac ccgtggacct gccagaccgt ttggccgtcc 6020060DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 200ggtacctccc cgtccttctg ccagtgggac ccgtggacct gctcccacat ggttcagggt 6020142DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 201caggaagaat gcgaatggga cccatggact tgcgaacaca tg 4220266DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 202cagaactaca aaccgctgga cgaactggac gctaccctgt acgaacactt catcttccac 60tacacc 6620366DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 203ctgaacttca ccccgctgga cgaactggaa cagaccctgt acgaacagtg gaccctgcag 60cagtcc 6620466DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 204accaaattca acccgctgga cgaactggaa cagaccctgt acgaacagtg gaccctgcag 60caccag 6620566DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 205gttaaattca aaccgctgga cgctctggaa cagaccctgt acgaacactg gatgttccag 60caggct 6620666DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 206gttaaataca aaccgctgga cgaactggac gaaatcctgt acgaacagca gaccttccag 60gaacgt 6620766DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 207accaacttca tgccgatgga cgacctggaa cagcgtctgt acgaacagtt catcctgcag 60cagggt 6620866DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 208tccaaattca aaccgctgga cgaactggaa cagaccctgt acgaacagtg gaccctgcag 60cacgct 6620966DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 209cagaaattcc agccgctgga cgaactggaa cagaccctgt acgaacagtt catgctgcag 60caggct 6621066DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 210cagaacttca aaccgatgga cgaattggaa gacaccctgt acaaacagtt cctgttccag 60cactcc 6621166DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 211tacaaattca ccccgctgga cgacctggaa cagaccctgt acgaacagtg gaccctgcag 60cacgtt 6621265DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 212aggaatacga accgctggac gaactggacg aaaccctgta caaccagtgg atgttccacc 60agcgt 6521366DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 213tccaacttca tgccgctgga cgaactggaa cagaccctgt acgaacagtt catgctgcag 60caccag 6621466DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 214cagaaatacc agccgctgga cgaactggac aaaaccctgt acgatcagtt catgctgcag 60cagggt 6621566DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 215cagaaattcc agccgctgga cgaactggaa gaaaccctgt acaaacagtg gaccctgcag 60cagcgt 6621666DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 216gttaaataca aaccgctgga cgaactggac gaatggctgt accaccagtt caccctgcac 60caccag 6621767DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 217cagaaattca tgccgctgga cgaactggac gaaatcctgt acgaacagtt catgttccag 60cagtccc 6721866DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 218cagaccttcc agccgctgga cgacctggaa gaatacttgt acgaacagtg gatccgtcgt 60taccac 6621966DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 219gaagactaca tgccgctgga cgctctggac gctcagctgt acgaacagtt catcctgctg 60cacggt 6622066DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 220cacaccttcc agccgctgga cgaactggaa gaaaccctgt actaccagtg gctgtacgac 60cagctg 6622166DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 221tacaaattca acccgatgga cgaactggaa cagaccctgt acgaagaatt cctgttccag 60cacgct 6622266DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 222accaactaca aaccgctgga cgaactggac gctaccctgt acgaacactg gatcctgcag 60cactcc 6622366DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 223cagaaattca aaccgctgga cgaactggaa cagaccctgt acgaacagtg gaccctgcag 60cagcgt 6622466DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 224accaaattcc agccgctgga cgaactggac cagaccctgt acgaacagtg gaccctgcag 60cagcgt 6622566DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 225accaacttcc agccgctgga cgaactggac cagaccctgt acgaacagtg gaccctgcag 60cagcgt 6622660DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 226aaattcaacc cgctggacga gctggaagag actctgtacg aacagtttac ttttcaacag 6022760DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 227gctggtggta tgcgtccgta cgacggtatg ctgggttggc cgaactacga cgttcaggct 6022860DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 228cagacttggg acgatccgtg catgcacatt ctgggtccgg ttacttggcg tcgttgcatc 6022960DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 229gctccgggtc agcgtccgta cgacggtatg ctgggttggc cgacctacca gcgtatcgtt 6023060DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 230tccggtcagc tgcgtccgtg cgaagaaatc ttcggttgcg gtacccagaa cctggctctg 6023160DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 231ttcggtgaca aacgtccgct ggaatgcatg ttcggtggtc cgatccagct gtgcccgcgt 6023260DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 232ggtcaggacc tgcgtccgtg cgaagacatg ttcggttgcg gtaccaaaga ctggtacggt 6023360DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 233ggtttcgaat actgcgacgg tatggaagac ccgttcacct tcggttgcga caaacagacc 6023460DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 234aaactggaat actgcgacgg tatggaagac ccgttcaccc agggttgcga caaccagtcc 6023560DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 235ctgcaggaat ggtgcgaagg tgttgaagac ccgttcacct tcggttgcga aaaacagcgt 6023660DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 236gctcaggact actgcgaagg tatggaagac ccgttcacct tcggttgcga aatgcagaaa 6023760DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 237ctgctggact actgcgaagg tgttcaggac ccgttcacct tcggttgcga aaacctggac 6023860DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 238caccaggaat actgcgaagg tatggaagac ccgttcacct tcggttgcga ataccagggt 6023960DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 239atgctggact actgcgaagg tatggacgac ccgttcacct tcggttgcga caaacagatg 6024060DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 240ctgcaggact actgcgaagg tgttgaagac ccgttcacct tcggttgcga aaaccagcgt 6024160DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 241ctgcaggact actgcgaagg tgttgaagac ccgttcacct tcggttgcga aaaacagcgt 6024254DNAArtificial SequenceDNA encoding peptide capable of binding to Ang-2 242ttcgactact gcgaaggtgt tgaagacccg ttcactttcg gctgtgataa ccac 54243250PRTArtificial SequenceDNA encoding peptide capable of binding to Ang-2 243Met Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu1 5 10 15Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu 20 25 30Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser 35 40 45His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu 50 55 60Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr65 70 75 80Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp

Leu Asn 85 90 95Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro 100 105 110Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln 115 120 125Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val 130 135 140Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val145 150 155 160Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro 165 170 175Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr 180 185 190Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val 195 200 205Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu 210 215 220Ser Pro Gly Lys Gly Gly Gly Gly Gly Cys Thr Ala Gly Tyr His Trp225 230 235 240Asn Ser Asp Cys Glu Cys Cys Arg Arg Asn 245 25024429DNAArtificial SequenceOligonucleotide 244caaacgaatg gatcctcatt aaagccaga 2924542DNAArtificial SequenceOligonucleotide 245ggtggtgcgg ccgcactcga gactgttgaa agttgtttag ca 4224629DNAArtificial SequenceOligonucleotide 246caaacgaatg gatcctcatt aaagccaga 2924743DNAArtificial SequenceOligonucleotide 247aacacaaaag tgcacagggt ggaggtggtg gtgcggccgc act 4324891PRTArtificial SequenceOligonucleotide 248Cys Ala Cys Ala Gly Thr Gly Cys Ala Cys Ala Gly Gly Gly Thr Asn1 5 10 15Asn Lys Asn Asn Lys Asn Asn Lys Asn Asn Lys Asn Asn Lys Asn Asn 20 25 30Lys Asn Asn Lys Ser Ala Arg Thr Gly Gly Gly Ala Thr Cys Cys Gly 35 40 45Thr Gly Gly Ala Ser Cys Asn Asn Lys Asn Asn Lys Asn Asn Lys Asn 50 55 60Asn Lys Asn Asn Lys Asn Asn Lys Asn Asn Lys Cys Ala Thr Thr Cys65 70 75 80Thr Cys Thr Cys Gly Ala Gly Ala Thr Cys Ala 85 9024991PRTArtificial SequenceOligonucleotide 249Cys Ala Cys Ala Gly Thr Gly Cys Ala Cys Ala Gly Gly Gly Thr Asn1 5 10 15Asn Lys Asn Asn Lys Asn Asn Lys Ala Ala Lys Cys Gly Lys Cys Cys 20 25 30Lys Asn Asn Lys Gly Ala Lys Gly Ala Lys Ala Thr Lys Thr Thr Lys 35 40 45Gly Gly Lys Gly Gly Lys Asn Asn Lys Ala Cys Lys Thr Ala Lys Cys 50 55 60Ala Lys Asn Asn Lys Asn Asn Lys Asn Asn Lys Cys Ala Thr Thr Cys65 70 75 80Thr Cys Thr Cys Gly Ala Gly Ala Thr Cys Ala 85 9025095PRTArtificial SequenceOligonucleotide 250Cys Ala Cys Ala Gly Thr Gly Cys Ala Cys Ala Gly Gly Gly Thr Asn1 5 10 15Asn Lys Ala Ala Lys Thr Thr Lys Ala Ala Lys Cys Cys Lys Cys Thr 20 25 30Lys Gly Ala Lys Gly Ala Lys Cys Thr Lys Gly Ala Lys Gly Ala Lys 35 40 45Ala Cys Lys Cys Thr Lys Thr Ala Lys Gly Ala Lys Cys Ala Lys Thr 50 55 60Thr Lys Ala Cys Lys Thr Thr Lys Cys Ala Lys Cys Ala Lys Asn Asn65 70 75 80Lys Cys Ala Thr Thr Cys Thr Cys Thr Cys Gly Ala Gly Ala Thr 85 90 9525191PRTArtificial SequenceOligonucleotide 251Cys Ala Cys Ala Gly Thr Gly Cys Ala Cys Ala Gly Gly Gly Thr Asn1 5 10 15Asn Lys Asn Asn Lys Asn Asn Lys Cys Ala Lys Gly Ala Lys Gly Ala 20 25 30Lys Thr Gly Cys Gly Ala Lys Thr Gly Lys Gly Ala Lys Cys Cys Lys 35 40 45Thr Gly Lys Ala Cys Lys Thr Gly Cys Gly Ala Lys Cys Ala Lys Ala 50 55 60Thr Lys Asn Asn Lys Asn Asn Lys Asn Asn Lys Cys Ala Thr Thr Cys65 70 75 80Thr Cys Thr Cys Gly Ala Gly Ala Thr Cys Ala 85 9025289PRTArtificial SequenceOligonucleotide 252Cys Ala Cys Ala Gly Thr Gly Cys Ala Cys Ala Gly Gly Gly Thr Asn1 5 10 15Asn Lys Thr Thr Lys Gly Ala Lys Thr Ala Lys Asn Asn Lys Gly Ala 20 25 30Lys Gly Gly Lys Gly Thr Lys Gly Ala Lys Gly Ala Lys Cys Cys Lys 35 40 45Thr Thr Lys Ala Cys Lys Thr Thr Lys Gly Gly Lys Asn Asn Lys Gly 50 55 60Ala Lys Ala Ala Lys Cys Ala Lys Asn Asn Lys Cys Ala Thr Thr Cys65 70 75 80Thr Cys Thr Cys Gly Ala Gly Ala Thr 8525395PRTArtificial SequenceOligonucleotide 253Cys Ala Cys Ala Gly Thr Gly Cys Ala Cys Ala Gly Gly Gly Thr Asn1 5 10 15Asn Lys Ala Ala Lys Thr Thr Lys Ala Ala Lys Cys Cys Lys Cys Thr 20 25 30Lys Gly Ala Lys Gly Ala Lys Cys Thr Lys Gly Ala Lys Gly Ala Lys 35 40 45Ala Cys Lys Cys Thr Lys Thr Ala Lys Gly Ala Lys Cys Ala Lys Thr 50 55 60Thr Lys Ala Cys Lys Thr Thr Lys Cys Ala Lys Cys Ala Lys Asn Asn65 70 75 80Lys Cys Ala Thr Thr Cys Thr Cys Thr Cys Gly Ala Gly Ala Thr 85 90 9525415DNAArtificial SequenceOligonucleotide 254cacagtgcac agggt 1525516DNAArtificial SequenceOligonucleotide 255tgatctcgag agaatg 1625621DNAArtificial SequenceOligonucleotide 256gttagctcac tcattaggca c 2125721DNAArtificial SequenceOligonucleotide 257gtaccgtaac actgagtttc g 2125818DNAArtificial SequenceOligonucleotide 258ttacacttta tgcttccg 1825931PRTArtificial SequencePeptibodies capable of binding to Ang-2 259Met Xaa Gly Gly Gly Gly Gly Ala Gln Pro Ile Arg Gln Glu Glu Cys1 5 10 15Asp Trp Asp Pro Trp Thr Cys Glu His Met Trp Glu Val Leu Glu 20 25 3026031PRTArtificial SequencePeptibodies capable of binding to Ang-2 260Met Xaa Gly Gly Gly Gly Gly Ala Gln Thr Asn Ile Gln Glu Glu Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Asp His Met Pro Gly Lys Leu Glu 20 25 3026131PRTArtificial SequencePeptibodies capable of binding to Ang-2 261Met Xaa Gly Gly Gly Gly Gly Ala Gln Trp Tyr Glu Gln Asp Ala Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Glu His Met Ala Glu Val Leu Glu 20 25 3026231PRTArtificial SequencePeptibodies capable of binding to Ang-2 262Met Xaa Gly Gly Gly Gly Gly Ala Gln Asn Arg Leu Gln Glu Val Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Glu His Met Glu Asn Val Leu Glu 20 25 3026331PRTArtificial SequencePeptibodies capable of binding to Ang-2 263Met Xaa Gly Gly Gly Gly Gly Ala Gln Ala Ala Thr Gln Glu Glu Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Glu His Met Pro Arg Ser Leu Glu 20 25 3026431PRTArtificial SequencePeptibodies capable of binding to Ang-2 264Met Xaa Gly Gly Gly Gly Gly Ala Gln Leu Arg His Gln Glu Gly Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Glu His Met Phe Asp Trp Leu Glu 20 25 3026531PRTArtificial SequencePeptibodies capable of binding to Ang-2 265Met Xaa Gly Gly Gly Gly Gly Ala Gln Val Pro Arg Gln Lys Asp Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Glu His Met Tyr Val Gly Leu Glu 20 25 3026631PRTArtificial SequencePeptibodies capable of binding to Ang-2 266Met Xaa Gly Gly Gly Gly Gly Ala Gln Ser Ile Ser His Glu Glu Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Glu His Met Gln Val Gly Leu Glu 20 25 3026731PRTArtificial SequencePeptibodies capable of binding to Ang-2 267Met Xaa Gly Gly Gly Gly Gly Ala Gln Trp Ala Ala Gln Glu Glu Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Glu His Met Gly Arg Met Leu Glu 20 25 3026831PRTArtificial SequencePeptibodies capable of binding to Ang-2 268Met Xaa Gly Gly Gly Gly Gly Ala Gln Thr Trp Pro Gln Asp Lys Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Glu His Met Gly Ser Thr Leu Glu 20 25 3026931PRTArtificial SequencePeptibodies capable of binding to Ang-2 269Met Xaa Gly Gly Gly Gly Gly Ala Gln Gly His Ser Gln Glu Glu Cys1 5 10 15Gly Trp Asp Pro Trp Thr Cys Glu His Met Gly Thr Ser Leu Glu 20 25 3027031PRTArtificial SequencePeptibodies capable of binding to Ang-2 270Met Xaa Gly Gly Gly Gly Gly Ala Gln Gln His Trp Gln Glu Glu Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Asp His Met Pro Ser Lys Leu Glu 20 25 3027131PRTArtificial SequencePeptibodies capable of binding to Ang-2 271Met Xaa Gly Gly Gly Gly Gly Ala Gln Asn Val Arg Gln Glu Lys Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Glu His Met Pro Val Arg Leu Glu 20 25 3027231PRTArtificial SequencePeptibodies capable of binding to Ang-2 272Met Xaa Gly Gly Gly Gly Gly Ala Gln Lys Ser Gly Gln Val Glu Cys1 5 10 15Asn Trp Asp Pro Trp Thr Cys Glu His Met Pro Arg Asn Leu Glu 20 25 3027331PRTArtificial SequencePeptibodies capable of binding to Ang-2 273Met Xaa Gly Gly Gly Gly Gly Ala Gln Val Lys Thr Gln Glu His Cys1 5 10 15Asp Trp Asp Pro Trp Thr Cys Glu His Met Arg Glu Trp Leu Glu 20 25 3027431PRTArtificial SequencePeptibodies capable of binding to Ang-2 274Met Xaa Gly Gly Gly Gly Gly Ala Gln Ala Trp Gly Gln Glu Gly Cys1 5 10 15Asp Trp Asp Pro Trp Thr Cys Glu His Met Leu Pro Met Leu Glu 20 25 3027531PRTArtificial SequencePeptibodies capable of binding to Ang-2 275Met Xaa Gly Gly Gly Gly Gly Ala Gln Pro Val Asn Gln Glu Asp Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Glu His Met Pro Pro Met Leu Glu 20 25 3027631PRTArtificial SequencePeptibodies capable of binding to Ang-2 276Met Xaa Gly Gly Gly Gly Gly Ala Gln Arg Ala Pro Gln Glu Asp Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Ala His Met Asp Ile Lys Leu Glu 20 25 3027731PRTArtificial SequencePeptibodies capable of binding to Ang-2 277Met Xaa Gly Gly Gly Gly Gly Ala Gln His Gly Gln Asn Met Glu Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Glu His Met Phe Arg Tyr Leu Glu 20 25 3027831PRTArtificial SequencePeptibodies capable of binding to Ang-2 278Met Xaa Gly Gly Gly Gly Gly Ala Gln Pro Arg Leu Gln Glu Glu Cys1 5 10 15Val Trp Asp Pro Trp Thr Cys Glu His Met Pro Leu Arg Leu Glu 20 25 3027931PRTArtificial SequencePeptibodies capable of binding to Ang-2 279Met Xaa Gly Gly Gly Gly Gly Ala Gln Arg Thr Thr Gln Glu Lys Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Glu His Met Glu Ser Gln Leu Glu 20 25 3028031PRTArtificial SequencePeptibodies capable of binding to Ang-2 280Met Xaa Gly Gly Gly Gly Gly Ala Gln Gln Thr Ser Gln Glu Asp Cys1 5 10 15Val Trp Asp Pro Trp Thr Cys Asp His Met Val Ser Ser Leu Glu 20 25 3028131PRTArtificial SequencePeptibodies capable of binding to Ang-2 281Met Xaa Gly Gly Gly Gly Gly Ala Gln Gln Val Ile Gly Arg Pro Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Glu His Leu Glu Gly Leu Leu Glu 20 25 3028231PRTArtificial SequencePeptibodies capable of binding to Ang-2 282Met Xaa Gly Gly Gly Gly Gly Ala Gln Trp Ala Gln Gln Glu Glu Cys1 5 10 15Ala Trp Asp Pro Trp Thr Cys Asp His Met Val Gly Leu Leu Glu 20 25 3028331PRTArtificial SequencePeptibodies capable of binding to Ang-2 283Met Xaa Gly Gly Gly Gly Gly Ala Gln Leu Pro Gly Gln Glu Asp Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Glu His Met Val Arg Ser Leu Glu 20 25 3028431PRTArtificial SequencePeptibodies capable of binding to Ang-2 284Met Xaa Gly Gly Gly Gly Gly Ala Gln Pro Met Asn Gln Val Glu Cys1 5 10 15Asp Trp Asp Pro Trp Thr Cys Glu His Met Pro Arg Ser Leu Glu 20 25 3028531PRTArtificial SequencePeptibodies capable of binding to Ang-2 285Met Xaa Gly Gly Gly Gly Gly Ala Gln Phe Gly Trp Ser His Gly Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Glu His Met Gly Ser Thr Leu Glu 20 25 3028631PRTArtificial SequencePeptibodies capable of binding to Ang-2 286Met Xaa Gly Gly Gly Gly Gly Ala Gln Lys Ser Thr Gln Asp Asp Cys1 5 10 15Asp Trp Asp Pro Trp Thr Cys Glu His Met Val Gly Pro Leu Glu 20 25 3028731PRTArtificial SequencePeptibodies capable of binding to Ang-2 287Met Xaa Gly Gly Gly Gly Gly Ala Gln Gly Pro Arg Ile Ser Thr Cys1 5 10 15Gln Trp Asp Pro Trp Thr Cys Glu His Met Asp Gln Leu Leu Glu 20 25 3028831PRTArtificial SequencePeptibodies capable of binding to Ang-2 288Met Xaa Gly Gly Gly Gly Gly Ala Gln Ser Thr Ile Gly Asp Met Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Ala His Met Gln Val Asp Leu Glu 20 25 3028931PRTArtificial SequencePeptibodies capable of binding to Ang-2 289Met Xaa Gly Gly Gly Gly Gly Ala Gln Val Leu Gly Gly Gln Gly Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Arg Leu Leu Gln Gly Trp Leu Glu 20 25 3029031PRTArtificial SequencePeptibodies capable of binding to Ang-2 290Met Xaa Gly Gly Gly Gly Gly Ala Gln Val Leu Gly Gly Gln Gly Cys1 5 10 15Gln Trp Asp Pro Trp Thr Cys Ser His Leu Glu Asp Gly Leu Glu 20 25 3029131PRTArtificial SequencePeptibodies capable of binding to Ang-2 291Met Xaa Gly Gly Gly Gly Gly Ala Gln Thr Thr Ile Gly Ser Met Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Ala His Met Gln Gly Gly Leu Glu 20 25 3029231PRTArtificial SequencePeptibodies capable of binding to Ang-2 292Met Xaa Gly Gly Gly Gly Gly Ala Gln Thr Lys Gly Lys Ser Val Cys1 5 10 15Gln Trp Asp Pro Trp Thr Cys Ser His Met Gln Ser Gly Leu Glu 20 25 3029331PRTArtificial SequencePeptibodies capable of binding to Ang-2 293Met Xaa Gly Gly Gly Gly Gly Ala Gln Thr Thr Ile Gly Ser Met Cys1 5 10 15Gln Trp Asp Pro Trp Thr Cys Ala His Met Gln Gly Gly Leu Glu 20 25 3029431PRTArtificial SequencePeptibodies capable of binding to Ang-2 294Met Xaa Gly Gly Gly Gly Gly Ala Gln Trp Val Asn Glu Val Val Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Asn His Trp Asp Thr Pro Leu Glu 20 25 3029531PRTArtificial SequencePeptibodies capable of binding to Ang-2 295Met Xaa Gly Gly Gly Gly Gly Ala Gln Val Val Gln Val Gly Met Cys1 5 10 15Gln Trp Asp Pro Trp Thr Cys Lys His Met Arg Leu Gln Leu Glu 20 25 3029631PRTArtificial SequencePeptibodies capable of binding to Ang-2 296Met Xaa Gly Gly Gly Gly Gly Ala Gln Ala Val Gly Ser Gln Thr Cys1 5

10 15Glu Trp Asp Pro Trp Thr Cys Ala His Leu Val Glu Val Leu Glu 20 25 3029731PRTArtificial SequencePeptibodies capable of binding to Ang-2 297Met Xaa Gly Gly Gly Gly Gly Ala Gln Gln Gly Met Lys Met Phe Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Ala His Ile Val Tyr Arg Leu Glu 20 25 3029831PRTArtificial SequencePeptibodies capable of binding to Ang-2 298Met Xaa Gly Gly Gly Gly Gly Ala Gln Thr Thr Ile Gly Ser Met Cys1 5 10 15Gln Trp Asp Pro Trp Thr Cys Glu His Met Gln Gly Gly Leu Glu 20 25 3029931PRTArtificial SequencePeptibodies capable of binding to Ang-2 299Met Xaa Gly Gly Gly Gly Gly Ala Gln Thr Ser Gln Arg Val Gly Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Gln His Leu Thr Tyr Thr Leu Glu 20 25 3030031PRTArtificial SequencePeptibodies capable of binding to Ang-2 300Met Xaa Gly Gly Gly Gly Gly Ala Gln Gln Trp Ser Trp Pro Pro Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Gln Thr Val Trp Pro Ser Leu Glu 20 25 3030131PRTArtificial SequencePeptibodies capable of binding to Ang-2 301Met Xaa Gly Gly Gly Gly Gly Ala Gln Gly Thr Ser Pro Ser Phe Cys1 5 10 15Gln Trp Asp Pro Trp Thr Cys Ser His Met Val Gln Gly Leu Glu 20 25 3030231PRTArtificial SequencePeptibodies capable of binding to Ang-2 302Met Xaa Gly Gly Gly Gly Gly Ala Gln Thr Gln Gly Leu His Gln Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Lys Val Leu Trp Pro Ser Leu Glu 20 25 3030331PRTArtificial SequencePeptibodies capable of binding to Ang-2 303Met Xaa Gly Gly Gly Gly Gly Ala Gln Val Trp Arg Ser Gln Val Cys1 5 10 15Gln Trp Asp Pro Trp Thr Cys Asn Leu Gly Gly Asp Trp Leu Glu 20 25 3030431PRTArtificial SequencePeptibodies capable of binding to Ang-2 304Met Xaa Gly Gly Gly Gly Gly Ala Gln Asp Lys Ile Leu Glu Glu Cys1 5 10 15Gln Trp Asp Pro Trp Thr Cys Gln Phe Phe Tyr Gly Ala Leu Glu 20 25 3030531PRTArtificial SequencePeptibodies capable of binding to Ang-2 305Met Xaa Gly Gly Gly Gly Gly Ala Gln Ala Thr Phe Ala Arg Gln Cys1 5 10 15Gln Trp Asp Pro Trp Thr Cys Ala Leu Gly Gly Asn Trp Leu Glu 20 25 3030631PRTArtificial SequencePeptibodies capable of binding to Ang-2 306Met Xaa Gly Gly Gly Gly Gly Ala Gln Gly Pro Ala Gln Glu Glu Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Glu Pro Leu Pro Leu Met Leu Glu 20 25 3030731PRTArtificial SequencePeptibodies capable of binding to Ang-2 307Met Xaa Gly Gly Gly Gly Gly Ala Gln Arg Pro Glu Asp Met Cys Ser1 5 10 15Gln Trp Asp Pro Trp Thr Trp His Leu Gln Gly Tyr Cys Leu Glu 20 25 3030831PRTArtificial SequencePeptibodies capable of binding to Ang-2 308Met Xaa Gly Gly Gly Gly Gly Ala Gln Leu Trp Gln Leu Ala Val Cys1 5 10 15Gln Trp Asp Pro Gln Thr Cys Asp His Met Gly Ala Leu Leu Glu 20 25 3030931PRTArtificial SequencePeptibodies capable of binding to Ang-2 309Met Xaa Gly Gly Gly Gly Gly Ala Gln Thr Gln Leu Val Ser Leu Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Arg Leu Leu Asp Gly Trp Leu Glu 20 25 3031031PRTArtificial SequencePeptibodies capable of binding to Ang-2 310Met Xaa Gly Gly Gly Gly Gly Ala Gln Met Gly Gly Ala Gly Arg Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Gln Leu Leu Gln Gly Trp Leu Glu 20 25 3031131PRTArtificial SequencePeptibodies capable of binding to Ang-2 311Met Xaa Gly Gly Gly Gly Gly Ala Gln Met Phe Leu Pro Asn Glu Cys1 5 10 15Gln Trp Asp Pro Trp Thr Cys Ser Asn Leu Pro Glu Ala Leu Glu 20 25 3031231PRTArtificial SequencePeptibodies capable of binding to Ang-2 312Met Xaa Gly Gly Gly Gly Gly Ala Gln Phe Gly Trp Ser His Gly Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Arg Leu Leu Gln Gly Trp Leu Glu 20 25 3031331PRTArtificial SequencePeptibodies capable of binding to Ang-2 313Met Xaa Gly Gly Gly Gly Gly Ala Gln Trp Pro Gln Thr Glu Gly Cys1 5 10 15Gln Trp Asp Pro Trp Thr Cys Arg Leu Leu His Gly Trp Leu Glu 20 25 3031431PRTArtificial SequencePeptibodies capable of binding to Ang-2 314Met Xaa Gly Gly Gly Gly Gly Ala Gln Pro Asp Thr Arg Gln Gly Cys1 5 10 15Gln Trp Asp Pro Trp Thr Cys Arg Leu Tyr Gly Met Trp Leu Glu 20 25 3031531PRTArtificial SequencePeptibodies capable of binding to Ang-2 315Met Xaa Gly Gly Gly Gly Gly Ala Gln Thr Trp Pro Gln Asp Lys Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Arg Leu Leu Gln Gly Trp Leu Glu 20 25 3031631PRTArtificial SequencePeptibodies capable of binding to Ang-2 316Met Xaa Gly Gly Gly Gly Gly Ala Gln Asp Lys Ile Leu Glu Glu Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Arg Leu Leu Gln Gly Trp Leu Glu 20 25 3031731PRTArtificial SequencePeptibodies capable of binding to Ang-2 317Met Xaa Gly Gly Gly Gly Gly Ala Gln Ala Ala Thr Gln Glu Glu Cys1 5 10 15Glu Trp Asp Pro Trp Thr Cys Arg Leu Leu Gln Gly Trp Leu Glu 20 25 3031834PRTArtificial SequencePeptibodies capable of binding to Ang-2 318Met Gly Ala Gln Thr Asn Phe Met Pro Met Asp Asp Leu Glu Gln Arg1 5 10 15Leu Tyr Glu Gln Phe Ile Leu Gln Gln Gly Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa31934PRTArtificial SequencePeptibodies capable of binding to Ang-2 319Met Gly Ala Gln Thr Asn Tyr Lys Pro Leu Asp Glu Leu Asp Ala Thr1 5 10 15Leu Tyr Glu His Trp Ile Leu Gln His Ser Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa32034PRTArtificial SequencePeptibodies capable of binding to Ang-2 320Met Gly Ala Gln Gln Lys Tyr Gln Pro Leu Asp Glu Leu Asp Lys Thr1 5 10 15Leu Tyr Asp Gln Phe Met Leu Gln Gln Gly Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa32134PRTArtificial SequencePeptibodies capable of binding to Ang-2 321Met Gly Ala Gln Leu Asn Phe Thr Pro Leu Asp Glu Leu Glu Gln Thr1 5 10 15Leu Tyr Glu Gln Trp Thr Leu Gln Gln Ser Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa32234PRTArtificial SequencePeptibodies capable of binding to Ang-2 322Met Gly Ala Gln Gln Lys Phe Gln Pro Leu Asp Glu Leu Glu Gln Thr1 5 10 15Leu Tyr Glu Gln Phe Met Leu Gln Gln Ala Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa32334PRTArtificial SequencePeptibodies capable of binding to Ang-2 323Met Gly Ala Gln Gln Glu Tyr Glu Pro Leu Asp Glu Leu Asp Glu Thr1 5 10 15Leu Tyr Asn Gln Trp Met Phe His Gln Arg Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa32434PRTArtificial SequencePeptibodies capable of binding to Ang-2 324Met Gly Ala Gln Val Lys Tyr Lys Pro Leu Asp Glu Leu Asp Glu Ile1 5 10 15Leu Tyr Glu Gln Gln Thr Phe Gln Glu Arg Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa32534PRTArtificial SequencePeptibodies capable of binding to Ang-2 325Met Gly Ala Gln Thr Lys Phe Gln Pro Leu Asp Glu Leu Asp Gln Thr1 5 10 15Leu Tyr Glu Gln Trp Thr Leu Gln Gln Arg Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa32634PRTArtificial SequencePeptibodies capable of binding to Ang-2 326Met Gly Ala Gln Thr Asn Phe Gln Pro Leu Asp Glu Leu Asp Gln Thr1 5 10 15Leu Tyr Glu Gln Trp Thr Leu Gln Gln Arg Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa32734PRTArtificial SequencePeptibodies capable of binding to Ang-2 327Met Gly Ala Gln Gln Asn Phe Lys Pro Met Asp Glu Leu Glu Asp Thr1 5 10 15Leu Tyr Lys Gln Phe Leu Phe Gln His Ser Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa32834PRTArtificial SequencePeptibodies capable of binding to Ang-2 328Met Gly Ala Gln Val Lys Tyr Lys Pro Leu Asp Glu Leu Asp Glu Trp1 5 10 15Leu Tyr His Gln Phe Thr Leu His His Gln Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa32934PRTArtificial SequencePeptibodies capable of binding to Ang-2 329Met Gly Ala Gln Tyr Lys Phe Thr Pro Leu Asp Asp Leu Glu Gln Thr1 5 10 15Leu Tyr Glu Gln Trp Thr Leu Gln His Val Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa33034PRTArtificial SequencePeptibodies capable of binding to Ang-2 330Met Gly Ala Gln Gln Asn Tyr Lys Pro Leu Asp Glu Leu Asp Ala Thr1 5 10 15Leu Tyr Glu His Phe Ile Phe His Tyr Thr Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa33134PRTArtificial SequencePeptibodies capable of binding to Ang-2 331Met Gly Ala Gln Val Lys Phe Lys Pro Leu Asp Ala Leu Glu Gln Thr1 5 10 15Leu Tyr Glu His Trp Met Phe Gln Gln Ala Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa33234PRTArtificial SequencePeptibodies capable of binding to Ang-2 332Met Gly Ala Gln Glu Asp Tyr Met Pro Leu Asp Ala Leu Asp Ala Gln1 5 10 15Leu Tyr Glu Gln Phe Ile Leu Leu His Gly Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa33334PRTArtificial SequencePeptibodies capable of binding to Ang-2 333Met Gly Ala Gln Tyr Lys Phe Asn Pro Met Asp Glu Leu Glu Gln Thr1 5 10 15Leu Tyr Glu Glu Phe Leu Phe Gln His Ala Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa33434PRTArtificial SequencePeptibodies capable of binding to Ang-2 334Met Gly Ala Gln Ser Asn Phe Met Pro Leu Asp Glu Leu Glu Gln Thr1 5 10 15Leu Tyr Glu Gln Phe Met Leu Gln His Gln Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa33534PRTArtificial SequencePeptibodies capable of binding to Ang-2 335Met Gly Ala Gln Gln Lys Phe Gln Pro Leu Asp Glu Leu Glu Glu Thr1 5 10 15Leu Tyr Lys Gln Trp Thr Leu Gln Gln Arg Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa33634PRTArtificial SequencePeptibodies capable of binding to Ang-2 336Met Gly Ala Gln Gln Lys Phe Met Pro Leu Asp Glu Leu Asp Glu Ile1 5 10 15Leu Tyr Glu Gln Phe Met Phe Gln Gln Ser Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa33734PRTArtificial SequencePeptibodies capable of binding to Ang-2 337Met Gly Ala Gln Thr Lys Phe Asn Pro Leu Asp Glu Leu Glu Gln Thr1 5 10 15Leu Tyr Glu Gln Trp Thr Leu Gln His Gln Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa33834PRTArtificial SequencePeptibodies capable of binding to Ang-2 338Met Gly Ala Gln His Thr Phe Gln Pro Leu Asp Glu Leu Glu Glu Thr1 5 10 15Leu Tyr Tyr Gln Trp Leu Tyr Asp Gln Leu Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa33934PRTArtificial SequencePeptibodies capable of binding to Ang-2 339Met Gly Ala Gln Gln Lys Phe Lys Pro Leu Asp Glu Leu Glu Gln Thr1 5 10 15Leu Tyr Glu Gln Trp Thr Leu Gln Gln Arg Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa34034PRTArtificial SequencePeptibodies capable of binding to Ang-2 340Met Gly Ala Gln Gln Thr Phe Gln Pro Leu Asp Asp Leu Glu Glu Tyr1 5 10 15Leu Tyr Glu Gln Trp Ile Arg Arg Tyr His Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa34134PRTArtificial SequencePeptibodies capable of binding to Ang-2 341Met Gly Ala Gln Ser Lys Phe Lys Pro Leu Asp Glu Leu Glu Gln Thr1 5 10 15Leu Tyr Glu Gln Trp Thr Leu Gln His Ala Leu Glu Gly Gly Gly Gly 20 25 30Gly Xaa34231PRTArtificial SequencePeptibodies capable of binding to Ang-2 342Met Xaa Gly Gly Gly Gly Gly Ala Gln Ser Gly Gln Leu Arg Pro Cys1 5 10 15Glu Glu Ile Phe Gly Cys Gly Thr Gln Asn Leu Ala Leu Leu Glu 20 25 3034331PRTArtificial SequencePeptibodies capable of binding to Ang-2 343Met Xaa Gly Gly Gly Gly Gly Ala Gln Ala Gly Gly Met Arg Pro Tyr1 5 10 15Asp Gly Met Leu Gly Trp Pro Asn Tyr Asp Val Gln Ala Leu Glu 20 25 3034431PRTArtificial SequencePeptibodies capable of binding to Ang-2 344Met Xaa Gly Gly Gly Gly Gly Ala Gln Gly Gln Asp Leu Arg Pro Cys1 5 10 15Glu Asp Met Phe Gly Cys Gly Thr Lys Asp Trp Tyr Gly Leu Glu 20 25 3034531PRTArtificial SequencePeptibodies capable of binding to Ang-2 345Met Xaa Gly Gly Gly Gly Gly Ala Gln Ala Pro Gly Gln Arg Pro Tyr1 5 10 15Asp Gly Met Leu Gly Trp Pro Thr Tyr Gln Arg Ile Val Leu Glu 20 25 3034631PRTArtificial SequencePeptibodies capable of binding to Ang-2 346Met Xaa Gly Gly Gly Gly Gly Ala Gln Gln Thr Trp Asp Asp Pro Cys1 5 10 15Met His Ile Leu Gly Pro Val Thr Trp Arg Arg Cys Ile Leu Glu 20 25 3034731PRTArtificial SequencePeptibodies capable of binding to Ang-2 347Met Xaa Gly Gly Gly Gly Gly Ala Gln Phe Gly Asp Lys Arg Pro Leu1 5 10 15Glu Cys Met Phe Gly Gly Pro Ile Gln Leu Cys Pro Arg Leu Glu 20 25 3034825PRTArtificial SequencePeptibodies capable of binding to Ang-2 348Met Xaa Gly Gly Gly Gly Gly Ala Gln Lys Arg Pro Cys Glu Glu Ile1 5 10 15Phe Gly Gly Cys Thr Tyr Gln Leu Glu 20 2534931PRTArtificial SequencePeptibodies capable of binding to Ang-2 349Met Xaa Gly Gly Gly Gly Gly Ala Gln Leu Gln Glu Trp Cys Glu Gly1 5 10 15Val Glu Asp Pro Phe Thr Phe Gly Cys Glu Lys Gln Arg Leu Glu 20 25 3035031PRTArtificial SequencePeptibodies capable of binding to Ang-2 350Met Xaa Gly Gly Gly Gly Gly Ala Gln Met Leu Asp Tyr Cys Glu Gly1 5 10 15Met Asp Asp Pro Phe Thr Phe Gly Cys Asp Lys Gln Met Leu Glu 20 25 3035131PRTArtificial SequencePeptibodies capable of binding to Ang-2 351Met Xaa Gly Gly Gly Gly Gly Ala Gln His Gln Glu Tyr Cys Glu Gly1 5 10 15Met Glu Asp Pro Phe Thr Phe Gly Cys Glu Tyr Gln Gly Leu Glu 20 25 3035231PRTArtificial SequencePeptibodies capable of binding to Ang-2 352Met Xaa Gly Gly Gly Gly Gly Ala Gln Leu Gln Asp Tyr Cys Glu Gly1 5 10 15Val Glu Asp Pro Phe Thr Phe Gly Cys Glu Asn Gln Arg Leu Glu 20 25 3035331PRTArtificial SequencePeptibodies capable of binding to Ang-2 353Met Xaa Gly Gly Gly Gly Gly Ala Gln Leu Leu Asp Tyr Cys Glu Gly1 5 10 15Val Gln Asp Pro Phe Thr Phe Gly Cys Glu Asn Leu Asp Leu Glu 20 25 3035431PRTArtificial SequencePeptibodies capable of binding to Ang-2 354Met Xaa Gly Gly Gly Gly Gly Ala Gln Gly Phe Glu Tyr Cys Asp Gly1 5 10 15Met Glu Asp Pro Phe Thr Phe Gly Cys Asp Lys Gln Thr Leu Glu 20

25 3035531PRTArtificial SequencePeptibodies capable of binding to Ang-2 355Met Xaa Gly Gly Gly Gly Gly Ala Gln Ala Gln Asp Tyr Cys Glu Gly1 5 10 15Met Glu Asp Pro Phe Thr Phe Gly Cys Glu Met Gln Lys Leu Glu 20 25 3035631PRTArtificial SequencePeptibodies capable of binding to Ang-2 356Met Xaa Gly Gly Gly Gly Gly Ala Gln Leu Gln Asp Tyr Cys Glu Gly1 5 10 15Val Glu Asp Pro Phe Thr Phe Gly Cys Glu Lys Gln Arg Leu Glu 20 25 3035731PRTArtificial SequencePeptibodies capable of binding to Ang-2 357Met Xaa Gly Gly Gly Gly Gly Ala Gln Lys Leu Glu Tyr Cys Asp Gly1 5 10 15Met Glu Asp Pro Phe Thr Gln Gly Cys Asp Asn Gln Ser Leu Glu 20 25 3035829PRTArtificial SequencePeptibodies capable of binding to Ang-2 358Met Xaa Gly Gly Gly Gly Gly Ala Gln Phe Asp Tyr Cys Glu Gly Val1 5 10 15Glu Asp Pro Phe Thr Phe Gly Cys Asp Asn His Leu Glu 20 2535932PRTArtificial SequencePolypeptide capable of binding to Ang-2 359Cys Gly Gly Gly Gly Gly Ala Gln Thr Asn Phe Met Pro Met Asp Asp1 5 10 15Leu Glu Gln Arg Leu Tyr Glu Gln Phe Ile Leu Gln Gln Gly Leu Glu 20 25 30

Claims

1-117. (canceled)

118. A polypeptide that specifically binds to Ang2, said polypeptide comprising an amino acid sequence of SEQ ID NO: 4 with at least one of: up to 2 amino acid substitutions, up to 1 deletion, or up to 1 insertion therein, wherein said polypeptide has at least one substitution, insertion or deletion,and physiologically acceptable salts thereof.

119. A polypeptide according to claim 118, wherein said polypeptide comprises an amino acid sequence of SEQ ID NO: 4 with 1 or 2 amino acid substitutions therein.

120. A polypeptide according to claim 118, wherein said polypeptide comprises an amino acid sequence of SEQ ID NO: 4 with 1 or 2 conservative amino acid substitutions therein.

121. A polypeptide according to claim 118, wherein said polypeptide comprises an amino acid sequence of SEQ ID NO: 4, with 1 conservative amino acid substitution therein.

122. A polypeptide according to claim 118, wherein said polypeptide comprises an amino acid sequence of SEQ ID NO: 4 with 1 deletion therein.

123. A polypeptide according to claim 118, wherein said polypeptide comprises an amino acid sequence of SEQ ID NO: 4 with 1 insertion therein.

124. A polynucleotide encoding a polypeptide according to claim 118.

125. The polynucleotide according to claim 124, wherein the polypeptide is encoded as set forth in SEQ ID NO: 46.

126. An expression vector comprising the polynucleotide of claims 124.

127. A host cell comprising the expression vector of claim 126.

128. The host cell according to claim 127 wherein the cell is an E. coli cell.

129. A method of inhibiting angiogenesis in a mammal comprising administering a therapeutically effective amount of the polypeptide according to claim 118.

130. A method of inhibiting tumor growth characterized by undesired angiogenesis in a mammal comprising administering a therapeutically effective amount of the polypeptide according to claim 118.

131. A method of treating cancer in a mammal comprising administering a therapeutically effective amount of the polypeptide according to claim 118 and a chemotherapeutic agent.

132. A polypeptide that specifically binds to Ang-2, said polypeptide comprising the amino acid sequence of SEQ ID NO: 25 with at least one of up to 4 amino acid substitutions, up to 1 insertion or up to 1 deletion therein, wherein said polypeptide has at least one substitution, insertion or deletion,and physiologically acceptable salts thereof.

133. A polypeptide according to claim 132, wherein said polypeptide comprises an amino acid sequence of SEQ ID NO: 25 with 1 or 2 amino acid substitutions or 1 deletion or 1 insertion therein.

134. A polypeptide according to claim 132, wherein said polypeptide comprises an amino acid sequence of SEQ ID NO: 25 with 1 or 2 amino acid substitutions therein.

135. A polypeptide according to claim 132, wherein said polypeptide comprises an amino acid sequence of SEQ ID NO: 25 with 1 or 2 conservative amino acid substitutions therein.

136. A polypeptide according to claim 132, wherein said polypeptide comprises an amino acid sequence of SEQ ID NO: 25 with 1 conservative amino acid substitution therein.

137. A polypeptide according to claim 132, wherein said polypeptide comprises an amino acid sequence of SEQ ID NO: 25 with 1 deletion therein.

138. A polypeptide according to claim 132, wherein said polypeptide comprises an amino acid sequence of SEQ ID NO: 25 with 1 insertion therein.

139. The polypeptide according to claim 132, wherein the Fc in SEQ ID NO: 25 is the Fc of a human IgG1.

140. The polypeptide according to claim 139, wherein the amino acid sequence of the Fc in SEQ ID NO: 25 is SEQ ID NO: 60.

141. A method of inhibiting angiogenesis in a mammal comprising administering a therapeutically effective amount of the polypeptide according to claim 133.

142. A method of inhibiting tumor growth characterized by undesired angiogenesis in a mammal comprising administering a therapeutically effective amount of the polypeptide according to claim 133.

143. A method of treating cancer in a mammal comprising administering a therapeutically effective amount of the polypeptide according to claim 133 and a chemotherapeutic agent.