Patent application title: SOMATIC HYPERMUTATION SYSTEMS
Inventors:
Robert A. Horlick (San Diego, CA, US)
Robert A. Horlick (San Diego, CA, US)
Andrew B. Cubitt (San Diego, CA, US)
Andrew B. Cubitt (San Diego, CA, US)
Peter M. Bowers (Encinitas, CA, US)
Assignees:
AnaptysBio, Inc.
IPC8 Class: AC12P2100FI
USPC Class:
435 694
Class name: Micro-organism, tissue cell culture or enzyme using process to synthesize a desired chemical compound or composition recombinant dna technique included in method of making a protein or polypeptide hormones and fragments thereof
Publication date: 2012-02-02
Patent application number: 20120028301
Abstract:
The present application relates to somatic hypermutation (SHM) systems
and synthetic genes. Synthetic genes can be designed using computer-based
approaches to increase or decrease susceptibility of a polynucleotide to
somatic hypermutation. Genes of interest are inserted into the vectors
and subjected to activation-induced cytidine deaminase to induce somatic
hypermutation. Proteins or portions thereof encoded by the modified genes
can be introduced into a SHM system for somatic hypermutation and
proteins or portions thereof exhibiting a desired phenotype or function
can be isolated for in vitro or in vivo diagnostic or therapeutic uses.Claims:
1.-31. (canceled)
32. A method for preparing a gene product having a desired property, comprising: a) expressing in a population of cells at least one somatic hypermutation (SHM) resistant synthetic gene encoding a gene product, wherein one or more first SHM motifs in an unmodified polynucleotide sequence encoding an unmodified gene product has been replaced by one or more second SHM motifs having a lower probability of SHM, the synthetic gene having a greater density of cold spots and/or a lower density of hot spots than the unmodified polynucleotide sequence, and wherein the population of cells express AID activity, or can be induced to express AID activity via the addition of an inducing agent; and b) selecting a cell or cells within the population of cells which express a modified gene product having the desired property.
33. The method of claim 32, optionally further comprising activating or inducing the expression of AID activity in the population of cells.
34. The method of claim 32, further comprising establishing one or more clonal populations of cells from the cell or cells identified in (b).
35. The method of claim 32, wherein the at least one SHM resistant synthetic gene encodes an enzyme involved in SHM, a synthetic selectable marker gene, or a synthetic reporter gene.
36. The method of claim 32, wherein the population of cells further comprises a gene product encoded by a SHM susceptible synthetic gene, wherein one or more first SHM motifs in an unmodified polynucleotide sequence encoding an unmodified gene product has been replaced by one or more second SHM motifs having a higher probability of SHM, the synthetic gene having a greater density of hot spot motifs and/or a lower density of cold spots than the unmodified polynucleotide sequence.
37. A method for preparing a gene product having a desired property, comprising: a) preparing a somatic hypermutation (SHM) susceptible synthetic gene encoding a gene product, wherein one or more first SHM motifs in an unmodified polynucleotide sequence encoding an unmodified gene product has been replaced by one or more second SHM motifs having a higher probability of SHM, the synthetic gene having a greater density of hot spot motifs and/or a lower density of cold spots than the unmodified polynucleotide sequence, b) expressing the SHM susceptible synthetic gene in a population of cells; wherein the population of cells expresses AID activity, or can be induced to express AID activity via the addition of an inducing agent; and c) selecting a cell or cells within the population of cells which express a modified gene product having the desired property.
38. The method of claim 37, optionally further comprising activating or inducing the expression of AID activity in the population of cells.
39. The method of claim 37, further comprising establishing one or more clonal populations of cells from the cell or cells identified in (c).
40. The method of claim 37, wherein the SHM susceptible synthetic gene encodes an antibody or antigen-binding fragment thereof, a neurotransmitter, a hormone, a cytokine, a chemokine, an enzyme, a receptor, a toxin, a co-factor, or a transcription factor.
41. The method of claim 37, wherein the population of cells further comprises a gene product encoded by a SHM resistant synthetic gene wherein one or more first SHM motifs in an unmodified polynucleotide sequence encoding an unmodified gene product has been replaced by one or more second SHM motifs having a lower probability of SHM, the synthetic gene having a greater density of cold spots and/or a lower density of hot spots than the unmodified polynucleotide sequence.
Description:
CROSS-REFERENCE
[0001] This application claims the benefit of U.S. Provisional Application No. 60/902,414 (Attorney docket no. 33547-705.101), filed Feb. 20, 2007, U.S. Provisional Application No. 60/904,622 (Attorney docket no. 33547-706.101), filed Mar. 1, 2007, U.S. Provisional Application No. 61/020,124 (Attorney docket no. 33547-706.102), filed Jan. 9, 2008, and U.S. Provisional Application No. 60/995,970 (Attorney docket no. 33547-708.101), filed Sep. 28, 2007, each of which applications is incorporated herein by reference in its entirety.
BACKGROUND OF THE INVENTION
[0002] The market for the use of recombinant protein therapeutics has increased steadily for the last quarter century. In 2005, six of the top 20 drugs were proteins, and overall, biopharmaceutical drugs accounted for revenues of approximately $40 billion, of which approximately $17 billion was based on the sales of monoclonal antibodies.
[0003] Monoclonal antibodies represent a distinct class of biotherapeutics with a great deal of promise. The antibody scaffold is well tolerated in the clinic, and glycosylated IgG molecules have favorable pharmacokinetic and pharmacodynamic properties. There is the potential for rapidly selecting new drug candidates that vary little from currently marketed drugs. Issues relating to non-mechanism based toxicity, and the manufacturing and formulation of antibody products are known and consistent across the therapeutic group, which reduces the potential failure rate associated with this class of drug candidates as compared to small molecule therapeutics.
[0004] In contrast to traditional small molecule based approaches, therapeutic antibodies have significant advantages, including the facts that (i) they can be generated and validated quickly; (ii) they exhibit fewer side effects and have improved safety profiles, (iii) they have well understood pharmacokinetic characteristics, and can be optimized to create long half-life products with reduced dosing frequency; iv) they are versatile and exhibit flexibility in drug function; v) scale-up and manufacturing processes are robust and well-understood; vi) they have a proven track record of clinical and regulatory success; and vii) the current regulatory environment makes the introduction of competitive generic, or bioequivalent, antibodies both difficult and costly.
[0005] Even given the success of monoclonal antibodies, the antibody-as-drug modality is continuing to evolve, and subject to inefficiency. Further, intrinsic biological bias within the native immune system often works against the more rapid development of improved therapeutics. These limitations include, i) the long development time for the isolation of biologically active antibodies with affinity constants of therapeutic caliber, ii) the inability to raise antibodies to certain classes of protein targets (intractable targets), and iii) the intrinsic affinity ceiling inherent in immune system based affinity selection.
[0006] Specifically there is a need for methods to more rapidly develop antibodies with improved pharmacokinetics, cross-reactivity, safety profiles and superior dosing regimens. Central to this need is the development of methods that enable the systematic analysis of potential epitopes with a protein, and enable the selective development of antibodies with the desired selectivity profiles.
[0007] There are several existing well-established methods of developing monoclonal antibodies; however, many of these technologies have specific disadvantages that limit their ability to rapidly evolve the best clinical candidates. These technological limitations include: i) mouse immunization and hybridoma technology cannot be used iteratively and often fails to yield an antibody with desired characteristics due to antigen intractability; ii) phage display or panning often fails to yield monoclonal antibodies with affinity constants of therapeutic caliber, and cannot easily be used to select and co-evolve entire heavy and light chains; and iii) rational design strategies often provides an incomplete solution, and are based solely on existing knowledge.
[0008] An approach used includes the use of random or semi-random mutagenesis (for example the use of error prone PCR), in conjunction with in vitro molecular evolution. This approach is based on the creation of random changes in protein structure and the generation of large libraries of mutant polynucleotides that are subsequently screened for improved variants, usually through the expression of the encoded proteins within a living cell. From these libraries, a few improved proteins can be selected for further optimization.
[0009] Such in vitro mutation approaches can be limited by the inability to systematically search a portion of any given sequence, and by the relative difficulty of detecting very rare improvement mutants out of a large number of mutations. This fundamental problem arises because the total number of possible mutants for a reasonably sized protein is large. For example, a 100 amino acid protein has a potential diversity of 20100 different sequences of amino acids, while existing high throughput screening methodologies are, in some cases, limited to a maximum screening capacity of 107-108 samples per week. Additionally, such approaches are relatively inefficient because of redundant codon usage, in which up to around 3100 of the nucleotide sequences possible for a 100 amino acid residue protein actually encode for the same amino acids and protein, (Gustafsson et al. (2004) Codon Bias and heterologous protein expression Trends. Biotech. 22 (7) 346-353).
[0010] A more sophisticated approach uses a mixture of random mutagenesis with recombination between protein domains in order to select for improved proteins (Stemmer Proc. Natl. Acad. Sci. (1994) 91 (22) 10747-51). This approach exploits natural design concepts inherent in protein structures across families of proteins, but again requires significant recombinant DNA manipulation and screening capacity of a large number of sequences to identify rare improvements. Both approaches require extensive follow-up mutagenesis and analysis to understand the significance of each mutation, and to identify the best combination of the many thousands or millions of mutants identified.
SUMMARY OF THE INVENTION
[0011] The present invention is based on the development of a system to design and make or generate SHM susceptible and SHM resistant DNA sequences, within a cell or cell-free, environment. The present invention is further based on the development of a SHM system that is stable over a suitable time period to reproducibly maintain increased and/or decreased rates of SHM without affecting structural portions or polypeptides or structural proteins, transcriptional control regions and selectable markers. The system allows for stable maintenance of a mutagenesis system that provides for high level targeted SHM in a polynucleotide of interest, while sufficiently preventing non-specific mutagenesis of structural proteins, transcriptional control regions and selectable markers.
[0012] In part, the present system is based upon the creation of a more stable version of activation induced cytidine deaminase (AID) that can provide for high level sustained SHM.
[0013] In the present application, in vitro somatic hypermutation (SHM) systems involve the use of in vitro SHM in conjunction with directed evolution and bioinformatic analysis to create integrated systems that include, but are not limited to, optimized, controlled systems for codon design and usage, library design, screening, selection and integrated systems for the data mining. These systems include:
[0014] I. An expression system designed to create SHM susceptible and or SHM resistant DNA sequences, within a cell or cell-free, environment. The system enables the stable maintenance of a mutagenesis system that provides for high level targeted SHM in a polynucleotide of interest, while significantly preventing non-specific mutagenesis of structural proteins, transcriptional control regions and selectable markers.
[0015] II. Polynucleotide libraries that are focused in size and specificity, and are enriched for those functions of interest and are efficient substrates for SHM to seed in situ diversity creation upon exposure to AID.
[0016] III. A process based on computational analysis of protein structure, intra-species and inter-species sequence variation, and the functional analysis of protein activity for selecting optimal epitopes that provide for the selection of antibodies with superior selectivity, cross species reactivity, and blocking activity.
[0017] Provided herein is a method to design polynucleotide sequences to either maximize or minimize the tendency of a polynucleotide to undergo SHM, while at the same time maximizing protein expression, RNA stability, and the presence of conveniently located restriction enzyme sites.
[0018] Also provided herein are synthetic or semi-synthetic versions of a polynucleotide that are optimized to either enhance, or decrease the impact of SHM on the rate of mutagenesis of that polynucleotide compared to its wild type's susceptibility to undergo SHM (i.e., SHM susceptible or SHM resistent).
[0019] SHM susceptible sequences enable the rapid evolution of polynucleotides which are designed based on codon usage to be more susceptible to SHM; optimized polynucleotides can be exposed to AID and expressed as polypeptides. Conversely, SHM resistant sequences enable the rapid evolution of polynucleotides which are designed based on codon usage to be less susceptible (resistant) to SHM; optimized polynucleotides can be exposed to AID and expressed as polypeptides. Modified versions of the encoded polypeptides can be selected for improved function or increased stability and resistance to SHM.
[0020] The system described herein combines the power of rational design with accelerated random mutagenesis and directed evolution.
[0021] Also included in the invention are SHM resistant polynucleotide sequences that enable important conserved domains to be spared from mutagenesis, while simultaneously targeting desired sequences.
[0022] Polynucleotides for which these methods are applicable include any polynucleotide sequence that can be transcribed and a functional activity devised for screening.
[0023] The overall result of the integration of these approaches is an integrated system for creating targeted diversity in situ, and for the automated analysis and selection of proteins with improved traits.
[0024] In certain embodiments, the present invention is based in part on an improved understanding of the context of multiple rounds of SHM within the reading frame of a polynucleotide sequence, and the underlying logic relationships of codon usage patterns.
[0025] Provided herein is a SHM susceptible synthetic gene encoding a protein, or a portion thereof, wherein one or more first SHM motifs in an unmodified polynucleotide sequence encoding said protein or portion thereof has been replaced by one or more second SHM motifs having a higher probability of SHM, wherein said SHM susceptible synthetic gene exhibits a higher rate of activation induced cytidine deaminase (AID)-mediated mutagenesis compared to said unmodified polynucleotide sequence. Preferred hot spot SHM codons or preferred hot spot SHM motifs are for, example, a codon including, but not limited to codons AAC, TAC, TAT, AGT and AGC. Such sequences may be potentially embedded within the context of a larger SHM motif, recruit SHM mediated mutagenesis and generate targeted amino acid diversity at that codon.
[0026] The present invention also contemplates that a SHM susceptible synthetic gene can be created in a step-wise or sequential fashion such that some modifications are made to the gene and then a subsequent round of modification is made to the gene. Such sequential or step-wise modifications are contemplated by the present invention and are one way of carrying out the process and one way of producing the genes claimed herein.
[0027] In one embodiment, the SHM susceptible synthetic gene encodes a protein or portion thereof having about 99%, about 95%, about 90% amino, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, about 55%, about 50%, or any percentage between about 50% and about 100% identity to an unmodified gene.
[0028] In one embodiment, the SHM susceptible synthetic gene exhibits a higher rate of AID-mediated mutagenesis including, but not limited to, 1.05-fold, 1.1-fold, 1.25-fold, 1.5-fold, 2-fold, 5-fold, 10-fold, 50-fold, 100-fold, 200-fold, 500-fold, 1000-fold or more, or any range therebetween.
[0029] In one embodiment, the SHM susceptible synthetic gene exhibits a rate of AID-mediated mutagenesis at a level which is at least about 101%, at least about 105%, at least about 110%, at least about 115%, at least about 120%, at least about 125%, at least about 130%, at least about 135%, at least about 1140%, at least about 145%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 350%, at least about 400%, at least about 450%, at least about 5000%, or higher of that exhibited by an unmodified gene.
[0030] In one embodiment, provided herein is a SHM susceptible gene encoding a protein or a portion thereof wherein one or more first SHM motifs in an unmodified polynucleotide sequence encoding said protein or portion thereof has been replaced by one or more second SHM motifs having a higher probability of SHM, said synthetic gene having a greater density of hot spot motifs than said unmodified polynucleotide sequence.
[0031] In yet another non-limiting aspect, the said synthetic gene includes one or more amino acid mutations that introduce preferred SHM hot spot motifs.
[0032] Provided herein is a SHM resistant synthetic gene encoding a protein, or a portion thereof, wherein one or more first SHM motifs in an unmodified polynucleotide sequence encoding said protein or portion thereof has been replaced by one or more second SHM motifs having a lower probability of SHM, wherein said SHM resistant synthetic gene exhibits a lower rate of AID-mediated mutagenesis compared to said unmodified polynucleotide sequence.
[0033] The present invention also contemplates that a SHM resistant synthetic gene can be created in a step-wise or sequential fashion such that some modifications are made to the gene and then a subsequent round of modification is made to the gene. Such sequential or step-wise modifications are contemplated by the present invention and are one way of carrying out the process and one way of producing the genes claimed herein.
[0034] In one embodiment, the SHM resistant synthetic gene encodes a protein or portion thereof having about 95%, about 90% amino, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, about 55%, about 50%, or any percentage between about 50% and about 100% identity to an unmodified gene.
[0035] In one embodiment, the SHM resistant synthetic gene exhibits a lower rate of AID-mediated mutagenesis including, but not limited to, 1.05-fold, 1.1-fold, 1.2-fold, 1.5-fold, 2-fold, 5-fold, 10-fold, 50-fold, 100-fold, 200-fold, 500-fold, 1000-fold or less, or any range therebetween.
[0036] In one embodiment, the SHM resistant synthetic gene exhibiting a rate of AID-mediated mutagenesis at a level which is less than about 99%, less than about 95%, less than about 90%, less than about 85%, less than about 80%, less than about 75%, less than about 70%, less than about 65%, less than about 60%, less than about 55%, or less than about 50%, of that exhibited by an unmodified gene.
[0037] In another embodiment, provided herein is a SHM resistant synthetic gene encoding a protein or a portion thereof wherein one or more first SHM motifs in an unmodified polynucleotide sequence encoding said protein or portion thereof has been replaced by one or more second SHM motifs having a lower probability of SHM, said synthetic gene having a greater density of cold spots than said unmodified polynucleotide sequence.
[0038] Provided herein is a selectively targeted, SHM optimized synthetic gene encoding a protein, or a portion thereof, wherein one or more first SHM motifs in an unmodified polynucleotide sequence encoding said protein or portion thereof has been replaced by one or more second SHM motifs having a higher probability of SHM; and one or more third SHM motifs in said unmodified polynucleotide sequence encoding said protein or portion thereof has been replaced by one or more fourth SHM motifs having a lower probability of SHM; wherein said selectively targeted, SHM optimized synthetic gene exhibits targeted AID-mediated mutagenesis. In such an embodiment, the selectively targeted, SHM optimized synthetic gene has portions that exhibit a higher rate of MD-mediated mutagenesis and other portions that exhibit a lower rate of AID-mediated mutagenesis.
[0039] In yet another embodiment, provided herein is a selectively targeted, SHM optimized synthetic gene encoding a protein or portion thereof, wherein one or more first SHM motifs in an unmodified polynucleotide sequence encoding said protein or portion thereof has been replaced by one or more second SHM motifs having a higher probability of SHM, said synthetic gene having a greater density of hot spot motifs than said unmodified polynucleotide sequence; and one or more third SHM motifs in said unmodified polynucleotide sequence encoding said protein or portion thereof has been replaced by one or more fourth SHM motifs having a lower probability of SHM, said synthetic gene having a greater density of cold spots than said unmodified polynucleotide sequence; wherein said selectively targeted, SHM optimized synthetic gene exhibits targeted AID-mediated mutagenesis. In one embodiment, the selectively targeted, SHM optimized synthetic gene has portions that exhibit a higher rate of AID-mediated mutagenesis and other portions that exhibit a lower rate of AID-mediated mutagenesis.
[0040] The present invention also contemplates that a selectively targeted SHM optimized synthetic gene can be created in a step-wise or sequential fashion such that some modifications are made to the gene and then a subsequent round of modification is made to the gene. Such sequential or step-wise modifications are contemplated by the present invention and are one way of carrying out the process and one way of producing the genes claimed herein.
[0041] In one non-limiting aspect, the synthetic gene includes one or more conservative or semi-conservative amino acid mutations to modulate hot spot or cold spot density and said synthetic gene encodes a protein or portion thereof having about 90% or greater amino acid sequence identity compared to said unmodified gene.
[0042] In another non-limiting aspect, the synthetic gene includes one or more conservative or semi-conservative amino acid mutations to modulate hot spot or cold spot density, and said synthetic gene encodes a protein or portion thereof having about 70% or greater amino acid sequence identity compared to said unmodified gene.
[0043] In another non-limiting aspect, the synthetic gene includes one or more conservative or semi-conservative amino acid mutations to modulate hot spot or cold spot density, and said synthetic gene encodes a protein or portion thereof having about 50% or greater amino acid sequence identity compared to said unmodified gene.
[0044] In yet another non-limiting aspect, the said synthetic gene includes one or more amino acid mutations that introduce preferred SHM hot spot motifs.
[0045] In one non-limiting example, a synthetic gene does not include genes comprising a stop motif inserted into an open reading frame.
[0046] In one aspect, a protein or portion thereof encoded by a synthetic gene is selected from among, but not limited to, antibodies or antigen-binding fragments thereof, selectable markers, reporter proteins, cytokines, chemokines, growth factors, hormones, neurotransmitters, hormones, cytokines, chemokines, enzymes, receptors, structural proteins, toxins, co-factors and transcription factors.
[0047] Provided herein is an expression vector, comprising at least one synthetic gene. In one aspect, the expression vector is an integrating expression vector. When the expression vector is an integrating expression vector, the expression vector can further comprise one or more sequences to direct recombination. In another aspect, the expression vector is an episomal expression vector. In yet another aspect, the expression vector is a viral expression vector.
[0048] Provided herein is a eukaryotic cell comprising a synthetic gene as described herein. In one aspect, the eukaryotic cell is a mammalian cell or a yeast cell.
[0049] Provided herein is a prokaryotic cell comprising a synthetic gene as described herein. In one aspect, the prokaryotic cell is an Escherichia coli cell.
[0050] Provided herein is a method for preparing a gene product having a desired property, comprising: a) preparing a synthetic gene encoding a gene product which exhibits increased SHM; b) expressing said synthetic gene in a population of cells; wherein said population of cells express AID, or can be induced to express AID via the addition of an inducing agent; and c) selecting a cell or cells within the population of cells which express a mutated gene product having the desired property. In one aspect, the method, optionally, further comprises activating or inducing the expressing AID in said population of cells. In another aspect, the method, optionally, further comprises establishing one or more clonal populations of cells from the cell or cells identified in (c). In yet another aspect of the method, at least one synthetic gene is located in an expression vector such as any one of the vectors described elsewhere herein. In one aspect of the method, the cell is a cell as described elsewhere herein.
[0051] Provided herein is a method for preparing a gene product having a desired property, comprising: a) expressing said gene product in a population of cells; wherein said population of cells comprises at least one synthetic gene which exhibits decreased SHM; and wherein said population of cells express an AID, or can be induced to express AID via addition of an inducing agent; and b) selecting a cell or cells within the population of cells which express a mutated gene product (a polypeptide encoded by the mutated synthetic gene, the gene having one or more mutations) having the desired property. In one aspect, the method, optionally, further comprises activating or inducing the expressing AID in said population of cells. In another aspect, the method, optionally, further comprises establishing one or more clonal populations of cells from the cell or cells identified in (b). In yet another aspect of the method, at least one synthetic gene is located in an expression vector such as any one of the vectors described elsewhere herein. In one aspect of the method, the cell is a cell as described elsewhere herein.
[0052] Provided herein is an in vitro hypermutation system, comprising: a) a polynucleotide comprising a synthetic gene; b) a recombinant AID; and c) an in vitro expression system. The in vitro system can further comprise a polymerase to amplify nucleic acids after transcription. The in vitro system can further comprise an in vitro translation system. In one aspect, the polynucleotide is located in an expression vector such as any one of the vectors described elsewhere herein. The in vitro system can further comprise a cell population of a cell as described elsewhere herein.
[0053] Provided herein is a kit for in vitro mutagenesis, comprising: a) a recombinant AID protein; b) one or more reagents for in vitro transcription; and c) instructions for design or use of a synthetic gene. The kit can further comprise one or more reagents for in vitro translation. The kit can further comprise comprising an expression vector such as, for example, any one of the expression vectors as described herein. The kit can further comprise a cell population of a cell as described elsewhere herein.
INCORPORATION BY REFERENCE
[0054] All publications and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.
BRIEF DESCRIPTION OF THE DRAWINGS
[0055] A better understanding of the features and advantages of the present invention can be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:
[0056] FIG. 1 and FIG. 2 show the 20 most common codon transitions observed in complementarity determining regions (CDRs) and framework regions (FWs or FRs) during SHM-mediated affinity maturation and demonstrate how simple frame shifts can determine the two radically different patterns of mutagenesis seen in CDRs and FWs. These observations lead directly to a hypothesis that both functional selection during affinity maturation and the reading frame context determines the amino acid diversity generated at SHM hot spot codons.
[0057] FIG. 1 Shows that within CDRs, (the codons AGC, TAT, and TAC which encode tyrosine and serine amino acids), feed a directed flow of primary, secondary and tertiary SHM events generating amino acid diversity. Within CDRs, the most common codon transition observed is AGC to AAC (785 instances), leading to a serine to asparagine conversion. While that transition is also common in framework regions (354 instances), a simple frame shift of the same mutation in the same hotspot motif ( . . . TACAGCTAT . . . ; SEQ ID NO: 42) context leads to a CAG to CAA silent mutation that is common in framework regions (288 instances) but not commonly observed in CDRs.
[0058] FIG. 2 Shows that in contrast to FIG. 1, the most commonly observed codon (amino acid) transition events in frame work regions generate silent mutations.
[0059] FIG. 3 Provides all of the motifs encoded by the WAC library, given in any of the three possible reading frames, produce a concatenation of hot spots and compares these motifs with all other possible 4096 6-mer nucleotide combinations for their ability to recruit SHM-mediated machinery. Longer assemblies result in the same high density of SHM "hot spots" with no "cold spots." This assembly of degenerate codons (WACW) results in a subset of possible 4-mer hot spots described by Rogozin et al. (WRCH), where R=A or G, H=A or C or T, and W=T or A.
[0060] FIG. 4 Preferred SHM hot spot codons AAC and TAC, which are the basis for a synthetic library, can result in a set of primary and secondary mutation events that create considerable amino acid diversity, as judged by equivalent SHM mutation events observed in Ig heavy chains antibodies. From these two codons, basic amino acids (histidine, lysine, arginine), an acidic amino acid (Aspartate), hydrophilic amino acids (serine, threonine, asparagine, tyrosine), hydrophobic amino acids (Alanine, and phenylalanine), and glycine are generated as a result of SHM events.
[0061] FIG. 5 The distribution of all 4096 6-mer nucleotide z-scores describing the hotness or coldness of the motif to SHM-mediated mutation. The z-scores for all permutations of 6-mers in the WRC synthetic library are superimposed on this distribution, with the dashed line denoting the top 5% of all possible motifs.
[0062] FIG. 6 The series of mutation events that lead to the creation of amino acid diversity, starting from "preferred SHM hot spot codons" AGC and TAC, as observed in affinity matured IGV heavy chain sequences. 4200 primary and secondary mutation events, starting from codons encoding asparagine and tyrosine, lead to a set of functionally diverse amino acids.
[0063] FIG. 7 Illustrates the convergence of sequence optimization with progressive iterations of replacement using the program SHMredesign. The figure shows both optimization towards an idealized hot and cold sequence, in this case starting with unmodified canine AID nucleotide sequence.
[0064] FIG. 8 Provides the amino acid (A; SEQ ID NO: 294), and polynucleotide sequence (B; SEQ ID NO: 26) of unmodified blasticidin gene. Also shown is the initial analysis of hot spots (C), cold spots (D) and occurrences of CpGs (E) as illustrated by bold capital letters.
[0065] FIG. 9 Provides the amino acid (A; SEQ ID NO: 294), and polynucleotide sequence (B; SEQ ID NO: 295) of a synthetic, SHM resistant version of the blasticidin gene. Also shown is the analysis of hot spots (C), cold spots (D) and occurrences of CpGs (E) in the synthetic sequence as illustrated by bold capital letters.
[0066] FIG. 10 Provides the amino acid (A; SEQ ID NO: 294), and polynucleotide sequence (B; SEQ ID NO: 296) of a synthetic, SHM susceptible version of the blasticidin gene. Also shown is the analysis of hot spots (C), cold spots (D) and occurrences of CpGs (E) in the synthetic sequence as illustrated by bold capital letters.
[0067] FIG. 11 Provides the polynucleotide sequence (A; SEQ ID NO: 297) of the unmodified form of the hygromycin gene. Also shown is the initial analysis of hot spots (B) and cold spots (C) as illustrated by bold capital letters. 102 CpG methylation sites were present (data not shown).
[0068] FIG. 12 Provides the polynucleotide sequence (A; SEQ ID NO: 298) of a synthetic, SHM resistant (cold) form of the hygromycin gene. Also shown is the analysis of hot spots (B) and cold spots (C) as illustrated by bold capital letters. 41 CpG methylation sites were present (data not shown).
[0069] FIG. 13 Provides the polynucleotide sequence (A; SEQ ID NO: 299) of a synthetic, SHM susceptible (hot) form of the hygromycin gene. Also shown is the analysis of hot spots (B) and cold spots (C) as illustrated by bold capital letters. 32 CpG methylation sites were present (data not shown).
[0070] FIG. 14 Provides the polynucleotide sequence (A; SEQ ID NO: 300) of a unmodified form of the Teal Fluorescent Protein (TFP). Also shown is the analysis of hot spots (B) and cold spots (C) as illustrated by bold capital letters. 40 CpG methylation sites were present (data not shown).
[0071] FIG. 15 Provides the polynucleotide sequence (A; SEQ ID NO: 301) of a synthetic SHM susceptible (hot) form of the Teal Fluorescent Protein (TFP). Also shown is the analysis of hot spots (B) and cold spots (C) as illustrated by bold capital letters. 14 CpG methylation sites were present (data not shown).
[0072] FIG. 16 Provides the polynucleotide sequence (A; SEQ ID NO: 302) of a synthetic SHM resistant (cold) form of the Teal Fluorescent Protein (TFP). Also shown is the analysis of hot spots (B) and cold spots (C) as illustrated by bold capital letters. 21 CpG methylation sites were present (data not shown).
[0073] FIG. 16D shows the mutations for a representative segment of the hot and cold TFP constructs. The central row shows the amino acid sequence of TFP (residues 59 thru 87) in single letter format (SEQ ID NO: 378), and the "hot" and "cold" starting nucleic acid sequences encoding the two constructs are shown above (hot; SEQ ID NO: 379) and below (cold) the amino acid sequence (SEQ ID NO: 380). Mutations observed in the hot sequence are aligned and stacked top of the gene sequences, while mutations in the cold TFP sequence are shown below. The results illustrate how "silent" changes to the coding sequences generate dramatic changes in observed AID-mediated SHM rates, demonstrating that engineered sequences can be effectively optimized to create fast or slow rates of SHM.
[0074] FIG. 16E shows that the spectrum of mutations generated by AID in the present in vitro tissue culture system mirror those observed in other studies and those seen during in vivo affinity maturation. FIG. 16E shows the mutations generated in the present study (Box (i) upper left, n=118), and compares them with mutations observed by Zan et al. (box (ii) upper right, n=702), Wilson et al. (lower left, n=25000; box (iii)), and a larger analysis of IGHV chains that have undergone affinity maturation (lower right, n=101,926; box (iv)). The Y-axis in each chart indicates the starting nucleotide, the X-axis indicates the end nucleotide, and the number in each square indicates the percentage (%) of time that nucleotide transition is observed. In the present study, the frequency of mutation transitions and transversions was similar to those seen in other data sets. Mutations of C to T and G to A are the direct result of AID activity on cytidines and account for 48% of all mutation events. In addition, mutations at bases A and T account for ˜30% of mutation events (i.e., slightly less than frequencies observed in other datasets).
[0075] FIG. 16F shows that mutation events are distributed throughout the SHM optimized nucleotide sequence of the hot TFP gene, with a maximum instantaneous rate of about 0.08 events per 1000 nucleotides per generation centered around 300 nucleotides from the beginning of the open reading frame. Stable transfection and selection of a gene with AID (for 30 days) produces a maximum rate of mutation of 1 event per 480 nucleotides. As a result, genes may contain zero, one, two or more mutations per gene.
[0076] FIG. 16G Illustrates the distribution of SHM-mediated events observed in hot TFP sequenced genes compared to the significantly reduced pattern of mutations seen in cold TFP (FIG. 16H).
[0077] FIG. 17 Provides a sequence comparison of activation-induced cytidine deaminase (AID) from Homo sapiens (human; SEQ ID NO: 303), Mus musculus (mouse; SEQ ID NO: 304), Canis familiaris (dog; SEQ ID NO: 305), Rattus norv (rat; SEQ ID NO: 306) and Pan troglodyte (chimpanzee; SEQ ID NO: 307). Variations between the species are represented by bold amino acids.
[0078] FIG. 18 Provides the amino acid (A; SEQ ID NO: 308), and polynucleotide sequence (B; SEQ ID NO: 309) of canine cytidine deaminase (AID) (L198A) Also shown is the analysis of hot spots (C), cold spots (D) and occurrences of CpGs (E) in the unmodified sequence as illustrated by bold capital letters.
[0079] FIG. 19 Provides the polynucleotide sequence (A; SEQ ID NO: 310) of a synthetic SHM susceptible form of canine AID. Also shown is the analysis of hot spots (B), cold spots (C) and occurrences of CpGs (D) as illustrated by bold capital letters.
[0080] FIG. 20 Provides the polynucleotide sequence (A; SEQ ID NO: 311) of a synthetic SHM resistant form of canine AID. Also shown is the analysis of hot spots (B), cold spots (C) and occurrences of CpGs (D) as illustrated by bold capital letters.
[0081] FIG. 21 Provides a sequence comparison of genomic Canis familiaris (dog; SEQ ID NO: 312) and SHM-resistant (cold) Canis familiaris (dog; SEQ ID NO: 313), Homo sapiens (human; SEQ ID NO: 314) and Mus musculus (mouse; SEQ ID NO: 315) mRNA activation-induced cytidine deaminase (AID) sequences. GAG sequences are illustrated by bold, underlining. Variations between the species are represented by bold amino acids.
[0082] FIG. 22 FIG. 22A Shows the predicted effect of AID activity on reversion frequency using a protein containing a mutable stop codon such as a fluorescent protein. FIG. 22B shows the actual rates of loss of fluorescence achieved (shown as GFP extinction) with cells transfected with two different concentrations of an expression vector capable of expressing AID, and stably expressing GFP. FIG. 22C shows the initial rates of GFP reversion with comparing directly, wild type human AID, and cold canine AID. Also shown is the effect of Ig enhancers on reversion rate.
[0083] FIG. 23 Provides the amino acid (A; SEQ ID NO: 316), and polynucleotide sequence (B; SEQ ID NO: 317) of unmodified Pol eta as well as the analysis of the number of hot spots, cold spots and CpGs (C).
[0084] FIG. 24 Provides the polynucleotide sequence (A; SEQ ID NO: 318) of a synthetic SHM resistant (cold) form of Pol eta well as the analysis of the number of hot spots, cold spots and CpGs (B).
[0085] FIG. 25 Provides the polynucleotide sequence (A; SEQ ID NO: 319) of a synthetic SHM susceptible (hot) form of Pol eta well as the analysis of the number of hot spots, cold spots and CpGs (B).
[0086] FIG. 26 Provides the amino acid sequence of unmodified Pol theta (SEQ ID NO: 320).
[0087] FIG. 27 Provides the polynucleotide sequence of unmodified Pol theta (SEQ ID NO: 321).
[0088] FIG. 28 Provides the polynucleotide sequence of a synthetic SHM resistant (cold) form of Pol theta (SEQ ID NO: 322).
[0089] FIG. 29 Provide the polynucleotide sequence of a synthetic SHM susceptible (hot) form of Pol theta (SEQ ID NO: 323).
[0090] FIG. 30 Provides the amino acid (A; SEQ ID NO: 324), and polynucleotide sequence (B; SEQ ID NO: 325) of unmodified uracil DNA glycosylase well as the analysis of the number of hot spots, cold spots and CpGs (C).
[0091] FIG. 31 Provides the polynucleotide sequence of a synthetic SHM resistant (cold) form of uracil DNA glycosylase (A; SEQ ID NO: 326) and a synthetic SHM susceptible (hot) form of uracil glycosylase (B; SEQ ID NO: 327).
[0092] FIG. 32 Provides a schematic of Vector Formats 1 (A) & 2 (B).
[0093] FIG. 33 Provides a schematic of Vector Format 3 (A) & 4 (B).
[0094] FIG. 34 Provides a schematic of Vector Format 5.
[0095] FIG. 35 Provides a schematic of Vectors F1 (A) and F7 (B).
[0096] FIG. 36 Provides schematics of Vector AB102. Restriction sites and genetic elements are illustrated in 36A and fragments used in construction of the vector are illustrated in 36B.
[0097] FIG. 37 Provides a schematic of Vectors AB184 (A) and F10 (B).
[0098] FIG. 38 Provides a schematic of Vector ANA209.
[0099] FIG. 39 Provides the polynucleotide sequence of unmodified NisB (A; SEQ ID NO: 328) and the initial analysis of hot spots, cold spots and CpG content (B).
[0100] FIG. 40 Provides the polynucleotide sequence of a SHM resistant (cold) form of NisB (A; SEQ ID NO: 329) and the initial analysis of hot spots, cold spots and CpG content (B).
[0101] FIG. 41 Provides the polynucleotide sequence of unmodified NisP (A; SEQ ID NO: 330) and the initial analysis of hot spots, cold spots and CpG content (B).
[0102] FIG. 42 Provides the polynucleotide sequence of a SHM resistant (cold) form of NisP (A; SEQ ID NO: 331) and the initial analysis of hot spots, cold spots and CpG content (B).
[0103] FIG. 43 Provides the polynucleotide sequence of unmodified NisT (A; SEQ ID NO: 332) and SHM resistant (cold) form of NisT (B; SEQ ID NO: 333).
[0104] FIG. 44 Provides the polynucleotide sequence of unmodified NisA (A; SEQ ID NO: 334), as well as the initial analysis of hot spots (B) and cold spots (C). Also shown is a synthetic form of NisA (SEQ ID NO: 335) showing areas of SHM resistant sequence (D; underlined) and SHM susceptible sequence (D; non-underlined), and the analysis of hot spots (E) and cold spots (F).
[0105] FIG. 45 Provides the polynucleotide sequence of unmodified NisC (A; SEQ ID NO: 336), as well as the initial analysis of hot spots (B) and cold spots (C).
[0106] FIG. 46 Shows a synthetic resistant (cold) form of NisC (A; SEQ ID NO: 337) showing the analysis of hot spots (B) and cold spots (C).
[0107] FIG. 47 Provides a diagram of the synthesis and maturation of Nisin (47A). FIG. 47B illustrates a backbone trace of the protein NisC, as described in the pdb structure 2GOD (rcsb.org/pdb/), with residues in the binding pocket highlighted. A zinc metal and several cysteine, histidine and aspartate residues are the residues that carry out cyclization of NisA. Here, residues within 10 Angstroms (Å) of the catalytic site are labeled and shown with a surface representation.
[0108] FIG. 48 FIG. 48A shows cells expressing the 30 pM HyHEL antibody (dark gray) or no antibody (light gray) after selection by incubating with streptavidin microparticles conjugated to the mature Hen Egg Lysozyme (HEL) protein (Protein), HEL peptide monomer (Monomer), tandem HEL dimer (Tandem), HEL MAPS dimer (MAPS) or naked unconjugated streptavidin microparticles (Naked). FIG. 48B shows cells expressing the 800 pM HyHEL antibody (dark gray) or no antibody (light gray) were selected by incubating with tosylactivated microparticles conjugated to either the mature HEL protein (Protein) or naked unconjugated tosylactivated microparticles (Naked).
[0109] FIG. 49 FIG. 49A Shows cells expressing the 30 pM HyHEL antibody were selected by incubating with streptavidin microparticles conjugated to the mature HEL protein (Protein), HEL peptide monomer (Monomer), tandem HEL dimer (Tandem), HEL MAPS dimer (MAPS) or naked unconjugated streptavidin microparticles (Naked). FIG. 49B shows cells expressing the 800 pM HyHEL antibody were selected by incubating with tosylactivated microparticles conjugated to either the mature HEL protein (Protein) or naked unconjugated tosylactivated microparticles (Naked).
[0110] FIG. 50 shows the 20 most hot spot codon hypermutation transition events within the FR and CDR regions of heavy chain antibodies, where the numbers labeling the arrows indicate how often a codon transition event was observed. The codons AGC and AGT (Serine), and to a lesser extent TAC and TAT (Tyrosine), account for ˜50% of the originating mutations observed in affinity matured antibodies. Use of these hot spot codons within the correct reading frame, combined with affinity maturation leads to many fewer observed silent mutations within CDRs compared to framework regions (highlighted by dotted circles in the figure).
[0111] FIG. 51 HEK-293 cells transfected with a low affinity anti-HEL antibody (comprising the light chain mutation N31G) and an constitutive AID expression vector either after stable transfection and selection (panels A and C) or transiently with the addition of re-transfected AID expression vector (panels B and D) were incubated with either 50 pM HEL-FITC (A and B) or 500 pM HEL-FITC(C and D) and living HEL-FITC-binding cells were sorted and expanded in culture for another round of selection and sequence analysis.
[0112] FIG. 52 Previously sorted HEK-293 cells expressing anti-HEL antibodies and constitutive canine AID either after stable transfection and selection (A and C) or transiently with the addition of re-transfected AID expression vector (panels B and D) were incubated with either 50 pM HEL-FITC (A and B) or 500 pM HEL-FITC (C and D) and living HEL-FITC-binding cells were sorted and expanded in culture for another round of selection and sequence analysis.
[0113] FIG. 53 HEK-293 cells transfected with a low affinity anti-HEL antibody and evolved over 4 rounds of selection and evolution were analyzed by incubation with 50 pM HEL-FITC, as described in Example 13. Panel A shows that over 4 rounds of evolution, a clear increase in positive cells is evident in both the FACS scatter plot (panel A), as well as total number of positive cells gated (panel B).
[0114] FIG. 54 Panel A shows a selection of amino sequences around the HyHEL10 light chain CDR1, showing the evolved sequence around the site of the Asn 31 mutation introduced in the starting constructs (SEQ ID NOS: 367, 368 and 369). Panel B shows the corresponding nucleic acid sequences (SEQ ID NOS: 370, 371 and 372), and panel C shows a representation of the measured affinity of the evolved mutants.
DETAILED DESCRIPTION OF THE INVENTION
I. Definitions
[0115] As used herein and in the appended claims, the terms "a," "an" and "the" can mean, for example, one or more, or at least one, of a unit unless the context clearly dictates otherwise. Thus, for example, reference to "an antibody" includes a plurality of such antibodies and reference to "a variable domain" includes reference to one or more variable domains and equivalents thereof known to those skilled in the art, and so forth. In the event that there is a plurality of definitions for a term herein, those in this section prevail unless stated otherwise.
[0116] Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges can independently be included or excluded in the range, and each range where either, neither or both limits are included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.
[0117] The term "specific binding member" describes a member of a pair of molecules which have binding specificity for one another. The members of a specific binding pair can be naturally derived or wholly or partially synthetically produced. One member of the pair of molecules has an area on its surface, or a cavity, which specifically binds to and is therefore complementary to a particular spatial and/or polar organization of the other member of the pair of molecules. Thus, the members of the pair have the property of binding specifically, to each other. Examples of types of specific binding pairs include antigen-antibody, Avimer®-substrate, biotin-avidin, hormone-hormone receptor, receptor-ligand, protein-protein, and enzyme-substrate.
[0118] The term "antibody" describes an immunoglobulin whether natural or partly or wholly synthetically produced. The term also covers any polypeptide or protein having a binding domain which is, or is homologous to, an antigen-binding domain. CDR grafted antibodies are also contemplated by this term.
[0119] "Native antibodies" and "native immunoglobulins" are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is, in some cases, linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies among the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain ("VH") followed by a number of constant domains ("CH"). Each light chain has a variable domain at one end ("VL") and a constant domain ("CL") at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light-chain variable domain is aligned with the variable domain of the heavy chain. Particular amino acid residues are believed to form an interface between the light- and heavy-chain variable domains.
[0120] The term "variable domain" refers to protein domains that differ extensively in sequence among family members (i.e. among different isoforms, or in different species). With respect to antibodies, the term "variable domain" refers to the variable domains of antibodies that are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called hypervariable regions both in the light chain and the heavy chain variable domains. The more highly conserved portions of variable domains are called the "framework region" or "FR." The variable domains of unmodified heavy and light chains each comprise four FRs (FR1, FR2, FR3 and FR4, respectively), largely adopting a β-sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the β-sheet structure. The hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991), pages 647 669). The constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
[0121] The term "hypervariable region" when used herein refers to the amino acid residues of an antibody which are responsible for antigen-binding. The hypervariable region comprises amino acid residues from three "complementarity determining regions" or "CDRs," which directly bind, in a complementary manner, to an antigen and are known as CDR1, CDR2, and CDR3 respectively.
[0122] In the light chain variable domain, the CDRs correspond to approximately residues 24-34 (CDRL1), 50-56 (CDRL2) and 89-97 (CDRL3), and in the heavy chain variable domain the CDRs correspond to approximately residues 31-35 (CDRH1), 50-65 (CDRH2) and 95-102 (CDRH3); Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)) and/or those residues from a "hypervariable loop" (i.e., residues 26-32 (L1), 50-52 (L2) and 91-96 (L3) in the light chain variable domain and 26-32 (H1), 53-55 (H2) and 96-101 (H3) in the heavy chain variable domain; Chothia and Lesk J., Mol. Biol. 196:901-917 (1987)).
[0123] As used herein, "variable framework region" or "VFR" refers to framework residues that form a part of the antigen binding pocket and/or groove that may contact antigen. In some embodiments, the framework residues form a loop that is a part of the antigen binding pocket or groove. The amino acids residues in the loop may or may not contact the antigen. In an embodiment, the loop amino acids of a VFR are determined by inspection of the three-dimensional structure of an antibody, antibody heavy chain, or antibody light chain. The three-dimensional structure can be analyzed for solvent accessible amino acid positions as such positions are likely to form a loop and/or provide antigen contact in an antibody variable domain. Some of the solvent accessible positions can tolerate amino acid sequence diversity and others (e.g. structural positions) can be less diversified. The three-dimensional structure of the antibody variable domain can be derived from a crystal structure or protein modeling. In some embodiments, the VFR comprises, consists essentially of, or consists of amino acid positions corresponding to amino acid positions 71 to 78 of the heavy chain variable domain, the positions defined according to Kabat et al., 1991. In some embodiments, VFR forms a portion of Framework Region 3 located between CDRH2 and CDRH3. Preferably, VFR forms a loop that is well positioned to make contact with a target antigen or form a part of the antigen binding pocket.
[0124] Depending on the amino acid sequence of the constant domain of their heavy chains, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these can be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA, and IgA2. The heavy-chain constant domains (Fc) that correspond to the different classes of immunoglobulins are called α, δ, ε, γ, and μ, respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
[0125] The "light chains" of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa or ("κ") and lambda or ("λ"), based on the amino acid sequences of their constant domains.
[0126] The terms "antigen-binding portion of an antibody," "antigen-binding fragment," "antigen-binding domain," "antibody fragment" or a "functional fragment of an antibody" are used interchangeably in the present invention to mean one or more fragments of an antibody that retain the ability to specifically bind to an antigen (see, e.g., Holliger et al., Nature Biotech. 23 (9): 1126-1129 (2005)). Non-limiting examples of antibody fragments included within, but not limited to, the term "antigen-binding portion" of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR). Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883; and Osbourn et al. (1998) Nat. Biotechnol. 16:778). Such single chain antibodies are also intended to be encompassed within the term "antigen-binding portion" of an antibody. Any VH and VL sequences of specific scFv can be linked to human immunoglobulin constant region cDNA or genomic sequences, in order to generate expression vectors encoding complete IgG molecules or other isotypes. VH and VL can also be used in the generation of Fab, Fv or other fragments of immunoglobulins using either protein chemistry or recombinant DNA technology. Other forms of single chain antibodies, such as diabodies are also encompassed.
[0127] "F(ab')2" and "Fab'" moieties can be produced by treating immunoglobulin (monoclonal antibody) with a protease such as pepsin and papain, and includes an antibody fragment generated by digesting immunoglobulin near the disulfide bonds existing between the hinge regions in each of the two H chains. For example, papain cleaves IgG upstream of the disulfide bonds existing between the hinge regions in each of the two H chains to generate two homologous antibody fragments in which an L chain composed of VL (L chain variable region) and CL (L chain constant region), and an H chain fragment composed of VH (H chain variable region) and CHγI ('γ1 region in the constant region of H chain) are connected at their C terminal regions through a disulfide bond. Each of these two homologous antibody fragments is called Fab'. Pepsin also cleaves IgG downstream of the disulfide bonds existing between the hinge regions in each of the two H chains to generate an antibody fragment slightly larger than the fragment in which the two above-mentioned Fab' are connected at the hinge region. This antibody fragment is called F(ab')2.
[0128] The Fab fragment also contains the constant domain of the light chain and the first constant domain (CH1) of the heavy chain. Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxyl terminus of the heavy chain CH1 domain including one or more cysteine(s) from the antibody hinge region. Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group. F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
[0129] "Fv" is the minimum antibody fragment which contains a complete antigen-recognition and antigen-binding site. This region consists of a dimer of one heavy chain and one light chain variable domain in tight, non-covalent association. It is in this configuration that the three hypervariable regions of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer. Collectively, the six hypervariable regions confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three hypervariable regions specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
[0130] "Single-chain Fv" or "sFv" antibody fragments comprise the VH and VL domains of an antibody, wherein these domains are present in a single polypeptide chain. In some embodiments, the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the sFv to form the desired structure for antigen binding. For a review of sFv molecules, see, e.g., Pluckthun in The Pharmacology of Monoclonal Antibodies, Vol. 113, Rosenburg and Moore eds. Springer-Verlag, New York, pp. 269-315 (1994).
[0131] The term "Avimer®" refers to a new class of therapeutic proteins that are from human origin, which are unrelated to antibodies and antibody fragments, and are composed of several modular and reusable binding domains, referred to as A-domains (also referred to as class A module, complement type repeat, or LDL-receptor class A domain). They were developed from human extracellular receptor domains by in vitro exon shuffling and phage display, (Silverman et al., 2005, Nat. Biotechnol. 23:1493-94; Silverman et al., 2006, Nat. Biotechnol. 24:220). The resulting proteins can comprise multiple independent binding domains that can exhibit improved affinity (in some cases sub-nanomolar) and specificity compared with single-epitope binding proteins. See, for example, U.S. Patent Application Publ. Nos. 2005/0221384, 2005/0164301, 2005/0053973 and 2005/0089932, 2005/0048512, and 2004/0175756, each of which is hereby incorporated by reference herein in its entirety.
[0132] Each of the known 217 human A-domains comprises ˜35 amino acids (˜4 kDa) and domains are separated by linkers that average five amino acids in length. Native A-domains fold quickly and efficiently to a uniform, stable structure mediated primarily by calcium binding and disulfide formation. A conserved scaffold motif of only 12 amino acids is needed for this common structure. The end result is a single protein chain containing multiple domains, each of which represents a separate function. Each domain of the proteins binds independently and that the energetic contributions of each domain are additive. These proteins were called "Avimer®" from avidity multimers.
[0133] As used herein, "natural" or "naturally occurring" antibodies or antibody variable domains, refers to antibodies or antibody variable domains having a sequence of an antibody or antibody variable domain identified from a non-synthetic source, for example, from a germline sequence, or differentiated antigen-specific B cell obtained ex vivo, or its corresponding hybridoma cell line, or from the serum of an animal. These antibodies can include antibodies generated in any type of immune response, either natural or otherwise induced. Natural antibodies include the amino acid sequences, and the nucleotide sequences that constitute or encode these antibodies, for example, as identified in the Kabat database.
[0134] The term "synthetic polynucleotide" or "synthetic gene" means that the corresponding polynucleotide sequence, or amino acid sequence, is derived, in whole or part, from a sequence that has been designed, or synthesized de novo, or modified as compared to an equivalent unmodified sequence. Synthetic genes can be prepared in whole or part, via chemical synthesis, or amplified via PCR, or similar enzymatic amplification systems. Synthetic genes are, in some embodiments, different from unmodified genes, either at the amino acid, or polynucleotide level, (or both) and are, for example, located within the context of synthetic expression control sequences. Synthetic gene sequences can include amino acid or polynucleotide sequences that have been changed, for example, by the replacement, deletion, or addition, of one or more, amino acids or nucleotides, thereby providing an amino acid sequence, or a polynucleotide coding sequence that is different from the source sequence. Synthetic gene polynucleotide sequences may not necessarily encode proteins with different amino acids, compared to the unmodified gene, for example, they can also encompass synthetic polynucleotide sequences that incorporate different codons or motifs, but which encode the same amino acid(s); i.e., the nucleotide changes can represent silent mutations at the amino acid level. In one embodiment, synthetic genes exhibit altered susceptibility to SHM compared to the unmodified gene. Synthetic genes can be iteratively modified using the methods described herein and, in each successive iteration, a corresponding polynucleotide sequence or amino acid sequence, is derived, in whole or part, from a sequence that has been designed, or synthesized de novo, or modified, compared to an equivalent unmodified sequence.
[0135] The terms "semi-synthetic polynucleotide" or "semi-synthetic gene," as used herein, refer to polynucleotide sequences that consist in part of a nucleic acid sequence that has been obtained via polymerase chain reaction (PCR) or other similar enzymatic amplification system which utilizes a natural donor (i.e., peripheral blood monocytes) as the starting material for the amplification reaction. The remaining "synthetic" polynucleotides, i.e., those portions of semi-synthetic polynucleotide not obtained via PCR or other similar enzymatic amplification system can be synthesized de-novo using methods known in the art including, but not limited to, the chemical synthesis of nucleic acid sequences.
[0136] The term "synthetic variable regions" refers to synthetic polynucleotide sequences within a synthetic gene that are substantially comprised of optimal SHM hot spots and hot codons or motifs that, when combined with the activity of AID and one or more error-prone polymerases, generates a broad spectrum of potential amino acid diversity at each position. Synthetic variable regions can encode antibody or non-antibody polypeptides and can be separated by synthetic frame work sequences that encompass codons or motifs that are not specifically targeted for, or susceptible to, SHM, or that are resistant to SHM.
[0137] The term "diabodies" refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy chain variable domain (VH) connected to a light chain variable domain (VL) in the same polypeptide chain (VH-VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites. Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA 90:6444-6448 (1993).
[0138] Antibodies of the present invention also include heavy chain dimers, such as antibodies from camelids and sharks. Camelid and shark antibodies comprise a homodimeric pair of two chains of V-like and C-like domains (neither has a light chain). Since the VH region of a heavy chain dimer IgG in a camelid does not have to make hydrophobic interactions with a light chain, the region in the heavy chain that normally contacts a light chain is changed to hydrophilic amino acid residues in a camelid. VH domains of heavy-chain dimer IgGs are called VHH domains. Shark Ig-NARs comprise a homodimer of one variable domain (termed a V-NAR domain) and five C-like constant domains (C-NAR domains).
[0139] In camelids, the diversity of antibody repertoire is determined by the complementary determining regions (CDR) 1, 2, and 3 in the VH or VHH regions. The CDR3 in the camel VHH region is characterized by its relatively long length averaging 16 amino acids (Muyldermans et al., 1994, Protein Engineering 7(9): 1129). This is in contrast to CDR3 regions of antibodies of many other species. For example, the CDR3 of mouse VH has an average of 9 amino acids.
[0140] Libraries of camelid-derived antibody variable regions, which maintain the in vivo diversity of the variable regions of a camelid, can be made by, for example, the methods disclosed in U.S. Patent Application Ser. No. 20050037421, published Feb. 17, 2005.
[0141] "Humanized" forms of non-human (e.g., murine) antibodies are chimeric antibodies which contain minimal sequence derived from non-human immunoglobulin. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which hypervariable region residues of the recipient are replaced by hypervariable region residues from a synthetic, or non-human source, such as mouse, rat, rabbit or non-human primate (donor antibody) having the desired specificity, affinity, and capacity. In some instances, framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies can comprise residues which are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. A humanized antibody can comprise substantially all of at least one (and in some cases two) variable domain(s), in which all or substantially all of the hypervariable regions correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence. The humanized antibody, optionally, also can comprise at least a portion of an immunoglobulin constant region (Fc), such as that of a human immunoglobulin. For further details, see Jones et al., Nature 321:522-525 (1986); Reichmann et al., Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992).
[0142] A "humanized antibody" of the present invention includes semi-synthetic antibodies prepared by genetic engineering and specifically includes a monoclonal antibody in which the CDR3 of the heavy and light chain is derived from a non-human monoclonal antibody (e.g. murine monoclonal antibody), or region is derived from synthetic variable region polynucleotides, as described herein (both heavy and light chain) and the constant region is derived from the synthetic human constant region templates likewise described herein and in commonly owned, priority U.S. Provisional Patent Application Nos. 60/904,622 and 61/020,124.
[0143] The term "monoclonal antibody" as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that can be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to conventional (polyclonal) antibody preparations, which can include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. The modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention can be made by the hybridoma method first described by Kohler et al., Nature 256:495 (1975), or can be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567). In certain embodiments, the "monoclonal antibodies" can also be isolated from phage antibody libraries using the techniques described in Clackson et al., Nature 352:624-628 (1991) and Marks et al., J. Mol. Biol. 222:581-597 (1991), for example.
[0144] In other embodiments, monoclonal antibodies can be isolated and purified from the culture supernatant or ascites mentioned above by saturated ammonium sulfate precipitation, euglobulin precipitation method, caproic acid method, caprylic acid method, ion exchange chromatography (DEAE or DE52), or affinity chromatography using anti-immunoglobulin column or protein A column.
[0145] A polyclonal antibody (antiserum) or monoclonal antibody can be produced by known methods. Namely, mammals, preferably, mice, rats, hamsters, guinea pigs, rabbits, cats, dogs, pigs, goats, horses, or cows, or more preferably, mice, rats, hamsters, guinea pigs, or rabbits are immunized, for example, with an antigen mentioned above with Freund's adjuvant, if necessary. The polyclonal antibody can be obtained from the serum obtained from the animal so immunized. The monoclonal antibodies are produced as follows. Hybridomas are produced by fusing the antibody-producing cells obtained from the animal so immunized and myeloma cells incapable of producing auto-antibodies. Then the hybridomas are cloned, and clones producing the monoclonal antibodies showing the specific affinity to the antigen used for immunizing the mammal are screened.
[0146] As used herein, an "intrabody or fragment thereof" refers to antibodies that are expressed and function intracellularly. Intrabodies, in some embodiments, lack disulfide bonds and are capable of modulating the expression or activity of target genes through their specific binding activity. Intrabodies include single domain fragments such as isolated VH and VL domains and scFvs. An intrabody can include sub-cellular trafficking signals attached to the N or C terminus of the intrabodies to allow them to be expressed at high concentrations in the sub-cellular compartments where a target protein is located. Upon interaction with the target gene, an intrabody modulates target protein function, and/or achieves phenotypic/functional knockout by mechanisms such as accelerating target protein degradation and sequestering the target protein in a non-physiological sub-cellular compartment. Other mechanisms of intrabody-mediated gene inactivation can depend on the epitope to which the intrabody is directed, such as binding to the catalytic site on a target protein or to epitopes that are involved in protein-protein, protein-DNA or protein-RNA interactions. In one embodiment, an intrabody is a scFv.
[0147] The "cell producing an antibody reactive to a protein or a fragment thereof" of the present invention means any cell producing any of the above-described antibodies of the present invention.
[0148] The term "germline gene segments" refers to the genes from the germline (the haploid gametes and those diploid cells from which they are formed). The germline DNA contain multiple gene segments that encode a single immunoglobulin heavy or light chain. These gene segments are carried in the germ cells but cannot be transcribed and translated into heavy and light chains until they are arranged into functional genes. During B-cell differentiation in the bone marrow, these gene segments are randomly shuffled by a dynamic genetic system capable of generating more than 108 specificities. Most of these gene segments are published and collected by the germline database.
[0149] As used herein, "library" refers to a plurality of polynucleotides, proteins, or cells comprising two or more non-identical members. A "synthetic library" refers to a plurality of synthetic polynucleotides, or a population of cells that comprise said plurality of synthetic polynucleotides. A "semi-synthetic library" refers to a plurality of semi-synthetic polynucleotides, or a population of cells that comprise said plurality of semi-synthetic polynucleotides. A "seed library" refers to a plurality of one or more synthetic or semi-synthetic polynucleotides, or cells that comprise said polynucleotides, that contain one or more sequences or portions thereof, that have been modified to increase or decrease susceptibility to SHM, e.g., AID-mediated SHM, and that are capable, when acted upon by somatic hypermutation, to create a library of polynucleotides, proteins or cells in situ.
[0150] As used herein, the term "antigen" refers to substances that are capable, under appropriate conditions, of inducing an immune response to the substance and of reacting with the products of the immune response. For example, an antigen can be recognized by antibodies (humoral immune response) or sensitized T-lymphocytes (T helper or cell-mediated immune response), or both. Antigens can be soluble substances, such as toxins and foreign proteins, or particulates, such as bacteria and tissue cells; however, only the portion of the protein or polysaccharide molecule known as the antigenic determinant (epitopes) combines with the antibody or a specific receptor on a lymphocyte. More broadly, the term "antigen" refers to any substance to which an antibody binds, or for which antibodies are desired, regardless of whether the substance is immunogenic. For such antigens, antibodies can be identified by recombinant methods, independently of any immune response.
[0151] As used herein, the term "affinity" refers to the equilibrium constant for the reversible binding of two agents and is expressed as Kd. Affinity of a binding protein to a ligand such as affinity of an antibody for an epitope can be, for example, from about 100 nanomolar (nM) to about 0.1 nM, from about 100 nM to about 1 picomolar (pM), or from about 100 nM to about 1 femtomolar (fM). As used herein, the term "avidity" refers to the resistance of a complex of two or more agents to dissociation after dilution.
[0152] "Epitope" refers to that portion of an antigen or other macromolecule capable of forming a binding interaction that interacts with the variable region binding pocket of a binding protein. Such binding interaction can be manifested as an intermolecular contact with one or more amino acid residues of a CDR. Antigen binding can involve a CDR3 or a CDR3 pair. An epitope can be a linear peptide sequence (i.e., "continuous") or can be composed of noncontiguous amino acid sequences (i.e., "conformational" or "discontinuous"). A binding protein can recognize one or more amino acid sequences; therefore an epitope can define more than one distinct amino acid sequence. Epitopes recognized by binding protein can be determined by peptide mapping and sequence analysis techniques well known to one of skill in the art. A "cryptic epitope" or a "cryptic binding site" is an epitope or binding site of a protein sequence that is not exposed or substantially protected from recognition within an unmodified polypeptide, but is capable of being recognized by a binding protein of a denatured or proteolyzed polypeptide. Amino acid sequences that are not exposed, or are only partially exposed, in the unmodified polypeptide structure are potential cryptic epitopes. If an epitope is not exposed, or only partially exposed, then it is likely that it is buried within the interior of the polypeptide. Candidate cryptic epitopes can be identified, for example, by examining the three-dimensional structure of an unmodified polypeptide.
[0153] The term "specific" is applicable to a situation in which one member of a specific binding pair will not show any significant binding to molecules other than its specific binding partner(s). The term is also applicable where e.g. an antigen binding domain is specific for a particular epitope which is carried by a number of antigens, in which case the specific binding member carrying the antigen binding domain will be able to bind to the various antigens carrying the epitope.
[0154] The term "binding" refers to a direct association between two molecules, due to, for example, covalent, electrostatic, hydrophobic, and ionic and/or hydrogen-bond interactions, including interactions such as salt bridges and water bridges.
[0155] The term "adjuvant" refers to a compound or mixture that enhances the immune response, particularly to an antigen. An adjuvant can serve as a tissue depot that slowly releases the antigen and also as a lymphoid system activator that non-specifically enhances the immune response (Hood et al., Immunology, Second Ed., 1984, Benjamin/Cummings: Menlo Park, Calif., p. 384). Often, a primary challenge with an antigen alone, in the absence of an adjuvant, will fail to elicit a humoral or cellular immune response. Previously known and utilized adjuvants include, but are not limited to, complete Freund's adjuvant, incomplete Freund's adjuvant, saponin, mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil or hydrocarbon emulsions, keyhole limpet hemocyanins, dinitrophenol, and potentially useful human adjuvant such as BCG (Bacille Calmette-Guerin) and Corynebacterium parvum. Mineral salt adjuvants include but are not limited to: aluminum hydroxide, aluminum phosphate, calcium phosphate, zinc hydroxide and calcium hydroxide. Preferably, the adjuvant composition further comprises a lipid of fat emulsion comprising about 10% (by weight) vegetable oil and about 1-2% (by weight) phospholipids. Preferably, the adjuvant composition further optionally comprises an emulsion form having oily particles dispersed in a continuous aqueous phase, having an emulsion forming polyol in an amount of from about 0.2% (by weight) to about 49% (by weight), optionally a metabolizable oil in an emulsion-forming amount of up to 15% (by weight), and optionally a glycol ether-based surfactant in an emulsion-stabilizing amount of up to about 5% (by weight).
[0156] As used herein, the term "immunomodulator" refers to an agent which is able to modulate an immune response. An example of such modulation is an enhancement of antibody production. Another example of such modulation is an enhancement of a T cell response.
[0157] An "immunological response" to a composition or vaccine comprised of an antigen is the development in the host of a cellular- and/or antibody-mediated immune response to the composition or vaccine of interest. Usually, such a response consists of the subject producing antibodies, B cells, helper T cells, suppressor T cells, and/or cytotoxic T cells directed specifically to an antigen or antigens included in the composition or vaccine of interest.
[0158] The term "nucleotide" as used herein refers to a monomeric unit of a polynucleotide that consists of a heterocyclic base, a sugar, and one or more phosphate groups. The naturally occurring bases, (guanine, (G), adenine, (A), cytosine, (C), thymine, (T), and uracil (U)) are derivatives of purine or pyrimidine, though it should be understood that naturally and non-naturally occurring base analogs are also included. The naturally occurring sugar is the pentose (five-carbon sugar) deoxyribose (which forms DNA) or ribose (which forms RNA), though it should be understood that naturally and non-naturally occurring sugar analogs are also included. Nucleic acids are linked via phosphate bonds to form nucleic acids, or polynucleotides, though many other linkages are known in the art (such as, though not limited to phosphorothioates, boranophosphates and the like).
[0159] The terms "nucleic acid" and "polynucleotide" as used herein refer to a polymeric form of nucleotides of any length, either ribonucleotides (RNA) or deoxyribonucleotides (DNA). These terms refer to the primary structure of the molecules and, thus, include double- and single-stranded DNA, and double- and single-stranded RNA. These terms include, as equivalents, analogs of either RNA or DNA made from nucleotide analogs and modified polynucleotides such as, though not limited to, methylated and/or capped polynucleotides.
[0160] A "DNA molecule" refers to the polymeric form of deoxyribonucleotides (adenine, guanine, thymine, or cytosine) in its either single stranded form or a double-stranded helix. This term refers only to the primary and secondary structure of the molecule, and does not limit it to any particular tertiary forms. Thus, this term includes double-stranded DNA found, inter alia, in linear DNA molecules (e.g., restriction fragments), viruses, plasmids, and chromosomes. In discussing the structure of particular double-stranded DNA molecules, sequences can be described herein according to the normal convention of giving only the sequence in the 5' to 3' direction along the non-transcribed strand of DNA (i.e., the strand having a sequence homologous to the mRNA).
[0161] A DNA "coding sequence" or "coding region" is a double-stranded DNA sequence which is transcribed and translated into a polypeptide in vivo when placed under the control of appropriate expression control sequences. The boundaries of the coding sequence (the "open reading frame" or "ORF") are determined by a start codon at the 5' (amino) terminus and a translation stop codon at the 3' (carboxyl) terminus. A coding sequence can include, but is not limited to, prokaryotic sequences, cDNA from eukaryotic mRNA, genomic DNA sequences from eukaryotic (e.g., mammalian) DNA, and synthetic DNA sequences. A polyadenylation signal and transcription termination sequence is, usually, be located 3' to the coding sequence. The term "non-coding sequence" or "non-coding region" refers to regions of a polynucleotide sequence that are not translated into amino acids (e.g. 5' and 3' un-translated regions).
[0162] The term "reading frame" refers to one of the six possible reading frames, three in each direction, of the double stranded DNA molecule. The reading frame that is used determines which codons are used to encode amino acids within the coding sequence of a DNA molecule.
[0163] As used herein, an "antisense" nucleic acid molecule comprises a nucleotide sequence which is complementary to a "sense" nucleic acid encoding a protein, e.g., complementary to the coding strand of a double-stranded cDNA molecule, complementary to an mRNA sequence or complementary to the coding strand of a gene. Accordingly, an antisense nucleic acid molecule can hydrogen bond to a sense nucleic acid molecule.
[0164] The term "base pair" or ("bp"): a partnership of adenine (A) with thymine (T), or of cytosine (C) with guanine (G) in a double stranded DNA molecule. In RNA, uracil (U) is substituted for thymine.
[0165] As used herein a "codon" refers to the three nucleotides which, when transcribed and translated, encode a single amino acid residue; or in the case of UUA, UGA or UAG encode a termination signal. Codons encoding amino acids are well known in the art and are provided for convenience herein in Table 1.
TABLE-US-00001 TABLE 1 Codon Usage Table Codon Amino acid AA Abbr. Codon Amino acid AA Abbr. UUU Phenylalanine Phe F UCU Serine Ser S UUC Phenylalanine Phe F UCC Serine Ser S UUA Leucine Leu L UCA Serine Ser S UUG Leucine Leu L UCG Serine Ser S CUU Leucine Leu L CCU Proline Pro P CUC Leucine Leu L CCC Proline Pro P CUA Leucine Leu L CCA Proline Pro P CUG Leucine Leu L CCG Proline Pro P AUU Isoleucine Ile I ACU Threonine Thr T AUC Isoleucine Ile I ACC Threonine Thr T AUA Isoleucine Ile I ACA Threonine Thr T AUG Methionine Met M ACH Threonine Thr T GUU Valine Val V GCU Alanine Ala A GUC Valine Val V GCC Alanine Ala A GUA Valine Val V GCA Alanine Ala A GUG Valine Val V GCG Alanine Ala A UAU Tyrosine Tyr Y UGU Cysteine Cys C UAC Tyrosine Tyr Y UGC Cysteine Cys C UUA Stop UGA Stop UAG Stop UGG Tryptophan Trp W CAU Histidine His H CGU Arginine Arg R CAC Histidine His H CGC Arginine Arg R CAA Glutamine Gln Q CGA Arginine Arg R CAG Glutamine Gln Q CGG Arginine Arg R AAU Asparagine Asn N AGU Serine Ser S AAC Asparagine Asn N AGC Serine Ser S AAA Lysine Lys K AGA Arginine Arg R AAG Lysine Lys K AGG Arginine Arg R GAU Aspartate Asp D GGU Glycine Gly G GAC Aspartate Asp D GGC Glycine Gly G GAA Glutamate Glu E GGA Glycine Gly G GAG Glutamate Glu E GGG Glycine Gly G
[0166] AA: amino acid; Abbr: abbreviation. It should be understood that the codons specified above are for RNA sequences. The corresponding codons for DNA have a T substituted for U. Optimal codon usage is indicated by codon usage frequencies for expressed genes, for example, as shown in the codon usage chart from the program "Human--High.cod" from the Wisconson Sequence Analysis Package, Version 8.1, Genetics Computer Group, Madison, Wis. Codon usage is also described in, for example, R. Nussinov, "Eukaryotic Dinucleotide Preference Rules and Their Implications for Degenerate Codon Usage," J. Mol. Biol. 149: 125-131 (1981). The codons which are most frequently used in highly expressed human genes are presumptively the optimal codons for expression in human host cells and, thus, form the bases for constructing a synthetic coding sequence.
[0167] As used herein, a "wobble position" refers to the third position of a codon. Mutations in a DNA molecule within the wobble position of a codon, in some embodiments, result in silent or conservative mutations at the amino acid level. For example, there are four codons that encode Glycine, i.e., GGU, GGC, GGA and GGG, thus mutation of any wobble position nucleotide, to any other nucleotide, does not result in a change at the amino acid level of the encoded protein and, therefore, is a silent substitution.
[0168] Accordingly a "silent substitution" or "silent mutation" is one in which a nucleotide within a codon is modified, but does not result in a change in the amino acid residue encoded by the codon. Examples include mutations in the third position of a codon, as well in the first position of certain codons such as in the codon "CGG" which, when mutated to AGG, still encodes Arg.
[0169] The phrase "conservative amino acid substitution" or "conservative mutation" refers to the replacement of one amino acid by another amino acid with a common property. A functional way to define common properties between individual amino acids is to analyze the normalized frequencies of amino acid changes between corresponding proteins of homologous organisms (Schulz, G. E. and R. H. Schirmer, Principles of Protein Structure, Springer-Verlag). According to such analyses, groups of amino acids can be defined where amino acids within a group exchange preferentially with each other, and therefore resemble each other most in their impact on the overall protein structure (Schulz, G. E. and R. H. Schirmer, Principles of Protein Structure, Springer-Verlag).
[0170] Examples of amino acid groups defined in this manner include: a "charged/polar group," consisting of Glu, Asp, Asn, Gln, Lys, Mg and His; an "aromatic, or cyclic group," consisting of Pro, Phe, Tyr and Tip; and an "aliphatic group" consisting of Gly, Ala, Val, Leu, Ile, Met, Ser, Thr and Cys.
[0171] Within each group, subgroups can also be identified, for example, the group of charged/polar amino acids can be sub-divided into the sub-groups consisting of the "positively-charged sub-group," consisting of Lys, Arg and His; the negatively-charged sub-group," consisting of Glu and Asp, and the "polar sub-group" consisting of Asn and Gln.
[0172] The aromatic or cyclic group can be sub-divided into the sub-groups consisting of the "nitrogen ring sub-group," consisting of Pro, His and Tip; and the "phenyl sub-group" consisting of Phe and Tyr.
[0173] The aliphatic group can be sub-divided into the sub-groups consisting of the "large aliphatic non-polar sub-group," consisting of Val, Leu and Ile; the "aliphatic slightly-polar sub-group," consisting of Met, Ser, Thr and Cys; and the "small-residue sub-group," consisting of Gly and Ala.
[0174] Examples of conservative mutations include amino acid substitutions of amino acids within the sub-groups above, for example, Lys for Arg and vice versa such that a positive charge can be maintained; Glu for Asp and vice versa such that a negative charge can be maintained; Ser for Thr such that a free --OH can be maintained; and Gln for Asn such that a free --NH2 can be maintained.
[0175] "Semi-conservative mutations" include amino acid substitutions of amino acids with the same groups listed above, that do not share the same sub-group. For example, the mutation of Asp for Asn, or Asn for Lys all involve amino acids within the same group, but different sub-groups.
[0176] "Non-conservative mutations" involve amino acid substitutions between different groups, for example Lys for Leu, or Phe for Ser etc.
[0177] The term "amino acid residue" refers to the radical derived from the corresponding alpha-amino acid by eliminating the OH portion of the carboxyl group and the H-portion of the alpha amino group. For the most part, the amino acids used in the application are those naturally occurring amino acids found in proteins, or the naturally occurring anabolic or catabolic products of such amino acids which contain amino and carboxyl groups. Alternatively, un-natural amino acids can be incorporated into proteins to facilitate the chemical conjugation to other proteins, toxins, small organic compounds or anti-cancer agents (Datta et al., J Am Chem. Soc. 2002; 124(20):5652-3). The abbreviations used herein for designating the amino acids and the protective groups are based on recommendations of the IUPAC-IUB Commission on Biochemical Nomenclature (see Biochemistry (1972) 11: 1726-1732). The term "amino acid residue" also includes analogs, derivatives and congeners of any specific amino acid referred to herein, as well as C-terminal or N-terminal protected amino acid derivatives (e.g., modified with an N-terminal or C-terminal protecting group). For example, the present invention contemplates the use of amino acid analogs wherein a side chain is lengthened or shorted while still providing a carboxyl, amino or other reactive precursor functional group for cyclization, as well as amino acid analogs having variant side chains with appropriate functional groups).
[0178] The term "amino acid side chain" is that part of an amino acid exclusive of the --CH--(NH2)COOH portion, as defined by K. D. Kopple, "Peptides and Amino Acids," W. A. Benjamin Inc., New York and Amsterdam, 1996, pages 2 and 33; examples of such side chains of the common amino acids are --CH2CH2SCH3 (the side chain of methionine), --CH2(CH3)--CH2CH3 (the side chain of isoleucine), --CH2CH(CH3)2 (the side chain of leucine) or H-- (the side chain of glycine).
[0179] The amino acid residues described herein are preferred to be in the "L" isomeric form. However, residues in the "D" isomeric form can be substituted for any L-amino acid residue, as long as the desired functional property of antibody (immunoglobulin)-binding is retained by the polypeptide. NH2 refers to the free amino group present at the amino terminus of a polypeptide. COOH refers to the free carboxy group present at the carboxy terminus of a polypeptide.
[0180] An "amino acid motif" is a sequence of amino acids, optionally a generic set of conserved amino acids, associated with a particular functional activity.
[0181] As used herein, the terms "protein," "peptide" and "polypeptide" are used interchangeably to refer to polymers of amino acid residues of any length connected to one another by peptide bonds between the alpha-amino group and carboxy group of contiguous amino acid residues. Polypeptides, proteins and peptides can exist as linear polymers, branched polymers or in circular form. These terms also include forms that are post-translationally Modified in vivo or chemically modified during synthesis.
[0182] It should be noted that all amino acid residue sequences are represented herein by formulae whose left and right orientation is in the conventional direction of amino-terminus to carboxy terminus. Furthermore, it should be noted that a dash at the beginning or end of an amino acid residue sequence indicates a peptide bond to a further sequence of one or more amino-acid residues.
[0183] The terms "gene," "recombinant gene" and "gene construct" as used herein, refer to a DNA molecule, or portion of a DNA molecule, that encodes a protein or a portion thereof. The DNA molecule can contain an open reading frame encoding the protein (as exon sequences) and can further include intron sequences. The term "intron" as used herein, refers to a DNA sequence present in a given gene which is not translated into protein and is found in some, but not all cases, between exons. It can be desirable for the gene to be operably linked to, (or it can comprise), one or more promoters, enhancers, repressors and/or other regulatory sequences to modulate the activity or expression of the gene, as is well known in the art.
[0184] As used herein, a "complementary DNA" or "cDNA" includes recombinant polynucleotides synthesized by reverse transcription of mRNA and from which intervening sequences (introns) have been removed.
[0185] The term "operably linked" as used herein, describes the relationship between two polynucleotide regions such that they are functionally related or coupled to each other. For example, a promoter (or other expression control sequence) is operably linked to a coding sequence if it controls (and is capable of effecting) the transcription of the coding sequence. Although an operably linked promoter can be located upstream of the coding sequence, it is not necessarily contiguous with it.
[0186] "Expression control sequences" are DNA regulatory sequences, such as promoters, enhancers, polyadenylation signals, terminators, internal ribosome entry sites (IRES) and the like, that provide for the expression of a coding sequence in a host cell. Exemplary expression control sequences are described in Goeddel; Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990).
[0187] A "promoter" is a DNA regulatory region capable of binding RNA polymerase in a cell and initiating transcription of a downstream (3' direction) coding sequence. As used herein, the promoter sequence is bounded at its 3' terminus by the transcription initiation site and extends upstream (5' direction) to include the minimum number of bases or elements necessary to initiate transcription at levels detectable above background. A transcription initiation site (conveniently defined by mapping with nuclease S1) can be found within a promoter sequence, as well as protein binding domains (consensus sequences) responsible for the binding of RNA polymerase. Eukaryotic promoters can often, but not always, contain "TATA" boxes and "CAT" boxes. Prokaryotic promoters contain Shine-Dalgarno sequences in addition to the -10 and -35 consensus sequences.
[0188] A large number of promoters, including constitutive, inducible and repressible promoters, from a variety of different sources are well known in the art. Representative sources include for example, viral, mammalian, insect, plant, yeast, and bacterial cell types), and suitable promoters from these sources are readily available, or can be made synthetically, based on sequences publicly available on line or, for example, from depositories such as the ATCC as well as other commercial or individual sources. Promoters can be unidirectional (i.e., initiate transcription in one direction) or bi-directional (i.e., initiate transcription in either a 3' or 5' direction). Non-limiting examples of promoters include, for example, the T7 bacterial expression system, pBAD (araA) bacterial expression system, the cytomegalovirus (CMV) promoter, the SV40 promoter, the RSV promoter. Inducible promoters include the Tet system, (U.S. Pat. Nos. 5,464,758 and 5,814,618), the Ecdysone inducible system (No et al., Proc. Natl. Acad. Sci. (1996) 93 (8): 3346-3351; the T-REx® system (Invitrogen Carlsbad, Calif.), LacSwitch® (Stratagene, (San Diego, Calif.) and the Cre-ERT tamoxifen inducible recombinase system (Indra et al. Nuc. Acid. Res. (1999) 27 (22): 4324-4327; Nuc. Acid. Res. (2000) 28 (23): e99; U.S. Pat. No. 7,112,715; and Kramer & Fussenegger, Methods Mol. Biol. (2005) 308: 123-144) or any promoter known in the art suitable for expression in the desired cells.
[0189] As used herein, a "minimal promoter" refers to a partial promoter sequence which defines the transcription start site but which by itself is not capable, if at all, of initiating transcription efficiently. The activity of such minimal promoters depends on the binding of activators such as a tetracycline-controlled transactivator to operably linked binding sites.
[0190] The terms "IRES" or "internal ribosome entry site" refer to a polynucleotide element that acts to enhance the translation of a coding sequence encoded with a. polycistronic messenger RNA. IRES elements, mediate the initiation of translation by directly recruiting and binding ribosomes to a messenger RNA (mRNA) molecule, bypassing the 7-methyl guanosine-cap involved in typical ribosome scanning. The presence of an IRES sequence can increase the level of cap-independent translation of a desired protein. Early publications descriptively refer to IRES sequences as "translation enhancers." For example, cardioviral RNA "translation enhancers" are described in U.S. Pat. No. 4,937,190 to Palmenberg, et al. and U.S. Pat. No. 5,770,428 to Boris-Lawrie.
[0191] The terms "nuclear localization signal" and "NLS" refer to a domain, or domains capable of mediating the nuclear import of a protein or polynucleotide, or retention thereof, within the nucleus of a cell. A "strong nuclear import signal" represents a domain or domains capable of mediating greater than 90% subcellular localization in the nucleus when operatively linked to a protein of interest. Representative examples of NLSs include but are not limited to, monopartite nuclear localization signals, bipartite nuclear localization signals and N and C-terminal motifs. N terminal basic domains usually conform to the consensus sequence K-K/R-X-K/R which was first discovered in the SV40 large T antigen and which represents a monopartite NLS. One non-limiting example of an N-terminal basic domain NLS is PKKKRKV (SEQ ID NO: 340). Also known are bipartite nuclear localization signals which contain two clusters of basic amino acids separated by a spacer of about 10 amino acids, as exemplified by the NLS from nucleoplasmin: KR[PAATKKAGQA]KKKK (SEQ ID NO: 366). N and C-terminal motifs include, for example, the acidic M9 domain of hnRNP A1, the sequence KIPIK (SEQ ID NO: 381) in yeast transcription repressor Matα2 and the complex signals of U snRNPs. Most of these NLSs appear to be recognized directly by specific receptors of the importin β family.
[0192] The term "enhancer" as used herein, refers to a DNA sequence that increases transcription of, for example, a gene or coding sequence to which it is operably linked. Enhancers can be located many kilobases away from the coding sequence and can mediate the binding of regulatory factors, patterns of DNA methylation or changes in DNA structure. A large number of enhancers, from a variety of different sources are well known in the art and available as or within cloned polynucleotides (from, e.g., depositories such as the ATCC as well as other commercial or individual sources). A number of polynucleotides comprising promoters (such as the commonly-used CMV promoter) also comprise enhancer sequences. Operably linked enhancers can be located upstream, within, or downstream of coding sequences. The term "Ig enhancers" refers to enhancer elements derived from enhancer regions mapped within the Ig locus (such enhancers include for example, the heavy chain (mu) 5' enhancers, light chain (kappa) 5' enhancers, kappa and mu intronic enhancers, and 3' enhancers, (see, e.g., Paul W E (ed) Fundamental Immunology, 3rd Edition, Raven Press, New York (1993) pages 353-363; U.S. Pat. No. 5,885,827).
[0193] "Terminator sequences"" are those that result in termination of transcription. Termination sequences are known in the art and include, but are not limited to, poly A (e.g., Bgh Poly A and SV40 Poly A) terminators. A transcriptional termination signal will typically include a region of 3' untranslated region (or "3' ut"), an optional intron (also referred to as intervening sequence or "IVS") and one or more poly adenylation signals ("p(A)" or "pA." Terminator sequences may also be referred to as "IVS-pA," "IVS+p(A)," "3' ut+p(A)" or "3' ut/p(A)." Natural or synthetic terminators can be used as a terminator region.
[0194] The terms "polyadenylation," "polyadenylation sequence," "polyadenylation signal," "Poly A," "p(A)" or "pA" refer to a nucleic acid sequence present in a RNA transcript that allows for the transcript, when in the presence of the polyadenyl transferase enzyme, to be polyadenylated. Many polyadenylation signals are known in the art. Non-limiting examples include the human variant growth hormone polyadenylation signal, the SV40 late polyadenylation signal and the bovine growth hormone polyadenylation signal.
[0195] The term "splice site" as used herein refers to polynucleotides that are capable of being recognized by the spicing machinery of a eukaryotic cell as suitable for being cut and/or ligated to a corresponding splice site. Splice sites allow for the excision of introns present in a pre-mRNA transcript. In one example, the 5' portion of the splice site is referred to as the splice donor and the 3' corresponding splice site is referred to as the acceptor splice site. The term splice site includes, for example, naturally occurring splice sites, engineered splice sites, for example, synthetic splice sites, canonical or consensus splice sites, and/or non-canonical splice sites, for example, cryptic splice sites.
[0196] A "signal sequence" can be included before the coding sequence. This sequence encodes a signal peptide, N-terminal to the polypeptide, that communicates to the host cell to direct the polypeptide to the cell surface or secrete the polypeptide into the media, and this signal peptide is clipped off by the host cell before the protein leaves the cell. Signal sequences can be found associated with a variety of proteins native to prokaryotes and eukaryotes.
[0197] "Post-translational modification" can encompass any one of or combination of modification(s), including covalent modification(s), which a protein undergoes after translation is complete and after being released from the ribosome or on the nascent polypeptide co-translationally. Posttranslational modification includes but is not limited to phosphorylation, myristylation, ubiquitination, glycosylation, coenzyme attachment, methylation, S-nitrosylation and acetylation. Posttranslational modification can modulate or influence the activity of a protein, its intracellular or extracellular destination, its stability or half-life, and/or its recognition by ligands, receptors or other proteins. Post-translational modification can occur in cell organelles, in the nucleus or cytoplasm or extracellularly.
[0198] The term "primer" as used herein refers to an oligonucleotide, whether occurring naturally as in a purified restriction digest or produced synthetically, which is capable of acting as a point of initiation of synthesis when placed under conditions in which synthesis of a primer extension product, which is complementary to a nucleic acid strand; is induced, i.e., in the presence of nucleotides and an inducing agent such as a DNA polymerase and at a suitable temperature and pH. The primer can be either single-stranded or double-stranded and must be sufficiently long to prime the synthesis of the desired extension product in the presence of the inducing agent. The exact length of the primer can depend upon many factors, including temperature, source of primer and use of the method. For example, for diagnostic applications, depending on the complexity of the target sequence, an oligonucleotide primer can contain about 15 to about 25 or more nucleotides, although it can contain fewer nucleotides.
[0199] The primers herein are selected to be "substantially" complementary to different strands of a particular target polynucleotide sequence. This means that the primers must be sufficiently complementary to hybridize with their respective strands. Therefore, the primer sequence need not reflect the exact sequence of the template. For example, a non-complementary nucleotide fragment can be attached to the 5' end of the primer, with the remainder of the primer sequence being complementary to the strand. Alternatively, non-complementary bases or longer sequences can be interspersed into the primer, provided that the primer sequence has sufficient complementarity with the sequence of the strand to hybridize therewith and thereby form the template for the synthesis of the extension product.
[0200] As used herein, the terms "restriction endonucleases" and "restriction enzymes" refer to bacterial enzymes, each of which cut double-stranded DNA at or near a specific nucleotide sequence.
[0201] The term "multiple cloning site" as used herein, refers to a segment of a vector polynucleotide which can recognize several different restriction enzymes.
[0202] A "replicon" is any genetic element (e.g., plasmid, episome, chromosome, YAC, virus) that functions as an autonomous unit of DNA replication in vivo; i.e., capable of replication under its own control, and containing autonomous replicating sequences.
[0203] A "vector" or "cloning vector" is a replicon, such as plasmid, phage or cosmid, to which another polynucleotide segment can be introduced so as to bring about the replication of the inserted segment. Vectors can exist as circular, double stranded DNA, and range in size form a few kilobases (kb) to hundreds of kb. Preferred cloning vectors have been modified from naturally occurring plasmids to facilitate the cloning and recombinant manipulation of polynucleotide sequences. Many such vectors are well known in the art; see for example, by Sambrook (In. "Molecular Cloning: A Laboratory Manual," second edition, edited by Sambrook, Fritsch, & Maniatis, Cold Spring Harbor Laboratory, (1989)), Maniatis, In: Cell Biology: A Comprehensive Treatise, Vol. 3, Gene Sequence Expression, Academic Press, NY, pp. 563-608 (1980).
[0204] The term "expression vector" as used herein, refers to a vector used for expressing certain polynucleotides within a host cell or in-vitro expression system. The term includes plasmids, episomes, cosmids retroviruses or phages; the expression vector can be used to express a DNA sequence encoding a desired protein and in one aspect includes a transcriptional unit comprising an assembly of expression control sequences. The choice of promoter and other regulatory elements can vary according to the intended host cell, or in-vitro expression system.
[0205] As used herein, a "recombination system" refers to one which allows for recombination between a vector of the present application and a chromosome for incorporation of a gene of interest. Recombination systems are known in the art and include Cre/Lox systems and FLP-IN systems.
[0206] As used herein an "in vitro expression system" refers to cell free systems that enable the transcription, or coupled transcription and translation of DNA templates. Such systems include for example the classical rabbit reticulocyte system, as well as novel cell free synthesis systems, (J. Biotechnol. (2004) 110 (3): 257-63; Biotechnol Annu. Rev. (2004) 10:1-30).
[0207] As used herein, a "Cre/Lox" system refers to one such as described by Abremski et al., Cell, 32: 1301-1311 (1983) for a site-specific recombination system of bacteriophage P1. Methods of using Cre-Lox systems are known in the art; see, for example, U.S. Pat. No. 4,959,317, which is hereby incorporated in its entirety by reference. The system consists of a recombination site designated loxP and a recombinase designated Cre. In methods for producing site-specific recombination of DNA in eukaryotic cells, DNA sequences having first and second lox sites can be introduced into eukaryotic cells and contacted with Cre, thereby producing recombination at the lox sites.
[0208] As used here, "FLP-IN" recombination refers to systems in which a polynucleotide activation/inactivation and site-specific integration system has been developed for mammalian cells. The system is based on the recombination of transfected sequences by FLP, a recombinase derived from Saccharomyces. In several cell lines, FLP has been shown to rapidly and precisely recombine copies of its specific target sequence. FLP-1N systems have been described in, for example, U.S. Pat. Nos. 5,654,182 and 5,677,177).
[0209] The term "transfection," "transformation," or "transduction" as used herein, refers to the introduction of one or more exogenous polynucleotides into a host cell by using one or physical or chemical methods. Many transfection techniques are known to those of ordinary skill in the art including but not limited to calcium phosphate DNA co-precipitation (see Methods in Molecular Biology, Vol. 7, Gene Transfer and Expression Protocols, Ed. E. J. Murray, Humana Press (1991)); DEAE-dextran; electroporation; cationic liposome-mediated transfection; tungsten particle-facilitated microparticle bombardment (Johnston, S. A., Nature 346: 776-777 (1990)); and strontium phosphate DNA co-precipitation (Brash D. E. et al. Molec. Cell. Biol. 7: 2031-2034 (1987). Phage, or retroviral vectors can be introduced into host cells, after growth of infectious particles in packaging cells that are commercially available.
[0210] The terms "cells," "cell cultures," "cell line," "recombinant host cells," "recipient cells" and "host cells" are often used interchangeably and will be clear from the context in which they are used. These terms include the primary subject cells and any progeny thereof, without regard to the number of transfers. It should be understood that not all progeny are exactly identical to the parental cell (due to deliberate or inadvertent mutations or differences in environment), however, such altered progeny are included in these terms, so long as the progeny retain the same functionality as that of the originally transformed cell. For example, though not limited to, such a characteristic might be the ability to produce a particular recombinant protein. A "mutator positive cell line" is a cell line containing cellular factors that are sufficient to work in combination with other vector elements to affect hypermutation. The cell line can be any of those known in the art or described herein. A "clone" is a population of cells derived from a single cell or common ancestor by mitosis.
[0211] A "reporter gene" refers to a polynucleotide that confers the ability to be specifically detected (or detected and selected), when expressed with a cell of interest. Numerous reporter gene systems are known in the art and include, for example, alkaline phosphatase (Berger, J., et al., Gene 66: 1-10 (1988); Kain, S R., Methods Mol. Biol. 63: 49-60 (1997)), beta-galactosidase (U.S. Pat. No. 5,070,012), chloramphenicol acetyltransferase (Gorman et al., Mol. Cell. Biol. 2: 1044-51 (1982)), beta glucuronidase, peroxidase, beta lactamase (U.S. Pat. Nos. 5,741,657, 5,955,604), catalytic antibodies, luciferases (U.S. Pat. Nos. 5,221,623; 5,683,888; 5,674,713; 5,650,289; 5,843,746) and naturally fluorescent proteins (Tsien, R Y, Annu. Rev. Biochem. 67 509-544 (1998)). The term "reporter gene," also includes any peptide which can be specifically detected based on the use of one or more, antibodies, epitopes, binding partners, substrates, modifying enzymes, receptors, or ligands that are capable of, or desired to (or desired not to), interact with the peptide of interest to create a detectable signal. Reporter genes also include genes that can modulate cellular phenotype.
[0212] The term "selectable marker gene" as used herein, refers to polynucleotides that allow cells carrying the polynucleotide to be specifically selected for or against, in the presence of a corresponding selective agent. Selectable markers can be positive, negative or bifunctional. Positive selectable markers allow selection for cells carrying the marker, whereas negative selectable markers allow cells carrying the marker to be selectively eliminated. The selectable marker polynucleotide can either be directly linked to the polynucleotides to be expressed, or introduced into the same cell by co-transfection. A variety of such marker polynucleotides have been described, including bifunctional (i.e., positive/negative) markers (see, e.g., WO 92/08796, published May 29, 1992, and WO 94/28143, published Dec. 8, 1994), hereby incorporated in their entirety by reference herein. Specific examples of selectable markers of drug-resistance genes include, but are not limited to, ampicillin, tetracycline, blasticidin, puromycin, hygromycin, ouabain or kanamycin. Specific examples of selectable markers are those, for example, that encode proteins that confer resistance to cytostatic or cytocidal drugs, such as the DHFR protein, which confers resistance to methotrexate (Wigler et al., Proc. Natl. Acad. Sci. USA, 77:3567 (1980); O'Hare et al., Proc. Natl. Acad. Sci. USA, 78:1527 (1981)); the GPF protein, which confers resistance to mycophenolic acid (Mulligan & Berg, Proc. Natl. Acad. Sci. USA, 78:2072 (1981)), the neomycin resistance marker, which confers resistance to the aminoglycoside G-418 (Colberre-Garapin et al., J. Mol. Biol., 150:1 (1981)); the hygromycin protein, which confers resistance to hygromycin (Santerre et al., Gene, 30:147 (1984)); murine Na+, K+-ATPase alpha subunit, which confers resistance to ouabain (Kent et al., Science, 237:901-903 (1987); and the Zeocin® resistance marker (available commercially from Invitrogen). In addition, the herpes simplex virus thymidine kinase (Wigler et al., Cell, 11:223 (1977)), hypoxanthine-guanine phosphoribosyltransferase (Szybalska & Szybalski, Proc. Natl. Acad. Sci. USA, 48:2026 (1962)), and adenine phosphoribosyltransferase (Lowy et al., Cell, 22:817 (1980)) can be employed in tk.sup.-, hgprt.sup.- or aprt.sup.- cells, respectively. Glutamine synthetase permits the growth of cells in glutamine(GS)-free media (see, e.g., U.S. Pat. Nos. 5,122,464; 5,770,359; and 5,827,739). Other selectable markers encode, for example, puromycin N-acetyl transferase or adenosine deaminase.
[0213] "Homology" or "identity" or "similarity" refers to sequence similarity between two peptides or between two nucleic acid molecules. Homology and identity can each be determined by comparing a position in each sequence which can be aligned for purposes of comparison. When an equivalent position in the compared sequences is occupied by the same base or amino acid, then the molecules are identical at that position; when the equivalent site occupied by the same or a similar amino acid residue (e.g., similar in steric and/or electronic nature), then the molecules can be referred to as homologous (similar) at that position. Expression as a percentage of homology/similarity or identity refers to a function of the number of identical or similar amino acids at positions shared by the compared sequences. A sequence which is "unrelated" or "non-homologous" shares less than 40% identity, less than 35% identity, less than 30% identity, or less than 25% identity with a sequence of the present invention. In comparing two sequences, the absence of residues (amino acids or nucleic acids) or presence of extra residues also decreases the identity and homology/similarity.
[0214] The term "homology" describes a mathematically based comparison of sequence similarities which is used to identify genes or proteins with similar functions or motifs. The nucleic acid and protein sequences of the present invention can be used as a "query sequence" to perform a search against public databases to, for example, identify other family members, related sequences or homologs. Such searches can be performed using the NBLAST and) (BLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10. BLAST nucleotide searches can be performed with the NBLAST program, score=100, wordlength=12 to obtain nucleotide sequences homologous to nucleic acid molecules of the invention. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to protein molecules of the invention. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25(17):3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and BLAST) can be used (See www.ncbi.nhn.nih.gov).
[0215] As used herein, "identity" means the percentage of identical nucleotide or amino acid residues at corresponding positions in two or more sequences when the sequences are aligned to maximize sequence matching, i.e., taking into account gaps and insertions. Identity can be readily calculated by known methods, including but not limited to those described in (Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM J. Applied Math., 48: 1073 (1988). Methods to determine identity are designed to give the largest match between the sequences tested. Moreover, methods to determine identity are codified in publicly available computer programs. Computer program methods to determine identity between two sequences include, but are not limited to, the GCG program package (Devereux, J., et al., Nucleic Acids Research 12(1): 387 (1984)), BLASTP, BLASTN, and FASTA (Altschul, S. F. et al., J. Molec. Biol. 215: 403-410 (1990) and Altschul et al. Nuc. Acids Res. 25: 3389-3402 (1997)). The BLAST X program is publicly available from NCBI and other sources (BLAST Manual, Altschul, S., et al., NCBI NLM NIH Bethesda, Md. 20894; Altschul, S., et al., J. Mol. Biol. 215: 403-410 (1990). The well known Smith Waterman algorithm can also be used to determine identity.
[0216] A "heterologous" region of a DNA sequence is an identifiable segment of DNA within a larger DNA sequence that is not found in association with the larger sequence in nature. Thus, when the heterologous region encodes a mammalian gene, the gene can usually be flanked by DNA that does not flank the mammalian genomic DNA in the genome of the source organism. Another example of a heterologous coding sequence is a sequence where the coding sequence itself is not found in nature (e.g., a cDNA where the genomic coding sequence contains introns or synthetic sequences having codons or motifs different than the unmodified gene). Allelic variations or naturally-occurring mutational events do not give rise to a heterologous region of DNA as defined herein.
[0217] The term "activation-induced cytidine deaminase" or ("AID") refers to members of the AID/APOBEC family of RNA/DNA editing cytidine deaminases capable of mediating the deamination of cytosine to uracil within a DNA sequence. (See, e.g., Conticello et al., Mol. Biol. Evol. 22 No 2 367-377 (2005), "Evolution of the AID/APOBEC Family of Polynucleotide (Deoxy)cytidine Deaminases" and U.S. Pat. No. 6,815,194). Suitable AID enzymes include all vertebrate forms of the enzyme, including, for example, primate, rodent, avian and bony fish. Representative examples of AID enzymes include without limitation, human (GenBank Accession No. NP--065712), rat, chicken, canine and mouse (GenBank Accession No. NP--033775) forms. The term "AID homolog" refers to the enzymes of the Apobec family and include, for example, Apobec and, in particular, can be selected from Apobec family members such as Apobec-1, Apobec3C or Apobec3G (described, for example, by Jarmuz et al., (2002) Genomics, 79: 285-296) (2002)). AID and AID homologs also include, without limitation, modified polypeptides (e.g. mutants or muteins) that retain the ability to deaminate a polynucleotide sequence. The term "AID activity" includes activity mediated by AID and AID homologs.
[0218] The term "transition mutations" refers to base changes in a DNA sequence in which a pyrimidine (cytidine (C) or thymidine (T) is replaced by another pyrimidine, or a purine (adenosine (A) or guanosine (G) is replaced by another purine.
[0219] The term "transversion mutations" refers to base changes in a DNA sequence in which a pyrimidine (cytidine (C) or thymidine (T) is replaced by a purine (adenosine (A) or guanosine (G), or a purine is replaced by a pyrimidine.
[0220] The term "base excision repair" refers to a DNA repair pathway that removes single bases from DNA such as uridine nucleotides arising by deamination of cytidine. Repair is initiated by uracil glycosylase that recognizes and removes uracil from single- or double-stranded DNA to leave an abasic site.
[0221] The term "mismatch repair" refers to the repair pathway that recognizes and corrects mismatched bases, such as those that arise from errors of chromosomal DNA replication.
[0222] The term "pol eta" (also called PolH, RAD30A, XPV, XP-V) refers to a low-fidelity DNA polymerase that plays a role in replication through lesions, for instance, replication through UV-induced thymidine dimers. The gene for pol eta is defective in Xeroderma pigmentosum variant type protein, XPV. On non-damaged DNA, pol eta misincorporates incorrect nucleotides at a rate of approximately 3 per 100 bp, and is especially error-prone when replicating through templates containing WA dinucleotides (W=A or T) (Gearhart and Wood, 2001). Pol eta has been shown to play an important role as an A/T mutator during SHM in immunoglobulin variable genes (Zeng et al., 2001). Representative examples of pol eta include without limitation, human (GenBank Accession No. BAA81666), rat (GenBank Accession No. XP--001066743), chicken (GenBank Accession No. NP--001001304), canine (GenBank Accession No. XP--532150) and mouse (GenBank Accession No. NP--109640) forms.
[0223] The term "pol theta" (also called PolQ) refers to a low-fidelity DNA polymerase that may play a role in crosslink repair (Gearhart and Wood, Nature Rev Immunol 1: 187-192 (2001)) and contains an intrinsic ATPase-helicase domain (Kawamura et al., Int. J. Cancer 109(1):9-16 (2004)). The polymerase is able to efficiently replicate through an abasic site by functioning both as a mispair inserter and as a mispair extender (Zan et al., EMBO Journal 24, 3757-3769 (2005)). Representative examples of pol theta include without limitation, human (GenBank Accession No. NP--955452), rat (GenBank Accession No. XP--221423), chicken (GenBank Accession No. XP--416549), canine (GenBank Accession No. XP--545125) and mouse (GenBank Accession No. NP--084253) forms. Pol ete and Pol theta are sometimes referred to collectively as "error prone polymerases."
[0224] As used herein, the term "SHM hot spot" or "hot spot" or "hot spot motif" refers to a polynucleotide sequence or motif of 3-6 nucleotides (i.e., 1-2 codons) that exhibits an increased tendency to undergo SHM, as determined via a statistical analysis of SHM mutations in antibody genes (see Tables 2 and 3 which provide a relative ranking of various motifs for SHM, and Table 7 which lists canonical hot spots and cold spots). The statistical analysis can be extrapolated to analysis of SHM mutations in non-antibody genes as described elsewhere herein. For the purposes of graphical representations of hot spots in Figures, the first nucleotide of a canonical hot spot is represented by the letter "H."
[0225] Likewise, as used herein, a "SHM coldspot" or "cold spot" or "cold spot motif" refers to a polynucleotide or motif of 3-6 nucleotides (i.e., 1-2 codons) that exhibits a decreased tendency to undergo SHM, as determined via a statistical analysis of SHM mutations in antibody genes (see Tables 2 and 3 which provide a relative ranking of various motifs for SHM, and Table 7 which lists canonical hot spots and cold spots). The statistical analysis can be extrapolated to analysis of SHM mutations in non-antibody genes as described elsewhere herein. For the purposes of graphical representations of cold spots in Figures, the first nucleotide of a canonical cold spot is represented by the letter "C."
[0226] The term "somatic hypermutation motif" or "SHM motif" refers to a polynucleotide sequence that includes, or can be altered to include, one or more hot spots and/or cold spots, and which encodes a defined set of amino acids. SHM motifs can be of any size, but are conveniently based around polynucleotides of about 2 to about 20 nucleotides in size, preferred SHM motifs range from about 3 to about 9 nucleotides in size. SHM motifs can include any combination of canonical hot spots and/or cold spots, or may lack both canonical hot spots and/or cold spots.
[0227] The term "preferred SHM motif" refers to one or more preferred SHM codons (see Table 7 infra).
[0228] The terms "preferred hot spot SHM codon," "preferred hot spot SHM motif," "preferred SHM hot spot codon" and "preferred SHM hot spot motif," all refer to a codon including, but not limited to codons AAC, TAC, TAT, AGT and AGC. Such sequences may be potentially embedded within the context of a larger SHM motif, recruit SHM mediated mutagenesis and generate targeted amino acid diversity at that codon.
[0229] A polynucleotide sequence has been "optimized for SHM" if the polynucleotide, or a portion thereof has been altered to increase or decrease the frequency and/or location of hot spots and/or cold spots within the polynucleotide. A polynucleotide that has been made "susceptible to SHM" if the polynucleotide, or a portion thereof, has been altered to increase the frequency (density) and/or location of hot spots within the polynucleotide or to decrease the frequency and/or location of cold spots within the polynucleotide. Conversely, a polynucleotide that has been made "resistant to SHM" if the polynucleotide, or a portion thereof, has been altered to decrease the frequency and/or location of hot spots and/or has been altered to increase the frequency (density) and/or location of cold spots within the polynucleotide. In one embodiment, a sequence can be prepared that has a greater or lesser susceptibility (or rate) to undergo SHM-mediated mutagenesis by altering the codon usage, and/or the amino acids encoded by polynucleotide sequence relative to the unmodified polynucleotide.
[0230] Optimization of a polynucleotide sequence refers to modifying about 1%, about 2%, about 3%, about 4%, about 5%, about 10%, about 20%, about 25%, about 50%, about 75%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, 100% or any range therein of the nucleotides in the polynucleotide sequence. Optimization of a polynucleotide sequence also refers to modifying about 1, about 2, about 3, about 4, about 5, about 10, about 20, about 25, about 50, about 75, about 90, about 95, about 96, about 97, about 98, about 99, about 100, about 200, about 300, about 400, about 500, about 750, about 1000, about 1500, about 2000, about 2500, about 3000 or more, or any range therein of the nucleotides in the polynucleotide sequence such that some or all of the nucleotides are optimized for SHM-mediated mutagenesis. Reduction in the frequency (density) of hot spots and/or cold spots refers to reducing about 1%, about 2%, about 3%, about 4%, about 5%, about 10%, about 20%, about 25%, about 50%, about 75%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, 100% or any range therein of the hot spots or cold spots in a polynucleotide sequence. Increasing the frequency (density) of hot spots and/or cold spots refers to increasing about 1%, about 2%, about 3%, about 4%, about 5%, about 10%, about 20%, about 25%, about 50%, about 75%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, 100% or any range therein of the hot spots or cold spots in a polynucleotide sequence.
[0231] The position or reading frame of a hot spot or cold spot is also a factor governing whether SHM mediated mutagenesis that can result in a mutation that is silent with regards to the resulting amino acid sequence, or causes conservative, semi-conservative or non conservative changes at the amino acid level. As discussed below, these design parameters can be manipulated to further enhance the relative susceptibility or resistance of a nucleotide sequence to SHM. Thus both the degree of SHM recruitment and the reading frame of the motif are considered in the design of SHM susceptible and SHM resistant polynucleotide sequences.
[0232] As used herein, "somatic hypermutation" or "SHM" refers to the mutation of a polynucleotide initiated by, or associated with the action of activation-induced cytidine deaminase, uracil glycosylase and/or error prone polymerases on that polynucleotide sequence. The term is intended to include mutagenesis that occurs as a consequence of the error prone repair of the initial lesion, including mutagenesis mediated by the mismatch repair machinery and related enzymes.
[0233] As used herein, the term "UDG" refers to uracil DNA glycosylase, one of several DNA glycosylases that recognize different damaged DNA bases and remove them before replication of the genome. DNA glycosylases can remove DNA bases that are cytotoxic or cause DNA polymerase to introduce errors, and are part of the base excision repair pathway for DNA. Uracil DNA glycosylase recognizes uracil in DNA, a product of cytidine deamination, leading to its removal and potential replacement with a new base.
[0234] The term "isolated" refers to the state in which polypeptides or polynucleotides of the invention will be in accordance with the present invention. Polypeptides or polynucleotides will be free or substantially free of material with which they are naturally associated such as other polypeptides or polynucleotides with which they are found in their natural environment, or the environment in which they are prepared (e.g. cell culture) when such preparation is by recombinant DNA technology practiced in vitro or in vivo. Polypeptides or polynucleotides can be formulated with diluents or adjuvants and still for practical purposes be isolated--for example, the polypeptides or polynucleotides can be mixed with gelatin or other carriers if used to coat microtitre plates for use in immunoassays, or can be mixed with pharmaceutically acceptable carriers or diluents when used in diagnosis or therapy. Polypeptides or polynucleotides can be glycosylated, either naturally or by systems of heterologous eukaryotic cells, or they can be (for example, if produced by expression in a prokaryotic cell) unglycosylated.
[0235] The term "selection" refers to the separation of one or more members, such as polynucleotides, proteins or cells from a library of such members. Selection can involve both detection and selection, for example where cells are selected by use of a fluorescence activated cell sorter (FACS) that detects a reporter gene and then sorts the cells accordingly.
[0236] As used herein, "pg" means picogram, "ng" means nanogram, "ug" or "μg" mean microgram, "mg" means milligram, "g" means gram "ul" or "μl" mean microliter, "ml" means milliliter, "l" means liter, "kb" means kilobases, "nM" means nanomolar, "pM" means picomolar, "fM" means femtomolar, and "M" means molar.
[0237] The phrase "pharmaceutically acceptable" refers to molecular entities and compositions that are physiologically tolerable and do not produce an unsafe reaction.
II. Somatic Hypermutation
[0238] During the generation of antibodies, in vivo point mutations occur within the variable region (V-region) coding sequence of the antigen receptor, and the rate of mutation observed, called SHM, is about a million times greater than the spontaneous mutation rate in other genes. Bachl et al., Increased transcription levels induce higher mutation rates in a hypermutating cell line. J. Immunol. 2001 Apr. 15; 166(8):5051-7; Martin and Scharff, AID and mismatch repair in antibody diversification. Nat Rev Immunol. 2002; 2(8):605-14.
[0239] In humans and mice, after the primary repertoire of antibody specificity is Created by V-D-J rearrangement, and following antigen encounter, the rearranged V genes in those B cells that have been triggered by the antigen are subjected to two further types of genetic modification: SHM which triggers the diversification of the variable region of immunoglobulin genes, generating the secondary repertoire thereby allowing affinity maturation of the humoral response, and Class Switch Recombination (CSR) which involves the specific non-homologous recombination process which leads to isotype changes in the constant region of the expressed antibody. In chickens and rabbits (but not man or mouse) an additional mechanism, gene conversion, is a major contributor to V gene diversity.
[0240] AID is expressed within activated B cells and is an essential protein factor for SHM, CSR and gene conversion (Muramatsu et al., 2000; Revy et al., 2000). AID belongs to a family of enzymes, the APOBEC family, which share certain features with the metabolic cytidine deaminases but differs from them in that AID deaminates nucleotides within single stranded polynucleotides, and cannot utilize free nucleotide as a substrate. Other enzymes of the AID/APOBEC family can also act to deaminate cytidine on single stranded RNA or DNA (Conticello et al., (2005)).
[0241] The human AID protein comprises 198 amino acids and has a predicted molecular weight of 24 kDa. The human AID gene is located at locus 12p13, close to APOBEC-1. The AID protein has a cytidine/deoxycytidine deaminase motif, is dependent on zinc, and can be inhibited by tetrahydrouridine (THU) which is a specific inhibitor of cytidine deaminases.
[0242] Even prior to the discovery of unmodified AID, it was noted that SHM occurs more frequently in cytidines that are within the context of WRCY (AT/GA/C/AT) motifs. There is now accumulating evidence that this motif for SHM likely repreents a composite of this hot spot motif for AID deamination and for initiating error prone repair by the DNA polymerases pol eta and pol theta (Rogozin et al. (2004); Zan et al. (2005)).
[0243] High levels of DNA transcription have been shown necessary but alone are not sufficient for AID-mediated mutagenesis. In vivo, SHM begins about 80 to about 100 nucleotides from the transcription start site, but decreases in frequency as a function of distance from the promoter. Native AID has been shown in vitro to interact directly with the transcriptional elongation complex, but not the transcriptional initiation complex, and this interaction may be dependent upon the dissociation of the initiation factors, that occurs as the transcriptional initiation complex converts to the fully processive, elongation-competent transcription elongation complex (Besmer et al., 2006).
[0244] Since AID is only able to deaminate cytidines on single stranded DNA, it is likely that the requirement for transcription reflects the generation of single stranded regions by transcription bubbles. Studies with purified unmodified AID in vitro, however, suggest that AID binding is sequence independent, potentially allowing a scanning mode for hot spot capture that is driven by active transcription of the gene. In vitro studies suggest that unmodified AID has an apparent Kd for single stranded DNA in the range of 0.3 to 2 nM, and that the complex has a half life of 4-8 minutes. The turnover number of purified unmodified AID on single stranded DNA is approximately one deamination every 4 minutes, (Larijani et al., (2006)).
[0245] AID acts on DNA to deaminate cytidine residues to uracil residues on either strand of the transcribed DNA molecule. If the initial (C→U) lesion is not further modified prior to, or during DNA replication, then an adenosine (A) can be inserted opposite the U nucleotide, ultimately resulting in C→T or G→A transition mutations. The significance of this change at the amino acid level depends upon the location of the nucleotide within the codon within the reading frame. If this mutation occurs in the first or second position of the codon, the result is likely to be a non conservative amino acid substitution. By contrast, if the change occurs at the third position of the codon reading frame, within the wobble position, the practical effect of the mutation at the amino level will be slight because the effect of the nucleotide change will be silent or result in a conservative amino acid substitution.
[0246] Alternatively, the C→U lesion, and potentially the neighboring bases can be acted upon by DNA repair machinery, which in SHM, leads to repair in an error prone fashion. Studies in knock out mice have established that base excision repair via uracil DNA glycosylase (UDG), plays a role in mediating the mutation of A and T residues close to hot spot motifs; (Shen et al (2006)). Additionally there is increasing evidence that the creation of abasic sites by UDG recruits error prone polymerases, such as pol eta and pol theta, and that these polymerases introduce additional mutations at all base positions in the surrounding sequence (Watanabe et al. (2004); Neuberger et al (2005)). It is believed that pol eta is central to the creation of A mutations during SHM and is particularly error prone for coding strand adenosines proceeded by A or T (W/A) that are preferentially mutated to G.
[0247] It has been observed that in antibody genes, codon usage and precise concomitant hot spot/cold spot targeting of AID activity and pol eta errors in the CDRs and FRs, respectively, has evolved under selective pressure to maximize mutations in the variable regions and minimize mutations in the framework regions (Zheng et al., JEM 201(9): 1467-1478 (2005)). For example, Zheng et al. observed that the precise alignment of C and G nucleotides within the codons preferentially used within an antibody gene causes most C to T and G to A mutations to be silent or conservative. Juxaposed on the precise placement of Cs and Gs, Zheng et al., also observed the preferential placement of As and Ts in hot spots of pol eta in the variable regions and the exclusion from these sites in the framework regions.
[0248] The regulation of SHM in vivo and the determinants that direct and limit SHM to the Ig locus has been the subject of intense debate and experimental research. The rate of SHM observed in vivo has been shown to be at least partially dependent upon, for example, the following factors: 1) the AID expression levels and AID activity levels within a particular cell type; (Martin et al. (2002), Rucci et al., (2006)), 2) the degree of AID post translational modification and degree of nuclear localization; (McBride et al. (2006), Pasqualucci et al. (2006), Muto et al. (2006)), 3) the presence of immune locus specific enhancer regions, E-box motifs, or associated cis acting binding factors; (Komori et al. (2006), Schoetz, et al. (2006)), 4) the proximity of the targeted sequence to the transcriptional initiation site/promoter region; (Rada et al., (2001)), 5) the rate of transcription of the target sequence; (Storb et al., (2001)),6) the degree of target gene methylation; (Larijani et al (2005)), 7) the genomic context of the target gene, if integrated into the cell's genomic DNA; 8) the presence or absence of auxiliary factors, such as Pol Eta, MSH2; (Shen et al. (2006)), 9) the existence of hotspot or coldspot sequences within the target sequence; (Zheng et al. (2005)), 10) the existence of inhibitory factors; (Santa-Marta, et al. (2006)), 11) rate of DNA repair within the cell type of interest, (Poltoratsky (2006)), 12) the formation of local DNA or RNA hairpins structures; (Steele et al. (2006)), and 13) the phosphorylation state of histone H2B (Odegard et al. (2005)).
[0249] The present invention is based, in part, upon the optimization of some of the factors above to create both a temporally and spatially controlled system for hypermutation.
III. Identification and Analysis of Polynucleotides for Somatic Hypermutation
[0250] Previous analyses of antibody sequences, see, for example, Zheng et al. J. Exp. Med. (2005); 201(9):1467-1478; and Wang and Wabl, J. Immunol. 2005; 174(9):5650-4, have been based primarily on identifying the polynucleotide sequence motifs involved in SHM rather than elaborating the underlying logical operations that connect multiple rounds of SHM during protein evolution within a polynucleotide sequence.
[0251] As a first step to developing such an improved understanding of the context of one or more rounds of SHM within the reading frame of a polynucleotide sequence, and the underlying logic of relationships within codon usage patterns, the present applicants have used a statistical approach to identify consensus hot spots and cold spots. Such a statistical approach can also be used to functionally track the consequences of those mutations at the nucleotide level and to structural consequences at the amino acid level following SHM by AID.
[0252] Starting from any given polynucleotide sequence, this approach can be used to generate polynucleotide sequences that rapidly converge to structural consequences at the amino acid level a small number of possible sequences that are optimized for the properties described herein.
[0253] Polynucleotides sequences of the present application include fully synthetic polynucleotides, fully synthetic genes, semi-synthetic polynucletides and semi-synthetic genes. "Semi-synthetic polynucletides" and "semi-synthetic genes" as used herein, refer to a polynucleotide sequences that consists in part of a nucleic acid sequence that has been obtained via polymerase chain reaction (PCR) or other similiar enzymatic amplification system which utilizes a natural donor (i.e., peripheral blood monocytes) as the starting material for the amplification reaction. The remaining "synthetic" polynucleotides, i.e., those portions of semi-synthetic polynucleotide not obtained via PCR or other similiar enzymatic amplification system can be synthesized de-novo using methods known in the art including, but not limited to, the chemical synthesis of nucleic acid sequences.
[0254] In the present application, where the observed number of SHM mutations at a polynucleotide motif is conditioned on the underlying frequency of observing that motif, the degree to which a polynucleotide sequence or motif is a SHM "hot spot" or "cold spot" was derived from analysis of SHM mutations identified in approximately 50,000 antibody sequences. One measure of the statistical significance of a SHM "hot" or "cold" motif compares the number of times a motif is observed (Ns) at the site of a SHM mutation event, with how often it would be expected at random (Nps) (where N equals the total number of observed mutations in the dataset and ps is the background probability of observing the motif). A Markov chain was used to calculate the background frequency of the observing any motif at the site of mutation, as described previously (Tompa, 1999), using di-nucleotide transition probabilities taken directly from human germline IGHV sequences, as shown below.
ij = 0.169 0.270 0.381 0.179 0.289 0.287 0.101 0.321 0.239 0.219 0.314 0.227 0.155 0.278 0.413 0.154 where i , j .di-elect cons. { A , C , T , G } ##EQU00001##
[0255] The difference in the number of observed:expected motifs occurrences at the site of mutation is given by Ns-Nps, where {square root over (Nps(1-ps))} represents the standard deviation of Nps, and the z-score for each motif is given by:
Ms=(Ns-Nps)/ {square root over (Nps(1-ps))}
[0256] where Ms is the number of standard deviations by which the observed number of motif occurrences (at the site of mutation) exceeds the expected value. This metric can been used to rank all possible SHM "hot spot" and "cold spot" motifs, and to characterize the degree to which any motif is "hot" or "cold" to SHM mediated mutagenesis. For instance, those 3-mer, 4-mer, 5-mer, or 6-mer polynucleotide motifs having rank-ordered z-scores in the top 5% or 10% of all equivalent length polynucleotide motifs can be considered SHM "hot spots." Likewise, those 3-mer, 4-mer, 5-mer or 6-mer polynucleotide motifs having rank-ordered z-scores in the bottom 5% or 10% of all equivalent length motifs can be considered SHM "cold spots." In one aspect, the hot spot can be, for example, a preferred hot spot SHM codon or motif or a more preferred hot spot SHM codon or motif Rank-ordered tables of the top 3-mer, 4-mer and 6-mer nucleotide sequences with their corresponding. SHM mutation z-scores, describing their propensity to attract SHM-mediated mutagenesis (i.e., be more susceptible to SHM), are provided below in Tables 2 and 3.
TABLE-US-00002 TABLE 2 3- 3-mer 4-mer 4-mer 4-mer 4-mer mer z-score 4-mer z-score 4-mer z-score 4-mer z-score 4-mer z-score ATA 271.09 AATA 249.23 TACC 92.73 ACGA 19.69 CTGG -55.05 AGC 185.10 AGCA 225.50 GAAA 89.97 TTTT 17.21 CGGA -56.07 TAT 178.79 ATAT 224.06 CTGC 88.23 TTCT 16.95 ACGG -58.65 CAG 176.52 AACA 215.78 CCAA 87.55 GATC 16.55 GCCT -61.62 ACA 161.58 ATAA 213.14 TATC 86.83 TGTA 15.70 CGCC -62.50 CCA 156.43 ATCA 193.93 CCCA 86.81 CCCC 14.29 CTTG -63.02 ATT 128.07 TACA 190.78 GCTA 84.30 TTCC 8.07 AGTG -64.08 AAT 123.91 CACA 183.94 CTTA 83.60 CGCA 7.95 GGAC -66.33 CAC 113.31 ACAA 182.20 GCAA 83.41 CCTG 6.44 CCCG -68.14 CAT 106.72 ATTA 174.57 ATCC 82.88 AAGT 6.21 GTGA -69.31 GCT 99.04 CAGA 172.86 GAAT 82.09 GTTA 5.83 TTGT -70.87 TCA 92.35 AACT 171.38 ATTC 80.57 GTAA 5.54 GCGA -71.78 TAC 90.32 AGAT 167.36 AGCC 79.90 GACT 5.46 GTTT -73.35 ACT 84.63 ACAG 165.72 CTCA 78.97 TCCT 4.16 GGGA -75.77 ATC 82.30 CAAC 163.72 CCAG 78.46 GACC 2.64 CGTA -76.30 AGA 78.69 TATA 159.43 AGTA 78.05 GGAT -0.62 TCGA -76.40 CTA 71.32 ATAC 157.31 TAGC 76.80 TCTG -1.62 CGAG -78.05 GCA 70.80 ACTA 152.17 ATTT 74.50 GCTG -2.06 AGGG -81.46 GAT 68.06 CAGC 148.78 ACTG 74.10 GATG -2.19 GAGT -82.94 CTG 67.83 ACCA 146.54 TCAC 71.95 ACCG -2.66 CCGG -85.06 ACC 65.99 AAGC 145.36 CTGA 68.58 TTTC -4.30 GAGG -85.74 GAA 59.03 AGAA 144.62 CCTA 67.05 TAGT -4.65 GTTG -86.35 TGA 56.50 AAAA 136.44 TCTA 66.67 CGCT -5.54 TCCG -88.86 ATG 52.18 ACAT 135.69 AATG 66.07 AGCG -5.58 GTTC -89.62 CAA 48.79 AGCT 134.58 GCAT 65.56 CCCT -7.38 CGGC -90.00 AAA 39.39 CAAT 133.12 ACCC 62.47 CCTC -7.50 GCGC -91.60 AAC 37.15 GATA 131.74 TCAT 61.22 TGGA -8.79 CTCG -92.05 TTA 35.04 ACAC 130.35 TGCT 61.11 CTGT -10.50 TGGC -92.93 TAA 31.78 ATCT 128.86 CTAG 59.03 GTAT -10.53 TCGC -96.14 AAG 24.73 CACC 125.86 ACTT 58.98 TATG -13.14 TGTG -96.30 CTT 17.61 CATA 125.75 AGAG 58.81 AAGG -13.25 TTGG -100.73 TTC 16.92 ATAG 121.65 TTAC 57.51 CCGC -13.98 GGTT -102.17 GTA 15.61 TAAT 121.29 TTTA 56.94 ATGG -13.99 GCCG -104.21 TAG 13.84 CAAA 121.00 TCAG 56.45 CGAA -14.21 CCGT -105.94 GGA 11.44 TATT 120.42 ATGC 54.70 TCTT -15.45 GTCT -108.78 TTT 6.80 CTAA 119.93 AGAC 53.01 TGAC -16.19 GGCC -110.06 AGT 2.60 CATC 118.61 TGAT 51.51 CCTT -16.61 GACG -112.93 CTC -1.47 TTCA 117.73 GCAC 51.04 CACG -19.16 TGGT -115.42 TCC -5.22 AAAC 116.35 AGGA 50.16 GGCA -21.99 GTGC -117.74 CCT -5.42 TTAT 114.64 TAAG 49.76 TCCC -23.02 TTCG -118.98 CCC -7.09 AAAT 114.43 CAGT 49.09 AACG -26.20 ACGT -121.92 GAG -8.26 CCAT 113.51 ACTC 46.69 CGAT -27.41 GCGG -124.24 TGC -14.70 ACCT 111.92 AGTT 45.47 AGGT -29.09 TGCG -126.58 TCT -18.88 TAAC 111.26 CAAG 43.20 TCTC -29.53 TGGG -127.63 GAC -23.11 CTAT 110.83 CTCC 43.07 TTGC -29.86 GTCC -128.75 AGG -27.85 TAAA 110.30 GTAC 42.84 CCGA -32.32 GGGC -132.40 GCC -38.10 CCAC 110.05 GAAC 42.62 TGAG -34.69 GGGG -133.41 TGG -40.97 AATT 109.92 GAGC 41.24 ATGT -34.90 TCGT -135.34 TTG -43.86 TGCA 107.12 GCCA 40.88 TAGG -37.28 GGTG -135.80 ACG -61.29 CATT 106.83 GCTT 39.88 GGCT -38.30 CGTT -136.77 GTT -62.25 TCAA 104.12 CAGG 37.16 GCCC -40.66 TGTC -137.57 CGA -62.60 AAAG 103.76 GATT 35.99 GGAG -44.01 GTGT -142.24 TGT -64.56 TACT 101.53 GACA 35.71 TGTT -44.49 CGGT -144.04 GGC -70.30 AAGA 100.90 CTTC 34.67 CGAC -45.06 GTGG -149.24 CGC -82.93 CACT 100.32 CTCT 33.87 GGTA -46.07 CGTC -155.95 CCG -85.43 AACC 99.86 GAAG 31.97 AGGC -46.08 GGTC -158.84 GGG -97.46 GCAG 99.17 TTGA 31.29 TACG -46.78 TCGG -159.56 GTG -110.90 ATGA 98.38 CTTT 28.94 AGTC -46.82 CGGG -159.99 GGT -112.41 CTAC 95.93 TTAG 27.86 ACGC -47.10 GGGT -162.17 CGG -116.32 TCCA 95.63 GGAA 26.38 ATCG -48.15 GGCG -171.27 GCG -118.80 AATC 95.61 ATTG 25.55 GTCA -52.15 CGCG -172.40 TCG -125.83 TGAA 93.81 CATG 24.39 TTTG -52.48 CGTG -180.34 GTC -126.67 TTAA 93.67 GCTC 22.00 GTAG -53.73 GCGT -194.57 CGT -130.10 TAGA 93.03 GAGA 21.55 TGCC -54.56 GTCG -207.74
TABLE-US-00003 TABLE 3 6-mer 6-mer z-score ACAGCT 266.45 ATTAAT 248.7 ATAATA 227 CAGCTA 223.27 AATATA 220.6 AATACA 215.65 AGCTAC 211.24 AGATAT 211.07 AGCTAA 210.24 ATATAT 209.3 AATACT 203.19 ATATAC 192.44 ATAACT 190.78 ATATTA 189.76 ATAGCA 186.89 ATACCA 186.58 ATACAA 181.41 GCAGCT 180.69 ATTACA 180.46 CAGCTC 180.29 ATAGCT 180.08 AATAAT 179.41 AGCTAT 178.14 CAGCTT 176.31 ATATCT 174.41 AGCTGC 169 CAGCTG 167.78 AGCTGA 167.41 AATAAA 167.35 ACTACA 167.11 AACAGC 167.08 ATTATT 166.89 AAGCTA 166.44 ACTACT 164.71 AATACC 164.29 TATTAT 164.1 ACAGCA 161.72 AGCAGA 160.66 AGCAAT 159.61 TAATAC 159.28 AATCCA 156.67 AATAGA 156.3 TATACA 155.5 AGCTCC 153.55 CATATA 152.22 ATACAT 151.77 TATATT 150.71 TAATAT 150.37 ATTACT 150.2 TCAGCT 149.79 AACTAC 149.11 AAAGCT 148.88 CAGCAT 147.47 ATACAC 147.42 ATAGAT 147.33 ATCAGC 147.06 AGATAC 146.34 AGCACA 146.01 CAGATA 145.75 TAGCTA 145.22 TTAGCT 144.8 AAGCTG 143.55 CACAGC 141.38 ACAACT 140.89 CATACA 139.87 AGCAGC 139.64 ACTATT 139.36 CCAGCT 137.43 GATACA 136.87 AGCTTC 136.64 AGCTCA 136.52 ACCAGC 136.02 AAATAC 135.35 AGCTTA 135.22 AGAGCT 134.71 TAACTA 134.57 TACTAC 134.52 AACTAT 133.79 ATAAAC 132.79 TAGATA 132.74 AACACA 131.7 CTAATA 131.46 AATAGC 130.99 GAGCTA 130.78 ATACTA 130.56 ATATCA 130.47 CTACTA 130.24 ATACAG 129.95 CCAGCA 129.73 CAGCAG 129.37 AATGCA 128.88 ACTAAT 128.87 AGCTTT 128.11 ATCCAC 128.11 GAAGCT 126.98 CAGCAA 126.51 ACCACC 126.44 GCTACA 126.36 AGCTGT 126.35 ATAACA 126.34 AGTTAT 125.56 TTACTA 125.4 AATTAC 124.76 AATTCA 123.97 CAGCAC 123.54 ACAGCC 123.25 TTAATA 122.8 AGTATT 122.69 CAACTA 122.15 CAATAA 121.87 AGCAAC 121.8 ATCTAC 121.63 TACACC 121.61 AGCACC 121.59 ATAGCC 120.05 TAGCTG 119.3 AAAACA 119.25 ATTATA 119.17 AGTACT 118.38 CACCAT 117.87 ATCTAT 116.19 ACCATT 115.23
TACTAT 115.17 TCAGCA 115.13 AGCATA 114.84 TATTAA 114.69 CAAGCT 113.83 AGATGA 113.27 GATATA 112.88 TAGCTT 112.54 TATTAC 111.72 AGCTCT 111.46 TCACCA 111.34 ATAGTA 110.66 ATACCT 110.48 AGCATC 109.68 TATCTA 109.46 TACAAC 108.83 GCAGCA 108.59 AGTAAT 108.57 TGCACA 108.53 TTTATT 108.51 ATGATA 108.34 CAAATA 108.12 ACAATA 107.6 AATAGT 107.19 AACAAC 107.08 CACCAG 107.01 TAGCTC 106.68 TACAGC 106.65 AACTGA 106.63 GCATAT 106.63 GAGCTG 106.39 ATTCAC 106.22 AAATAA 105.92 TAGCAA 105.71 CCAGAT 105.22 ACCATC 105.14 AATAAC 105.1 TACCAT 104.92 AGAACA 104.85 ATCATA 104.56 ATCACC 104.5 AGAAAT 104.29 ATATAA 104.19 CATATC 103.97 ATTCCA 103.78 GGAGCT 102.99 TACAGA 102.58 TACTAA 102.18 ATCACT 102.01 ATATGA 101.89 AAACAG 101.82 ACACAG 101.77 ACACCA 101.38 ACAACC 101.23 TAAGCT 100.84 CAATAG 100.69 CTATTA 100.61 TTACCA 100.56 AGTACA 100.42 AACCAC 100.39 CCACCA 100.19 AAACAC 99.94 ATAAAT 99.38 GCTATA 99.35 GTAGCT 99.14 CAGCCA 99.11 TTCAGC 99 AGACAC 98.97 AGCACT 98.85 CCAATA 98.8 AAACCA 98.68 CAGCCT 98.34 AAGCAC 98.34 ACTGCA 98.25 AGAAGC 98.23 CCATCA 98.1 CAACCA 97.53 CAACTG 97.51 ATTAGC 97.37 AATATT 96.98 ACCACA 96.82 ATATGC 96.53 GTATTA 96.49 CATAGC 96.33 GTATAT 96.2 ACCAAC 96.14 CAGATC 96.05 AACATA 96.05 AGATCC 95.89 CTACCA 95.82 GATCCA 95.8 ATTGCT 95.61 ACCATA 95.61 CATCTA 95.61 CCAGCC 95.4 ACCTAC 95.39 TCAACT 95.32 ATGCAC 95.22 GAAATA 95.07 TATAGC 94.95 TACCAC 94.81 AGCTAG 94.59 CCATAT 94.32 TATATA 94.2 CATATT 94.16 TAATAA 94.05 AGAACT 93.81 TATCAC 93.66 CACCAC 93.38 AAAGCC 93.36 CTACAG 93.16 GCAGAT 93.16 AGATCA 93.03 ACTTCA 92.78 ACACAC 91.91 ACCACT 91.48 AAGCTT 91.27 ACCAAT 90.89 CTAGCT 90.83 ATTTAT 90.72 CAGTTA 90.71 CATAGA 90.61 ATACTG 90.19 ATTACC 90 TATCAT 89.91 ACTATA 89.16
TACACA 89.01 GCTGAA 88.67 CCATTA 88.62 TGCTAT 88.19 TACATA 88.12 CACCAA 88.08 ATAGTT 87.88 CACCTA 87.77 GCACCA 87.64 CTATCA 87.58 GCTATT 87.58 TATTAG 87.34 CCACCT 87.28 AGAACC 87.26 ACTACC 87.25 TATAAT 87.06 ATTTCA 86.86 TAGCAG 86.76 AAGCTC 86.67 AACCAA 86.61 AATATC 86.37 TAGTAA 86.29 GCTGAT 86.25 TATATC 86.21 TAATTA 86.14 AACCAT 86.06 ATAGAC 86.03 CCATCT 85.84 TTATTA 85.75 TCAGCC 85.73 ACATAC 85.65 ACATAG 85.6 CACAAT 85.55 GTAATA 85.54 GAAGCA 85.45 TCATAT 85.24 CAGCCC 85.03 ACCTAT 84.68 AGCCAC 84.68 CAGTAA 84.62 CCAACA 84.17 AAAAGC 84.12 AACTGC 83.95 CCAACT 83.78 ATCATT 83.47 AGAGCA 83.38 GATACT 83.35 CCACAG 83.35 ATAATT 83.26 TAAACA 83.21 ACATAT 82.99 GCTACT 82.86 CAGTAT 82.76 ATCACA 82.36 TCAACA 82.34 AGCCCA 82.25 AATTAT 82.21 ATCATC 82.17 TGCTAC 81.84 GCTTCA 81.55 CCACTA 81.49 GCTGCA 81.44 TAGTTA 80.97 AATCAA 80.92 CAATTA 80.84 CTGCTA 80.71 ATATAG 80.66 TGCACC 80.52 AAGACA 80.5 TAATAG 80.31 TGCAGC 80.23 CCTCCA 80.17 GATGCA 80.15 AACTCC 80.09 TCCAGC 80.02 ACACTG 79.79 TATAAC 79.77 TTATAA 79.58 CAACAA 79.5 GCTAAT 79.35 TGATAC 79 AGATCT 78.63 ATAACC 78.57 AGAAAC 78.2 ATTGCA 78.18 AACACC 78.06 TGCATT 78 CAACTC 77.9 GTACTA 77.86 ACTCCA 77.83 CAGATG 77.71 TGCAGA 77.69 AAGAAA 77.67 TCCACC 77.66 TAACCA 77.39 TAACAG 77.34 TTATAT 77.04 TCTATT 76.92 ACACTA 76.75 CACTAA 76.68 GTAGCA 76.59 AGCCAT 76.52 TCATCT 76.5 CACTAT 76.28 CAATAT 76.05 CACAGA 76.03 AGTTAC 75.97 ATACTC 75.91 TATATG 75.77 CACTAC 75.68 ATTTCT 75.56 TACCAA 75.44 GCAATA 75.24 ATCTCA 74.72 ACAGAT 74.63 TCACCT 74.58 CATCAG 74.49 TCAGAT 74.33 AGTAAC 74.08 CTACAC 73.7 AATGAT 73.53 ATTAGT 73.5 TAGTAC 73.49 TAACTG 73.35 AAAATA 73.29
AAAACT 73.19 ATTTAC 72.97 ATCTGA 72.97 ATCCAT 72.95 ATACCC 72.75 AACTTC 72.62 AATACG 72.39 AAATCA 72.22 TTCACA 72.18 CAGATT 72.08 CAGAAA 71.97 ACACAT 71.91 AAGATA 71.91 CTGCAG 71.63 GCAACT 71.57 GATATT 71.57 AGATTC 71.53 ACCAGA 71.47 CTATAT 71.38 TGATAT 71.06 AAGAGC 70.89 ATACGC 70.65 CTGATA 70.47 GATAAA 70.39 ACATCC 70.36 AAACTA 70.26 ATCAAT 70.13 GAAACA 70.11 CATCAT 70.01 AGCTTG 70.01 TGAGCT 69.96 CTATAA 69.96 ATTCAT 69.85 TACTGC 69.83 CAGAGA 69.69 CATTTA 69.68 AGCTGG 69.06 GAATCA 68.99 TTATTT 68.98 ATCTGC 68.96 TAGCAC 68.84 ATGCTA 68.58 TATACT 68.54 TCATCA 68.5 AGATGC 68.48 ATAGCG 68.46 CATACT 68.15 TAGCAT 68.15 TACAAA 68.02 TACCTA 67.99 CATCTT 67.88 ATCAAC 67.83 ACCTTC 67.82 TTAGCA 67.82 AGTAGC 67.72 TTGCTA 67.61 TAAGCA 67.57 AATATG 67.49 TCACTA 67.42 CATTAA 67.2 AGCAAA 67.17 GGCTAT 67.15 ATGCAA 67.06 ACACCC 67.05 GCAGTA 67.04 AGTAAA 67 TTCACC 66.71 GATACC 66.69 CTACAA 66.54 CTGAAA 66.27 ATGTAT 66.24 CACCTT 66.08 ACCCAG 65.77 ATATCC 65.64 CAAAGC 65.58 ACAGTA 65.5 CATACC 65.47 TGAATT 65.43 TATTCA 65.2 GATATC 65.15 ACAAAT 65.04 CCATTT 64.91 AAAAAC 64.81 GCTCCA 64.64 AAGCCA 64.61 CCTTCA 64.45 GAGCTT 64.45 ATAGAA 64.31 TGAAGC 64.22 GAACCA 64.2 ACAGAC 64.16 ACAGAG 64.14 TGTATA 64 TGAACC 63.94 TTATCA 63.94 AACAGA 63.94 GATTCA 63.93 ATGAAT 63.83 GCTGCT 63.71 CACACA 63.58 GCAGCC 63.54 TAGCCA 63.4 GAGCTC 63.35 AACTCA 63.19 GTATCA 63.01 CATAAT 62.96 TCCACA 62.68 CAGAAG 62.65 CCCAGC 62.57 CGCTAT 62.55 CCTACT 62.52 CAATAC 62.45 CAACTT 62.28 AGAATC 62.21 GAGCAC 62.17 TCTGCA 62.09 CAATCC 61.99 AGAATT 61.72 CATTAC 61.65 ACTGCT 61.63 AACACT 61.62 GTAACA 61.62 TATCAG 61.58 ATGAAC 61.56 CAACAT 61.55 TCAATA 61.47
TGCATC 61.37 GCACAG 61.24 AGAGCC 61.12 AGTATA 61.1 GTAGAT 60.86 TACACT 60.8 TATCCA 60.75 AGCATT 60.65 ATTAAA 60.65 ACAAGC 60.61 ACTGAT 60.54 CAACAG 60.42 ATGCTG 60.37 TATCAA 60.3 AGTTGA 60.16 TTTACT 60.02 CTTCAC 59.96 GAAGAT 59.8 CATCTG 59.68 ATCCCA 59.65 CAACAC 59.49 AACATC 59.39 AAGCAG 59.37 CATCAC 59.3 ACTAGC 59.24 ACAACA 59.21 CATAAC 59.02 TATTTC 58.98 CCATAA 58.89 CACCCT 58.6 ACACCG 58.31 TACTAG 58.31 TGAATA 58.12 ACAATC 58.11 AGGAGC 58.09 TGAGCA 57.87 TATGAT 57.78 TATACC 57.77 GATATG 57.64 TCTGCT 57.47 AGTAGT 57.38 ACCAAA 57.17 TGTAAT 57.16 CAGCGA 57.12 AAGCAT 57.06 GATGCT 57.03 CATTTC 56.98 AAGATG 56.93 ATCCAG 56.88 CATATG 56.87 TGGATT 56.83 TGCAAC 56.76 CACCTC 56.75 CAGACT 56.73 ATGCAG 56.72 GTAACT 56.7 AGTAGA 56.45 TATGCA 56.42 GGAATA 56.3 AGTATC 56.23 CATTAG 56.19 CAGTAC 56.18 TACATC 56.14 AAAGCA 56.13 TCTCCA 56.01 ACAGAA 55.96 GGAGCA 55.88 CAGCCG 55.8 CTGCAC 55.6 AGCAGT 55.46 CACATA 55.45 TATCTG 55.37 TACTCA 55.36 CTTATA 55.34 GACACA 55.17 TGTATT 55.14 GAATCT 55.12 AACAGT 55.1 ATCAGA 55.06 GCATCT 54.8 AACTAA 54.79 CAGCGC 54.76 ACACAA 54.74 TAACAA 54.73 TGCATA 54.73 TTACAG 54.68 GAAGCC 54.6 AAGAAC 54.37 TTACTG 54.36 GTTTAT 54.25 ACCAGT 54.25 AATCCT 54.22 ACAAAG 54.18 TCACAG 54.18 ACTATG 54.15 GATGAT 54.08 TGCAAT 54.03 GTAATT 53.95 TTAGTA 53.95 CATGAA 53.93 CATCTC 53.89 AGCCTC 53.8 CACATT 53.79 AATTAA 53.78 GCACAT 53.76 ATTGAT 53.75 AAAACC 53.75 TACCAG 53.61 ACTAGT 53.57 AAAGAT 53.54 CTCCAA 53.42 CACACT 53.37 CCACAA 53.24 TACAAT 53.13 CTATTG 53.01 TAGTAG 52.94 GATCAT 52.84 AATCAT 52.81 ATTCAG 52.71 AGTACC 52.64 AAAAAT 52.58 CAGAAC 52.37 ACAGTT 52.35 TGAAAT 52.33 GAGATC 52.3
CATTCA 52.24 CGAGCT 52.22 GATAGC 52.17 TCATTA 52.11 CTCCAG 52.03 CAGAGC 51.98 TGCTGA 51.92 CCAAGA 51.92 ATAAGC 51.86 TTACAC 51.85 AGATGG 51.72 TCTACT 51.69 TTACAA 51.68 TGCAAA 51.62 TAGTAT 51.42 TTTATC 51.26 CCCAGA 51.25 GACTAC 51.19 ATTCTA 51.19 CAAAAA 51.15 ATACTT 51.15 ATACGA 51.08 ATCTTC 51.06 ACATCA 51.04 AACCCA 51 CATAAA 50.95 TGAAGA 50.88 TAGATG 50.83 CTGCAT 50.78 CAAGCA 50.65 AAATCC 50.5 GAACTA 50.47 CTATGA 50.36 ACTTAT 50.3 CCAAAT 50.25 CCTGCA 50.24 TACTCC 50.15 GAGCAG 50.07 TACCCA 50.02 ACCTCC 49.97 GTTATA 49.88 CATCAA 49.87 TGATAA 49.86 AATCAC 49.84 ATTAGA 49.71 CATCCC 49.63 GTATTT 49.61 ACCTGA 49.59 ACTGAA 49.51 CATCCA 49.5 TAACAC 49.46 AGAGAT 49.39 AGCATG 49.33 CAACCC 49.27 ACTTCT 49.23 ATGATC 49.2 GATAGA 49.19 GAACAG 48.99 CCAAAA 48.88 GAAACT 48.8 GACAGC 48.76 CAATGA 48.7 ACAAGA 48.64 CTCAGA 48.55 AGATAA 48.54 CTAGCA 48.43 ATCAAA 48.36 TCTTCA 48.34 GATGAA 48.34 ATCCAA 48.27 AACCAG 48.27 CACATC 48.25 TCCAAC 48.16 TAAAGC 48.1 AGACCC 48.09 CAGGAA 48.07 TTAACA 48.04 TTATTG 48 CATGGA 47.99 CTTCCA 47.96 CAGTTG 47.94 ATATGG 47.86 GTATCT 47.79 CTTCAA 47.73 GAGAAC 47.72 TTCACT 47.71 AAAGAA 47.71 ACACCT 47.51 AGTTCA 47.47 ACCTGC 47.45 TATGCT 47.44 TTGTAT 47.43 ACAGGC 47.42 TCCATA 47.27 TATTCC 47.17 GGCTGA 47.15 TGCTAA 47.05 ACCCCA 46.96 GTAGTA 46.89 ATCCTA 46.79 CGCATA 46.68 AATTCT 46.54 GGATCT 46.23 TTATAG 46.2 ACTAAA 46.2 CAGACA 46.2 GTACCA 46.16 CAAAGA 46.13 ACTCCT 46.11 CACAGT 46.1 AAACCT 46.05 CGCTGA 46.02 AATGAA 45.98 GTTACT 45.95 TACAAG 45.86 AGGAAT 45.81 ACTCAA 45.79 ATGACA 45.7 ACCATG 45.69 CATAGT 45.61 ATATTG 45.6 AGGTAT 45.57 CTCAGC 45.54 ATATTC 45.46 CTACTC 45.36 TACAGG 45.33
CCTCAG 45.33 CACTGC 45.24 GCACCT 45.13 ACTATC 45.05 CTGCTG 44.96 AGCCTT 44.9 GGTATT 44.89 TAAATA 44.79 TTCCAC 44.78 CAAAAG 44.78 TTTCAG 44.77 TAATGA 44.74 TTACAT 44.73 AACCCC 44.73 ATGGTA 44.66 CACTGA 44.64 CAAATC 44.64 CATGCT 44.62 GCTTCT 44.61 TCCATC 44.59 TCAGTT 44.56 ACTGCC 44.54 CTTCAT 44.49 TGCTCA 44.45 TGGAAT 44.41 CTTCAG 44.4 ACATCT 44.4 CACCTG 44.39 ATGCAT 44.36 CCAACC 44.33 CATTAT 44.25 CTAGTA 44.22 TACAGT 44.18 TACTGA 44.12 CTACTG 44.1 TAGAAT 44.07 ACAGCG 44.06 ATGGAT 44.04 TTCATA 43.92 ATAAAA 43.84 ACTCAG 43.83 CTGCAA 43.65 CAGGCT 43.52 TGATAG 43.5 AGAGAC 43.5 CCATGA 43.49 CTACTT 43.4 ACATTA 43.36 GAATAG 43.29 GCAGTT 43.25 CACAAA 43.25 TGAACT 43.25 TGAGAT 43.21 CACTAG 43.13 CCCCAT 43.06 CTAACA 42.92 CCAGTA 42.86 CTCCAT 42.76 CAAGAT 42.74 GAACCC 42.71 CCAGAA 42.65 TTCATC 42.62 AACCTG 42.6 AGCCCC 42.52 CCTACA 42.47 GGATAT 42.47 TCCACT 42.41 ATTACG 42.39 AAGATC 42.32 AGCCTA 42.29 ACACGG 42.21 CTGAAT 42.18 CTATTC 42.04 ACAATG 42.01 TCATAA 42 TGAATC 41.89 ATCAGT 41.74 GATTTA 41.74 AATCTG 41.72 GCTGGA 41.71 AGCGAT 41.68 TATTTT 41.67 GAATCC 41.64 TTTACC 41.63 AGCAGG 41.62 AAATAT 41.58 ATTATC 41.55 GAGATA 41.47 CCAGGA 41.41 TCATAG 41.39 GCTTTT 41.33 ATGACT 41.26 GAACTG 41.19 CTGAAC 41.19 GGCTAC 41.14 AGCTCG 41.12 ACCCAC 41.04 CAATCA 41.01 AGCGCA 40.99 ACTCCC 40.96 CTCCAC 40.95 AATCTA 40.93 GCATCA 40.9 ATTTTT 40.87 TGAAAA 40.84 TCACAT 40.84 ATTCCT 40.83 TTGATA 40.69 CACAAC 40.69 TATTGA 40.61 AGGCTG 40.57 AATGCT 40.53 TATTTG 40.53 CAGGTA 40.51 CATGCA 40.5 AAACTG 40.46 AACAAA 40.38 CTTTCA 40.38 CAAACT 40.38 TATTTA 40.37 GGAACA 40.37 GCCACT 40.35 CGCAGC 40.24 TAAATC 40.2 AGGTAC 40.19
ACTGTA 40.17 GAAGGA 40.16 CAGTTC 40.09 TTTTAC 40.04 TGAACA 40 GCTATC 39.99 GCTTTA 39.98 ATTAAC 39.98 GAATAT 39.96 CCATCC 39.94 TACCTG 39.93 CAAACC 39.91 CACTTC 39.84 TTATAC 39.76 TTGCAT 39.73 CTGTAT 39.67 GAAACC 39.64 AGTGAT 39.53 CAAGCC 39.3 AGGATT 39.29 CAGTAG 39.29 AGAATA 39.23 ATGCCA 39.23 GTGATA 39.2 AATCCC 39.2 AACAAT 39.16 GAAGAA 39.02 TAACAT 39 CAAACA 38.97 AGGATA 38.8 AAATGG 38.8 TTTAAT 38.75 TTTACA 38.66 GACACC 38.6 CTTACT 38.54 TAAAAC 38.52 TCAGCG 38.41 TTTGCA 38.37 ACAAAC 38.35 GATCTC 38.32 TGGATC 38.23 AAAAAA 38.16 CACGAT 38.16 TTTTCA 38.15 AAACAA 38.11 AATCAG 38.1 ATGAGA 38.04 CCAATT 38.03 CTATAC 37.99 AGGACA 37.98 GAACAA 37.98 TCCAAA 37.84 TTTCCA 37.82 ACTGGA 37.81 AAGCAA 37.77 ATGAAG 37.77 ACAAGG 37.76 AAGCCC 37.72 GCTCCT 37.68 ACACGA 37.64 AGCCGA 37.6 CCAGCG 37.57 ATCCCC 37.48 TGTAGC 37.33 AGCCGC 37.29 TCAGAA 37.28 TAAAAA 37.16 GATAAT 37.15 TCCTAC 37.13 TACTTC 37.09 GAAATG 36.99 ATATTT 36.91 GAACTC 36.81 CTAATG 36.79 AACAGG 36.76 AAGGCT 36.76 TCCAAT 36.72 TATGAC 36.67 ACCTCA 36.63 TGATGA 36.62 AAGCCT 36.59 GAGACA 36.59 ATGATT 36.47 CCACCC 36.46 GCAATT 36.27 CCCACA 36.26 TACTTA 36.25 TGACCA 36.23 CCATAG 36.13 ATTCCC 36.08 CCCACT 36.08 AAACCC 35.99 GAACCT 35.97 GTTATT 35.96 CCATAC 35.9 TTCTAC 35.9 ATGAGC 35.85 GATCAG 35.85 TATGAA 35.79 CAAGAA 35.7 TATAAG 35.62 ATCTCC 35.59 ACTACG 35.54 GAACAC 35.49 TATTGC 35.48 TAAATG 35.47 ATGAAA 35.43 GATCTG 35.38 TATAAA 35.37 ATACGG 35.34 ATTATG 35.3 CAAGGA 35.22 AAATAG 35.19 AAGACT 35.13 ACCCCC 35.07 AGATTT 35.05 GAGCAT 35.02 CCCCAA 35.02 AAATGC 35 TGATCA 34.95 GAGCCC 34.9 ATCTGG 34.82 AGAAGT 34.81 ACTAAC 34.76 TGGAGA 34.73 TAATCA 34.7
CAACCT 34.69 GACCAC 34.64 GTAAAA 34.56 TCTACC 34.54 GATTAC 34.54 CCAGTT 34.52 ACCAGG 34.5 GCAACC 34.48 ACATTT 34.47 ACTTCC 34.46 AAGTAC 34.43 ACCTTA 34.43 TAATTG 34.26 CACCCA 34.26 ATCTTT 34.13 TTAATT 34.07 TTGCAC 34.06 CACCCC 34.06 CATGAT 34.02 ATAGGT 33.92 GCTACC 33.92 ATAGAG 33.86 AGTTCT 33.81 TGCTTA 33.8 GCTGTT 33.73 AAGAAT 33.68 GATTCT 33.67 ACCGCC 33.57 ACAGGG 33.56 CAAGAC 33.52 CCACTG 33.47 AAGTAA 33.38 TGTACT 33.36 CTGAAG 33.36 AGACCT 33.33 ACTAGA 33.32 AAATCT 33.23 GCTATG 33.22 TTGATT 33.18 TGCTGC 33.18 AGAAGA 33.16 AATGGA 33.11 TTCCCA 33.1 AATGGT 33.08 GTTACA 33.07 TCAGGA 33.04 TACACG 32.96 TTACTT 32.93 TAAAGA 32.93 CACTTT 32.87 AACTGG 32.82 CTCACC 32.81 ACATGC 32.79 AGCCTG 32.79 TCCCAG 32.78 ACATGG 32.77 CACTTA 32.69 CCCCCA 32.63 ATGATG 32.59 GCAGAG 32.58 ACATAA 32.53 AAAGTA 32.47 AAAAGA 32.46 GAACAT 32.46 CAATTC 32.4 CCACTT 32.39 GGCTTT 32.37 TTCAAC 32.34 GCTTAT 32.32 CAGGAT 32.32 AGCCCT 32.3 CAATGC 32.26 TGTATC 32.2 TGATCT 32.2 CTGTTA 32.12 ACAATT 32.12 TATCTT 32.05 ATTCAA 32.04 TTCAAA 32.03 CAGACC 31.98 ACATGA 31.9 CTAAGC 31.75 CTAAGA 31.7 ATAAAG 31.69 AACTAG 31.56 GTACCT 31.55 AGATAG 31.51 CAAAAT 31.5 GTGAAT 31.48 AGCCAA 31.4 GAGATG 31.33 GGAGAA 31.29 AATTGC 31.29 ATGGCT 31.23 GCAAAT 31.22 TAGAAC 31.2 ATGGAA 31.19 GATGGA 31.15 CTGCTC 31.09 CCAGAC 31.09 ACTCAT 31.09 CGAACA 31.02 AGCCAG 31.01 GGATAC 31.01 GCAGAA 30.98 GTAAAT 30.95 TTTATA 30.85 TGCTTC 30.8 CTCAAC 30.7 AAAGAC 30.65 GCTCAA 30.56 ACAGTC 30.55 CACAAG 30.53 TGGATA 30.52 GCATAG 30.51 ACCTGG 30.5 CTCCCA 30.43 TGATTC 30.33 GCTGTA 30.33 GCATAC 30.26 TCAAGC 30.25 CAGAAT 30.22 TCATAC 30.18 CATCCT 30.14 TGAAAC 30.04
AAACTC 30 GCATTT 29.91 AAGGAC 29.86 ACAAAA 29.84 GAGTAT 29.79 AAATGA 29.74 AGCGGA 29.72 GAATTA 29.71 AGTGAA 29.7 AACAAG 29.69 TCAAGA 29.63 AACCTT 29.53 GAATAA 29.53 CTCACA 29.49 TCACAA 29.46 CCCATC 29.46 TGTGCA 29.41 ATTGGA 29.27 ATTGAA 29.23 ATAATG 29.22 CCTTTA 29.21 GGAACT 29.21 TTCAGA 29.18 GCAACA 29.12 ATAATC 29.11 CTCATA 29.07 GAATAC 29 CTGATC 29 ACCAAG 28.96 CACAGG 28.94 ATTTCC 28.86 GCATAA 28.83 TCCCAC 28.82 GAGCAA 28.81 TCCAGA 28.65 TTCCAT 28.63 GGCACA 28.6 TTTCTT 28.55 TAAACC 28.53 AAATTA 28.46 CTTGCA 28.46 ACCTCT 28.41 TCAGTA 28.39 GAAGTT 28.37 TACATT 28.33 GACCCA 28.32 GACCAT 28.29 CCACAT 28.23 CATTTT 28.22 ATCGCT 28.15 AAGGAA 28.11 TATAGT 27.92 TAACTT 27.89 CTTAGC 27.87 CTTAAG 27.83 CCTGCT 27.78 GATACG 27.7 TAGACA 27.69 GGTTCA 27.68 ATGCTT 27.68 TTCATT 27.66 TAATCC 27.62 ATATGT 27.59 CCACGA 27.56 AAAATC 27.56 GAAGTA 27.52 TGCTCC 27.5 CCCATA 27.47 TTAACC 27.43 TAGAGC 27.38 AGGCTA 27.34 GCAAAA 27.32 GCTCAT 27.31 AGGACC 27.3 AGACTA 27.27 CCATTC 27.24 ACGACT 27.24 AGGAAA 27.08 TTCCAG 27 TCACCC 26.94 AAATTC 26.9 AACTGT 26.84 TTCTAT 26.75 TAATGG 26.71 ACAACG 26.66 AGGTGA 26.64 AGGAAC 26.59 TGGTAT 26.57 AAACAT 26.53 AGTTGC 26.52 CAGTGA 26.47 GATTCC 26.47 AGCGAC 26.44 ATCAAG 26.44 ACCCCT 26.4 CCCCAG 26.4 CGTATT 26.39 TACTTT 26.39 AGACAG 26.37 TTATGA 26.36 CAAGAG 26.32 TGCAGT 26.31 AGGAGA 26.3 CCATGC 26.27 GAAAGC 26.23 ACGATA 26.23 CAAGGC 26.22 CTTTAT 26.22 CATTCC 26.22 GAAAAT 26.2 CATTGC 26.13 TATACG 26.08 GTAGAA 26.03 GGACCA 26.02 GCTCTT 25.97 TGTTAC 25.87 TCCCCA 25.78 TCCATT 25.78 AGAAAA 25.72 CCCAAG 25.69 GTGCAT 25.62 TTTTAT 25.58 ACCTTT 25.53 CTACGA 25.52 CCTTAA 25.52 GGCATA 25.52
GAAAAC 25.47 AGTTTT 25.42 GAATTC 25.36 GATCAC 25.35 CACACC 25.27 AAGCCG 25.26 ACTGAG 25.25 ATCTAA 25.24 AGACTG 25.18 AAGTTA 25.15 TCACTG 25.11 ATCGCA 25.08 CGATAT 25.02 GTCATA 24.99 AACCCT 24.98 TTAATG 24.97 ACTTTT 24.96 ACGCAG 24.82 ATTTAA 24.79 TGATTT 24.76 CTGATG 24.75 ATCTTA 24.75 TATGTA 24.71 GAAGAC 24.69 TTACCT 24.69 TAGATT 24.68 ATAAGT 24.67 CGGATA 24.54 CTTTTA 24.43 ACCACG 24.41 ACAGGA 24.4 TATGGA 24.4 TTACTC 24.37 GCAAAG 24.34 GAGGCT 24.32 ATCATG 24.24 TGTTAT 24.2 GCAAGA 24.19 CTGGAA 24.11 CTATTT 24.06 TCCATG 24.06 AGTGCT 24.05 AGCGCC 24.04 CTGTAA 24.03 GAGCCT 24.03 ACCCAT 24.03 TGGAGC 23.99 ATGGAC 23.95 CAGCGG 23.91 TAAGAA 23.9 GCATTA 23.88 AGTCAT 23.86 GGAACC 23.86 CCCTCA 23.86 AACCTA 23.83 CTTACA 23.77 GGTAAT 23.77 GGAGCC 23.69 CCCACC 23.65 GGAGAT 23.63 GTAGTT 23.62 CTGAGC 23.61 TTTCAC 23.61 CTGAGA 23.59 CATAGG 23.58 TTTCAT 23.55 AAGTAT 23.48 AATTCC 23.45 TACATG 23.39 GGAAAT 23.35 TGACCT 23.35 CGCACA 23.34 TACGAC 23.32 ATTTTC 23.32 CCTGAA 23.3 ACAGTG 23.28 AATCGA 23.28 ATCTCT 23.2 GACATG 23.19 AAGTAG 23.18 ATACCG 23.16 GGCAGC 23.07 TCTACA 23.02 CTAAAA 23 ACACGC 23 ACCCTG 22.98 TGAAAG 22.87 CACATG 22.71 CCTGTA 22.67 TGGTAA 22.66 CAGAGT 22.64 CCGCTA 22.64 GGAATC 22.63 TTCAAT 22.52 CTGCTT 22.49 CCTATT 22.49 GGTGCA 22.48 CAGGAG 22.48 CCCCAC 22.46 AGGCTC 22.43 CTAACT 22.4 CCAAGC 22.4 GCAGAC 22.36 CCAGGT 22.36 ACTGTT 22.3 ACCCTC 22.25 CTATGC 22.23 TCTAAT 22.15 TGGAAA 22.14 CAGTTT 22.08 TAATTC 22.08 TCACTT 22.06 TTTTTA 22.01 CCTTCC 21.92 ATCGAT 21.89 AAAATG 21.87 GCACAA 21.78 TGCACT 21.71 AAGACC 21.69 AATTGA 21.68 GCATCC 21.65 CACTGT 21.65 GAAAAA 21.64 GCTCAG 21.6 AACACG 21.59
GTTGCA 21.57 GCCCCA 21.54 GACTAT 21.53 GACCAG 21.52 GTTCAT 21.39 GAGAAT 21.24 TAAAAG 21.2 GAATTT 21.15 CACCGT 21.13 GATTAT 21.11 TTTCAA 21.05 ATCCTC 21.03 CTGGAT 21 CCTATA 20.97 ATAGGA 20.97 TAGGTA 20.96 GGATTT 20.93 ACTCAC 20.88 CGACTA 20.85 GGATCA 20.8 CTACCC 20.78 ACTTAC 20.74 GATAAC 20.71 GATCCC 20.66 TACGCA 20.62 GCCACC 20.56 AGACTC 20.56 GACTCA 20.5 CCTTAT 20.39 TAGGAT 20.38 AACATT 20.37 ATGCTC 20.32 ACTCTA 20.3 CTGCCA 20.29 TGGCTA 20.29 AGTCCA 20.26 CAGTCA 20.24 TTCCAA 20.24 GACATA 20.22 TCTATC 20.15 TCCTGA 20.13 ATGGCA 20.05 GTAGCC 20.05 CCTGGA 20 CTTAGA 20 AACGCT 19.94 CGCTAC 19.9 CTGTAG 19.87 CACTCA 19.87 CTTCTA 19.83 TCCTTC 19.8 CAAGTA 19.73 ATCAGG 19.71 TATTGG 19.66 AGTTCC 19.66 ACACTC 19.6 AATTTA 19.59 ACATTG 19.58 GAAATC 19.45 TGAAGT 19.45 GTACAT 19.44 CTTTAA 19.44 CATTGA 19.38 GGCTTC 19.38 CACGAA 19.33 TATCCT 19.28 ATGGAG 19.27 AATAGG 19.25 GTATAA 19.24 AATAAG 19.23 GGATTC 19.19 TCTATG 19.13 ACCCTT 19.09 ACTTTA 19.01 CCAATC 19 TCTGTA 18.99 GCTCTA 18.93 GATCTT 18.92 GGATTA 18.85 CGTATA 18.83 ACGAAC 18.75 ATTCTT 18.75 AGGTCA 18.72 TAGAAA 18.72 CGTAAT 18.7 GTACAG 18.63 ATGTAA 18.6 TTCATG 18.6 AGTTTC 18.56 TAGTTG 18.52 TGGACA 18.5 ATTTGC 18.49 CACCGC 18.45 CTCTAT 18.44 CAATCT 18.42 GAGAAG 18.39 ACATTC 18.38 ATTTGA 18.37 TTGCAA 18.35 AAGATT 18.34 AAAGGA 18.34 ATTGTA 18.33 TTAAAA 18.28 ATATCG 18.27 ATAGTG 18.25 GAGACT 18.19 GCTTAA 18.18 TGATTA 18.16 GGATCC 18.16 AGCACG 18.12 AACCGC 18.1 TTGCTG 18.05 CCAAGG 17.94 AGGCTT 17.91 CGCAAA 17.91 CCGATA 17.87 TCAAAT 17.85 CCGAGA 17.85 GCCATT 17.84 GCCATA 17.82 GCACTA 17.75 ACTCTG 17.67 AGTAAG 17.64 CGCTCA 17.58 TATCCC 17.54 AACTCT 17.47
TCCACG 17.46 GGAGAC 17.43 CTTGAA 17.42 TCTCAT 17.31 TAGCGA 17.31 CTAAAG 17.28 CACTCC 17.24 CCGTAT 17.21 GAGAAA 17.2 AACTTT 17.19 CACTCT 17.18 GACTCC 17.16 GCACCC 17.12 TTATCT 17.12 TAGCCT 17.07 CCTACC 16.97 TAAGAT 16.95 GCAATG 16.95 GGTAAA 16.95 AAAATT 16.92 AACGGC 16.9 CTATCT 16.81 TATCTC 16.81 GCTCCC 16.8 CTGACA 16.79 CATGGC 16.78 GACCTC 16.77 CCTTGA 16.76 CTCATC 16.72 CACGGA 16.69 CTATGT 16.65 TAGAAG 16.62 CATAAG 16.58 GGAAGC 16.58 CGCAGA 16.48 AACGCA 16.48 CGAAGA 16.41 TAACCT 16.4 CTGATT 16.33 CAGGCA 16.28 GAAAAG 16.25 CCCAAC 16.24 TAGTGA 16.23 TTGCAG 16.2 TGAAGG 16.18 TTTGAA 16.15 TACCTT 16.14 GCACAC 16.12 ATGACC 15.97 TTAAGC 15.91 GTTGCT 15.9 CATGTA 15.9 ACGACC 15.86 CAGGTT 15.84 AAAAGT 15.82 AGACCA 15.79 GCTTGA 15.71 GATGTA 15.67 TGACAT 15.66 TTCTCC 15.65 TTAGAA 15.63 TTAGAT 15.61 ATTTTA 15.6 TTAAAT 15.52 GGTACA 15.49 CATCGC 15.48 GCCATC 15.39 AATTTT 15.39 TCAATC 15.38 ACCCAA 15.38 CTGTTT 15.36 CCAGAG 15.35 AGAAGG 15.33 TCATTT 15.32 CCAGTC 15.26 AGTAGG 15.25 TGCAAG 15.23 AGGATC 15.22 GACAAC 15.19 TCCTCC 15.19 TCAATT 15.18 TCAAAA 15.15 CCTGAT 15.13 ATCCGC 15.08 GACCTT 15.07 TTATTC 15.07 GCTAAG 15.01 CTCAAG 14.96 CAGGCC 14.89 ATGTAC 14.83 CTTCTG 14.71 AGACAT 14.69 TAAGTA 14.61 TTGAAG 14.6 ATGTTA 14.54 TGGAAC 14.52 GGCTCC 14.47 ATAAGG 14.45 CTTATT 14.45 ATCCTG 14.42 TGTTTA 14.41 TGAGAA 14.39 CACGCC 14.39 CCATGT 14.39 ACGCTG 14.36 TCCAGT 14.34 CTACAT 14.31 AGTGCA 14.28 AATCTT 14.25 GGCTCA 14.24 CCCTAT 14.21 CCAGGC 14.21 CTGGAG 14.2 ACCCGC 14.16 GGTATA 14.14 GACTTC 14.11 AAGAGA 14.08 GCTTCC 14 AGCGCT 14 AGACTT 13.99 AAACGC 13.99 TCACCG 13.98 CACGCA 13.93 CCCAGG 13.91 CTCTGC 13.88
CGAGAA 13.83 TATAGA 13.82 AAAGCG 13.82 GAGTAA 13.8 GATTGA 13.77 TTGAAA 13.74 TAATTT 13.71 AGTTGT 13.57 GGAGTA 13.54 TAAACG 13.52 CCGCTG 13.48 GGCTGC 13.46 GGTACT 13.42 GTGCAA 13.36 TCTGAA 13.23 TCCAGG 13.15 CTTTAC 13.11 GGAAAA 13.07 ATCCTT 13.06 GAAGGT 13.04 GATTAA 13 CAATTG 12.98 CATGCC 12.96 TCTTTA 12.95 GATTTT 12.9 TTTGAT 12.87 CCACTC 12.84 TGTACA 12.83 TATGCC 12.83 GCTGCC 12.82 ATGGTT 12.82 GTTCCA 12.79 ATCCCT 12.79 ACTAAG 12.76 ATTCTC 12.75 AACCTC 12.75 CCTATG 12.71 GAATGA 12.69 ACAAGT 12.63 TACTGT 12.62 AGGTAA 12.62 AACGAC 12.6 TCCGCT 12.59 TCAAAC 12.55 GCACTT 12.49 AATGCC 12.48 ACGCTT 12.45 CAACGC 12.44 TAACTC 12.43 TCTTAC 12.42 CTTCCC 12.42 ACACTT 12.38 TTTTAA 12.23 GAACCG 12.23 GGGAAT 12.21 TTCTCA 12.16 TGCTCT 12.15 GTACAC 12.13 TTTTTT 12.1 GTTTCA 12.07 CCCAAT 12.04 TTCAAG 12.03 TTGAAT 12 AGTATG 11.99 TAGTTT 11.98 CGACCA 11.98 GCATGA 11.98 CAGGAC 11.97 GCCTCA 11.96 GTCTAT 11.95 CTATCC 11.89 TGCCAT 11.88 CGATCA 11.82 AAGGAT 11.76 GTGGAT 11.71 CCATGG 11.69 TCAACC 11.69 TCCCAA 11.68 GCTGAC 11.66 TCAAAG 11.63 GACACT 11.61 TCCAAG 11.61 CGGCTA 11.53 GCCATG 11.51 GCCCAT 11.46 GAGCCA 11.41 GAAAGA 11.4 GCGTAT 11.39 AAACGG 11.38 CCCAGT 11.36 ACACGT 11.35 TTCCCC 11.35 GGCACC 11.33 AGCCGG 11.32 TTAAAG 11.31 CTATAG 11.27 ATCTTG 11.27 TACTGG 11.23 CTCAAT 11.2 GCTAAA 11.18 GGTTAT 11.16 TGCCAC 11.14 GAGACC 11.07 GTTACC 11.04 AGGAGT 11.04 CCGCAG 11.03 CAAATT 11.02 CTTCTC 10.99 TATGTT 10.99 AATTTC 10.99 ACCGCT 10.99 CCCGCT 10.9 CGATTA 10.87 ACATCG 10.86 CCGGCT 10.85 TAGATC 10.82 AAGTTG 10.82 CTTGAT 10.79 TACCGC 10.78 AAAGGC 10.74 GATCTA 10.72 TCCCCT 10.64 GATAGT 10.62 GGATAA 10.61 TGAGTA 10.57 GGAGTT 10.54
ACGCAC 10.52 CCCATT 10.51 TGTAAC 10.49 GATTTC 10.48 TAACCC 10.46 AATGTA 10.46 ACGGCC 10.46 TGCAGG 10.44 CTGTAC 10.44 AACATG 10.43 ACTGGT 10.38 AAGGCC 10.36 TAAAGG 10.29 TATTGT 10.25 GGAGGA 10.19 AAGTGA 10.18 ATTTGG 10.18 TGTTTT 10.17 CAAAGT 10.16 AGTCAC 10.14 CTGAGG 10.12 CTAGAT 10.11 AATTGG 10.08 GGAAGA 10.08 CTCTTA 10.04 CTCTCA 9.99 GAACTT 9.97 AGAGAA 9.94 GAGGAT 9.93 GGGAAA 9.93 CCCTGA 9.92 CCAATG 9.9 TCATGA 9.89 CCTTCT 9.88 TCATTG 9.81 TACCCC 9.78 TTCTGA 9.75 AGAACG 9.72 ACGCTA 9.69 CTCCTA 9.69 TCCGCA 9.59 TTCACG 9.57 CGAATA 9.54 ATTTTG 9.43 GCCACA 9.39 CCTAGA 9.37 TTATCC 9.33 AGGCAC 9.29 GGCAAA 9.28 AACCCG 9.28 GTTAAT 9.27 AATGGC 9.23 GTATAC 9.16 CAGTCT 9.12 CTCAGT 9.12 TTTATG 9.09 TGAGCC 9.05 GGTGAA 9.04 TAAAAT 9.04 CACACG 9.02 GTACTT 9.02 TTACCG 9 GCCAGA 8.99 TCGCTA 8.97 GGCTCT 8.95 GACAGA 8.93 GGAATT 8.9 TATTCT 8.89 CCGCAC 8.89 TGCCAA 8.87 GCCAAC 8.84 GATCCT 8.82 ACGCCA 8.74 AAAAAG 8.73 CCAAAC 8.69 TAACCG 8.68 TTGAGC 8.68 GCATTG 8.65 CACTGG 8.65 GTAAGA 8.62 GACAAA 8.62 CCCTTC 8.61 TTAATC 8.61 GTACAA 8.54 ATAAGA 8.53 AATCCG 8.5 TTCTTC 8.39 CATGAG 8.38 GAAATT 8.32 CATACG 8.31 TCTGAT 8.28 GACCAA 8.27 TAAGAG 8.24 GGATTG 8.2 CAAATG 8.17 CCACGG 8.17 GAGAGA 8.12 GCTTAG 8.08 CAGCGT 8.07 GTGCTA 8.07 TTAACT 8.05 TGATCC 8.04 AATGAC 8.04 GTAACC 8.01 CTCAGG 8 CGATAC 7.98 CTTTTC 7.89 TTCAGT 7.81 CCCCTT 7.75 TGCACG 7.71 TTCTTA 7.71 TAATGC 7.7 CCTGAG 7.69 TATCCG 7.64 GACATC 7.64 GACCCC 7.61 CTTTGA 7.6 TTAAGA 7.56 CACGAC 7.55 TAAATT 7.54 ATTGAC 7.51 AGAAAG 7.5 TTTGCT 7.5 CCAAAG 7.46 CACGGC 7.4
GTTTTT 7.39 TGTGAA 7.37 GTAATC 7.37 CGTATC 7.36 TACGAT 7.3 GGACAT 7.28 CCCTTA 7.23 GATTTG 7.22 ATTTGT 7.2 ACATGT 7.19 CACGCT 7.18 TGCTGG 7.14 CACCGA 7.05 ATCCGA 7.01 TAGTTC 6.93 CTGGAC 6.9 CCTCAC 6.9 TGAATG 6.89 GCCCAG 6.83 CGGCTG 6.82 CTTGTA 6.77 AATCTC 6.73 AAGAAG 6.68 GAATTG 6.67 AAGGAG 6.63 TAGGCT 6.62 TTTGTA 6.58 TTCTAA 6.55 TCTCAG 6.51 ACCCTA 6.51 TTATGC 6.47 CTGGGA 6.46 TTTGGA 6.43 CTTTGC 6.39 GGAAAC 6.38 AACCGA 6.33 ACGATG 6.33 GCTACG 6.32 CTTTAG 6.28 GCAGGC 6.25 CTGCCC 6.22 TTCTTT 6.2 GCACTG 6.19 ATAGTC 6.11 GCTCAC 6.11 ATTGGT 6.09 GTACTG 6.09 GGTATC 6.07 CCCAAA 6.05 CATTGT 5.96 GTGCAC 5.86 GTTTTA 5.81 GCAAAC 5.79 CGCACC 5.79 CTACCG 5.78 GGGATA 5.77 ACAGGT 5.76 GCTGAG 5.75 AAATGT 5.7 TGTAGT 5.67 TGATGG 5.64 ATGCCC 5.63 TTTCCC 5.63 GCCAAT 5.59 AAGGTA 5.58 GTATCC 5.56 TGGACC 5.48 AGGCAT 5.46 GATGGT 5.44 TTCCTT 5.44 TGGAAG 5.39 CCTATC 5.33 CGGACA 5.31 AGGGCT 5.22 TTTAAC 5.22 TTGTAA 5.21 ATAGGC 5.18 TGTTAA 5.15 TGACTA 5.12 CCCCTA 5.11 AGATGT 5.1 GACAAT 5.09 GATCAA 5.07 GCCAGC 5.05 TCATCC 5.04 AGTTAA 4.96 TCTCAC 4.95 ACGGCT 4.94 TCTATA 4.87 GTAGGA 4.85 TTTCTA 4.85 CAGAGG 4.84 TTTTTG 4.77 TCCTAT 4.76 GAAGGC 4.74 TCAGAC 4.73 GCAGCG 4.71 AGTGGA 4.7 CCACGC 4.69 TTGTTA 4.62 CTTAAA 4.62 ACTGCG 4.61 GTTCAC 4.59 TCAAGG 4.58 AGGATG 4.56 CCCTGT 4.46 CAAAGG 4.45 TTTAAA 4.39 TTATGG 4.38 CTAGAA 4.37 CCGTAA 4.36 TAGCCG 4.36 ACTTTG 4.36 GACTGA 4.33 TCACAC 4.31 GGTAGA 4.27 GACTGC 4.25 AGATTG 4.24 CGGCTT 4.23 ATGTCA 4.23 TCTTGA 4.2 CTTTTG 4.2 TGTAAA 4.2 GCTTTG 4.19 CCAAGT 4.16 TGTACC 4.15
AAAGTT 4.14 ACCGTA 4.1 TACGAA 4.04 CTTATC 3.94 CCTCAA 3.94 ACCCGA 3.93 GTTGAT 3.93 TGCTGT 3.92 GTTCAG 3.91 TGGTTA 3.91 AAAACG 3.88 GCGCAG 3.86 CCTTTC 3.85 TCTCAA 3.85 ATCTAG 3.83 GAGATT 3.8 ACGACA 3.75 TAGACT 3.73 TGTATG 3.7 GCTAGT 3.7 TAAGCC 3.7 AAAGGT 3.68 CTAAAT 3.65 CAGTGT 3.61 GAGTTC 3.56 AGGGCA 3.54 CGCTTC 3.53 TACCGA 3.51 TCCTCA 3.51 AGCAAG 3.5 GAAGCG 3.49 GCCTTA 3.43 TTAGTT 3.4 ACCGAC 3.39 GCAGGA 3.39 ATGCGA 3.38 ACGAGC 3.35 GCAGGT 3.33 AGGGAT 3.33 CAGGGC 3.29 AAGGGA 3.26 AGCGGC 3.25 GACCCT 3.25 CGCCAT 3.18 GTGAAA 3.17 AGAGGA 3.16 GGGATT 3.16 ACGGAT 3.13 TGCTAG 3.1 TATGCG 3.06 GACCTG 3 TTGGAT 2.99 TACTTG 2.98 GACAAG 2.95 TATGAG 2.93 GACTCT 2.87 GTTGTA 2.85 GTCACC 2.84 CATGTC 2.82 TGGTAC 2.78 CTCCTT 2.78 ATCTGT 2.78 AGGACT 2.76 GGTAAC 2.76 TCCCAT 2.75 CAATTT 2.73 GCTGGT 2.69 ACGATT 2.63 CGAACT 2.6 GACACG 2.58 ATGTGA 2.58 CCTAAA 2.57 TGGCAT 2.49 CTGGTA 2.48 ACTTTC 2.47 GAGTAG 2.46 TTTCCT 2.4 CCACAC 2.39 TGTTCA 2.38 AACTTA 2.38 TGTTGA 2.35 GAAAGG 2.33 ACGGCA 2.33 GAGCCG 2.32 TCTTAG 2.32 CAATGT 2.29 GTCCAT 2.28 ACCGCA 2.24 CTCCTG 2.22 CTAGAG 2.19 TCATTC 2.19 AAGGCA 2.18 CCCTTT 2.15 AGGTTC 2.11 CTTAAC 2.1 TTGACC 2.07 GCTTTC 2.06 AGACAA 2.06 TTTCTG 2.02 GGTGAT 2.01 CCTCAT 1.99 GAGAGC 1.95 GCCTTC 1.91 TGATGC 1.88 AGAGGC 1.87 GATGAC 1.87 GTTTCT 1.83 TAACGA 1.8 CTTACC 1.79 ACTGAC 1.72 ACGCAA 1.7 CGAATC 1.69 GGACAG 1.64 GCCGAT 1.64 TGGGAA 1.62 AGACGC 1.6 TTACCC 1.58 CAACCG 1.55 CCCTCC 1.51 TTCAGG 1.48 TCACGA 1.48 TGCTTT 1.44 AGGGGA 1.42 ACGGAC 1.41 CTCCCC 1.38
ACCTTG 1.35 AGAGTA 1.3 GCCAAA 1.29 AAAGTG 1.28 CCCCTG 1.21 TTGAAC 1.21 GATGAG 1.21 GCGCTG 1.2 TCAATG 1.17 CTTGGA 1.16 AGGGAA 1.14 GTTGAA 1.14 AGAGTT 1.08 AGACGG 1.08 TTGGAA 1.05 TCTCCC 1.02 CTCTAA 1.01 TCTGAG 1 TCGATT 0.95 ACGAAT 0.83 TGGAGG 0.82 CATGGT 0.82 GAAGAG 0.81 TTCCTG 0.78 CGCTTT 0.75 CGGAGA 0.75 GATAAG 0.72 GGCATT 0.71 GGCAGT 0.67 ATTCGA 0.67 CATTTG 0.59 TCTTAA 0.58 ATTGAG 0.55 TTTTCC 0.54 CAAAAC 0.47 AGTGAC 0.47 GCCTCC 0.45 GACGCT 0.39 CATCCG 0.39 CTATGG 0.38 TCATGG 0.37 GGGACA 0.36 CCTGCC 0.36 CAGGGA 0.34 TTCGCA 0.32 AAGGTG 0.25 GATGTT 0.2 TTTTAG 0.18 TGGTGA 0.16 CTGTGA 0.14 GGCAGA 0.11 GTGTAT 0.1 CCCTAA 0.09 TCTCCT 0.06 ACTCGA 0.05 TACCTC 0 AATCGC -0.05 ACTTAA -0.05 CTCAAA -0.06 GCCCCC -0.1 GGTTAA -0.11 GCGAAA -0.15 CTAGTT -0.16 TCCCCC -0.21 AACTTG -0.22 CTCCGC -0.27 AAACGA -0.29 TGCCCC -0.34 CGCTGC -0.35 AAAAGG -0.35 TGCATG -0.38 CAGACG -0.39 TGACAC -0.39 CGATGA -0.4 TTAAGG -0.41 TTGGAG -0.41 GCCCAA -0.41 AGGTTA -0.42 ATTTAG -0.45 AGATTA -0.46 AGGTTT -0.49 GCCTAT -0.53 TCATGC -0.55 CTCATG -0.58 CAGTCC -0.59 GTATGA -0.64 CCTCTA -0.65 CATTCT -0.65 CCGACA -0.73 AGTTAG -0.81 GCCAAG -0.86 ATTCTG -0.86 GAGTTG -0.88 AAAGAG -0.91 TGTGCT -0.96 TCTAAG -0.96 AAACTT -1.01 GCGGCT -1.04 TTAGAC -1.04 TTAAAC -1.08 AAGGTT -1.14 AGTTGG -1.15 AGAGGT -1.2 CCCTAG -1.2 CCGCTC -1.21 GCATGG -1.24 GCTAGA -1.26 ACGATC -1.27 CGTGCA -1.27 TTTAGC -1.32 CTCATT -1.33 CGCAGT -1.35 AATTGT -1.36 TGACAG -1.37 ATGCCT -1.38 AAGTTC -1.41 CTTGAC -1.45 TTTTGA -1.48 ATAACG -1.48 GCATTC -1.49 ATCGGC -1.51 GTAATG -1.54 TAAACT -1.55 GAATGG -1.56 AATTTG -1.6 CCTCCC -1.61
CGGATT -1.62 TTGAGA -1.64 GTGAAG -1.66 GCCCCT -1.7 CGTTTA -1.73 GAGGAA -1.76 CGTTCA -1.77 TTCGAA -1.81 ATCGAC -1.83 TTTTTC -1.87 TGCGCA -1.89 ACCGAA -1.9 CTGCGC -1.93 AAGTCA -1.93 TTACGA -2 TGGACT -2.05 TACGCT -2.06 GAGGCA -2.1 TTGATG -2.12 ACCGAT -2.13 TACTCT -2.17 CGCCAG -2.18 GAGTTA -2.18 CACGTT -2.2 CTGCGA -2.22 GTGCTT -2.23 AATGAG -2.24 AGTGTA -2.25 CTTATG -2.26 TCTCTG -2.27 CCTAAT -2.29 GGAATG -2.29 CCATTG -2.34 CGATAA -2.35 ACTTGA -2.35 TTGGTA -2.35 TAGAGA -2.36 GACATT -2.38 GGGAAC -2.38 TGACAA -2.38 GTGCAG -2.42 CGGCTC -2.43 ATTGTT -2.45 ATGAGT -2.46 GGATGA -2.48 GTTCTA -2.49 GTTAAA -2.5 ATGTTC -2.57 CCTAGC -2.61 CCCTAC -2.61 AGAATG -2.65 CGAAGC -2.7 CGGTAA -2.71 CTAATC -2.72 ACCTAA -2.76 GCGCCA -2.8 GTCCCA -2.83 CGAGCA -2.88 TCAGGT -2.9 AGAGTC -2.92 GAGGAC -2.92 ACGAAA -2.95 AGGCAG -2.97 GGACCT -2.98 TCACTC -3.01 GACTGG -3.03 CTTGAG -3.03 CGAGCC -3.07 GGCTGT -3.1 GCCGCT -3.11 GGACAA -3.11 TACCCT -3.12 GTCAGC -3.12 CTGTTC -3.18 CCGAAT -3.21 AGAGCG -3.21 ATGGTG -3.29 TCCTTT -3.3 CATGAC -3.31 TAGACC -3.31 GGACTC -3.32 CCCTGC -3.32 GGAAGG -3.35 GGTTCT -3.38 GCAATC -3.41 AGTCTT -3.46 TACGGA -3.49 CGCACT -3.51 GCCTGC -3.57 GGACCC -3.57 GCCTTT -3.58 TTTAGT -3.6 GGTGCT -3.6 CGACTC -3.65 GGATAG -3.69 GGATGC -3.7 ACTCTT -3.73 ATTGCC -3.84 TGAACG -3.84 CTTTTT -3.89 GAATGC -3.91 TATAGG -3.92 GTATAG -3.93 GAGCGC -3.96 ATTGTG -3.97 TCAGAG -3.97 GGGATC -3.98 CCGCCA -4 TGTCCA -4.01 TGTTCT -4.03 AGGCCA -4.04 CCTTAC -4.05 TTTTCT -4.07 CATCGA -4.09 AGCGAA -4.12 AAAGGG -4.12 GGGAGA -4.13 CTGAGT -4.13 GAAGTC -4.15 CGTAGC -4.16 CGGCAC -4.18 TGCGAA -4.19 TCTTTT -4.21 ACGGAA -4.22 CCGACT -4.25
ACCTGT -4.26 ATCGTA -4.29 TATGGT -4.29 TAATCG -4.31 CGATTC -4.32 GGGAGC -4.38 CTCTAC -4.38 CGTACA -4.41 CAAGTT -4.42 TAAGGC -4.46 AAGCGA -4.46 GGTACC -4.48 GACAGT -4.49 CCGCAA -4.53 GCTAAC -4.61 TCCCTA -4.62 CAGGTG -4.63 CAATGG -4.64 TAGTCA -4.67 TAGACG -4.67 CGTGAA -4.7 AGACGA -4.7 AAGCGT -4.74 TGGGAT -4.81 CCGAAG -4.83 CGAAAA -4.87 AGCCCG -4.93 GGCTGG -4.96 GTCACT -4.99 CAACGA -4.99 TGACCC -5 GCCGCA -5.04 GTTCAA -5.06 TCGCTG -5.07 GTGAAC -5.11 CCTTAG -5.16 ATAGGG -5.17 CAGTGC -5.18 AGGCGA -5.2 CGAACC -5.2 ACTCCG -5.21 CTCCTC -5.24 GGTCCA -5.25 AAATTG -5.27 CAAGTC -5.27 TACCCG -5.28 CTTTCC -5.29 GCACTC -5.29 TTGGCA -5.3 ACTTGC -5.32 AGTCCC -5.32 TGGCAC -5.33 GTGGAA -5.33 GGCCAT -5.36 GCGGAT -5.39 GCGCAT -5.4 GGGGAA -5.4 TCTAGA -5.4 ACTTGG -5.44 TGCGAT -5.45 GCGATA -5.45 TGCCCA -5.45 TGGCTT -5.48 AGAGAG -5.48 TTGCTT -5.51 AATGTG -5.57 TTACGG -5.57 AAGGTC -5.59 TGAGAC -5.62 GACTGT -5.69 TTAGTG -5.71 CATTGG -5.71 CAGGTC -5.73 TCCCTT -5.8 CGAATT -5.82 AATGTT -5.82 GGCAAT -5.83 TAGGAC -5.91 TACGGC -5.94 TCTTCT -5.95 GGGCTC -5.97 TCGCAT -5.98 CTAGGC -5.98 CCTTTT -5.99 CCAGTG -6 CACGAG -6.01 TCCTAA -6.03 TAGGCA -6.08 TCTAAC -6.1 CACCCG -6.13 CTACGG -6.14 AGGTGC -6.16 CCCATG -6.17 ACGCCC -6.17 CGATCC -6.18 GAAACG -6.2 ATGTGC -6.21 GCAAGC -6.24 AAATCG -6.25 CCTCTC -6.29 ACCGGC -6.31 TTTAGA -6.33 CGACTG -6.33 AGGCAA -6.33 GGACAC -6.35 TAGCCC -6.37 TCTGGA -6.37 TAAAGT -6.37 TGAGTT -6.37 AAACCG -6.45 ACCCGG -6.51 CCTGAC -6.51 AAATTT -6.52 AACTCG -6.52 AAGGGC -6.52 TTTTGC -6.54 GGAAGT -6.61 GGTTAC -6.66 TCGTAT -6.68 GTTCTC -6.7 GGAAAG -6.72 TCCTTG -6.72 GCGAAT -6.75 AGTCTC -6.77 GGCACT -6.8 GCTCTG -6.8
CTACCT -6.8 TTGACA -6.81 AGCGTA -6.81 AGCGTT -6.83 TCGCAG -6.85 CGAAAT -6.88 GCCCTT -6.9 CATCGT -6.91 AATTAG -7 GACGAT -7 AACCGG -7.03 TTGCCA -7.04 CTAGCC -7.1 CACGGT -7.11 CTCTTC -7.13 AACGCC -7.15 GTTATG -7.15 ACTGTG -7.15 TAATGT -7.16 CCAACG -7.21 GCCTTG -7.21 CCTTGT -7.23 TTCTGC -7.23 TAAGAC -7.23 GCTGTG -7.24 CCCCTC -7.25 GACTAA -7.25 CGCTCC -7.27 GCGACT -7.27 TTCCCT -7.28 CGCCCA -7.29 TGCGCT -7.33 CCCCCC -7.34 TTAGAG -7.34 CCTGTT -7.36 TCTTCC -7.38 CCATCG -7.38 TCTAAA -7.39 CTAATT -7.42 AAGCGC -7.42 CTCTGT -7.48 AGGCCT -7.48 TAGGAA -7.51 GTTCTT -7.54 GTATTC -7.63 ACGAGA -7.68 ATGTTT -7.68 GGGTAT -7.76 ACTAGG -7.77 CGGAAA -7.79 ATGGCC -7.82 GTTATC -7.85 TCGACT -7.87 CTTCTT -7.9 AACGAT -7.91 GATCGA -7.94 CTCTAG -8 CTAACC -8.08 CTAGGA -8.08 GATTGT -8.1 CCCGCA -8.1 CGAGTA -8.11 TGGGCT -8.15 GGCTTA -8.19 TCGGCT -8.24 GATGGC -8.25 ACGCAT -8.3 CCGCTT -8.3 TGGCTG -8.32 ACTCTC -8.35 GCCCAC -8.37 CGCTGG -8.37 TTGCTC -8.38 TGGTAG -8.38 CTCTGA -8.49 TACTCG -8.59 TGAGAG -8.6 GCACCG -8.61 ATGGGA -8.69 TGACTG -8.7 CGATTT -8.72 CGGAGC -8.74 CGGATC -8.78 AGTCAA -8.79 TTCCTA -8.79 CCTAGG -8.79 GTTGGA -8.82 AGTCTG -8.83 CAAGGT -8.85 AATTCG -8.91 ATTCGC -8.93 GAAAGT -8.99 CTAGAC -9 AACGAA -9.02 CGACAA -9.03 GCCTAG -9.04 AAGTGC -9.06 GGTGTA -9.06 GATAGG -9.08 TTTGCC -9.1 TTTAAG -9.1 CCCCCT -9.1 CGATAG -9.13 ATCCCG -9.15 GTCACA -9.21 GTCCAG -9.24 CAAACG -9.25 AGGCCC -9.29 AGGGAC -9.3 CTGACC -9.3 GCTGCG -9.34 TTTCTC -9.36 CGACAG -9.37 TGAGGA -9.41 CCAGGG -9.43 AGTCTA -9.43 GCCGAA -9.48 TCCCTC -9.49 AAGTCT -9.51 AGGGCC -9.52 GCAGTC -9.54 ATGTTG -9.55 GTAAAC -9.56 GAGTTT -9.58 ATGCGC -9.6
CTCCCT -9.65 TTTTGG -9.67 GTCAAT -9.69 TAGGAG -9.7 CTTCGA -9.71 AGTTTA -9.73 GTAAAG -9.78 CGCCAC -9.81 GACAGG -9.82 AGGAAG -9.83 ACGTAT -9.85 GAACGC -9.88 AAGAGT -9.91 CACTTG -9.92 GCGATT -9.92 CGCCAA -9.93 GCTTAC -9.94 TGACTT -9.94 CATGTT -9.95 TGATTG -9.97 TCACGG -9.98 TCGAAT -9.98 CTCTTG -10.02 GTGATT -10.03 GAACGA -10.03 TGTTCC -10.05 TGTTTC -10.07 TCTTAT -10.08 GAGACG -10.09 CGGTTA -10.12 GCATGT -10.13 GGATGT -10.15 CCTTGG -10.18 GAATCG -10.2 GGGCTG -10.21 TAGAGT -10.25 TAGCGG -10.25 GCAGTG -10.25 GTCCAC -10.28 GAGTAC -10.33 CCACCG -10.36 CGACAT -10.37 GGGGAT -10.38 CGCTAA -10.4 CCGTTT -10.41 TCTAGC -10.42 GGGATG -10.45 CTGTGC -10.48 CTAAGG -10.48 TTGATC -10.5 ATTGGC -10.52 AGCCGT -10.56 ACTGGG -10.56 CTGGCT -10.58 ACGCCT -10.59 ATACGT -10.63 GGTAGC -10.65 TGTCAT -10.65 GATGCC -10.66 GGTTTA -10.7 GTGCTC -10.84 TAAGGA -10.86 CTTAAT -10.91 GATCCG -10.94 CGAGAT -11 GGCGAA -11.02 CCGCAT -11.03 GGCGCT -11.04 GCACGA -11.04 TGCCGA -11.07 GGCATC -11.1 TCGGCA -11.1 GATTAG -11.14 TCCTTA -11.15 CTAAAC -11.17 CGGAAG -11.23 CTTTGT -11.26 TTAGGA -11.27 CCGGAT -11.36 ATTAAG -11.38 GTGCTG -11.41 CTCTCC -11.45 TATTCG -11.47 GCCCTG -11.51 TCGCCA -11.54 TGTAGA -11.62 CTAGTG -11.62 CCGCCC -11.66 CAAGCG -11.66 GGTGGA -11.74 ATTAGG -11.75 GCCTAC -11.77 CTCACT -11.78 AAGCGG -11.79 AACCGT -11.81 AGATCG -11.85 TGACTC -11.92 TTCTTG -11.94 ATCGCC -11.99 ATCGAA -11.99 GGTTTT -12.02 TGGCAA -12.04 CGCCTT -12.06 TTGTAG -12.07 ACTTGT -12.08 TGGTTT -12.08 ACTCGG -12.09 TATGGC -12.1 TTGGTT -12.12 GCGATG -12.19 CAGGGT -12.2 AGTTTG -12.24 TAATCT -12.24 AAACGT -12.25 CGCAAT -12.28 CCCTCT -12.28 GGGCAT -12.33 AGTGGC -12.33 GCCAGG -12.34 TAAGGT -12.35 GGCCTT -12.37 GGGAAG -12.37 TGCCTA -12.4 CCGTCA -12.43 GTATTG -12.44 GTGACA -12.48
CGGCAG -12.51 TGTGAT -12.53 GACGCA -12.56 CAAGGG -12.58 GAGTCA -12.63 GCCGAG -12.66 CTTTCT -12.68 GACTTT -12.69 GGTCAA -12.72 TCGCAC -12.75 TCTTGC -12.82 CCTTTG -12.82 TTCGCC -12.88 TGGTCA -12.91 GCGCTC -12.95 GAAGTG -12.95 GCCTCT -12.96 AGGTGG -12.96 CAGTGG -13 GTACCC -13.02 TTCCTC -13.04 TCGACA -13.05 TGGCAG -13.07 CCGAAA -13.09 CTGCCT -13.11 ATGGGC -13.12 ACCGAG -13.13 CGTAGA -13.16 GGGCTT -13.18 CCGAGC -13.19 GACTTG -13.23 CTGACT -13.26 GAGGGA -13.28 AGTCGA -13.32 CCCGAG -13.32 CTTCCT -13.32 TCACGC -13.37 TAGGTG -13.39 CCTCTG -13.41 GCGACA -13.46 GCTAGC -13.46 TCATCG -13.48 CCCGCC -13.49 GTCCAA -13.5 TGGAGT -13.55 ACGAGT -13.6 CCCGGC -13.6 ACGGTA -13.65 TCCTGG -13.65 CGATCT -13.73 CAATCG -13.76 CTACGC -13.79 ATCACG -13.84 CGCTCT -13.89 CCCGAT -13.92 CGGTAT -13.94 AAGTCC -13.95 GGCATG -14 ATGAGG -14.05 AGGTCT -14.05 CTTAGT -14.06 ACTCGC -14.08 ACGAAG -14.09 GGGACT -14.1 AAGACG -14.11 TCCTGC -14.11 GCTCTC -14.12 TCTACG -14.14 TTGAGT -14.15 TCGAAC -14.16 CCCTTG -14.27 GTTCCT -14.28 GTCTCC -14.29 ACCGTC -14.35 TCTTTG -14.39 GGTTCC -14.39 GTTCCC -14.42 CGCTGT -14.51 CAACGT -14.53 CAGGCG -14.56 TACGCC -14.59 CGAAAC -14.6 TCTTTC -14.65 TGCCCT -14.67 GCCCTA -14.68 GTTTTC -14.68 GTATGC -14.7 GAAGGG -14.72 CGAAAG -14.79 GATTCG -14.79 CGATGC -14.9 TGAGCG -14.92 ACGCGG -14.93 CTCGAG -14.94 TGCGGA -14.95 ATGTCC -15.01 CGGCCA -15.02 ACCTAG -15.05 GTCAAA -15.06 GTGCCA -15.08 CCCCGA -15.11 CTGGCA -15.12 AAGGCG -15.13 GATTGC -15.14 TTTGAC -15.14 GTAGGT -15.16 GTTGTT -15.17 CCTAAC -15.17 GGACTT -15.18 CGTAAA -15.2 TCATGT -15.21 GGGACC -15.22 GGGCAG -15.23 CTGGTG -15.25 GGATGG -15.27 CCGTTA -15.31 GACGCC -15.32 CGCATC -15.33 ACGCTC -15.33 AAAGTC -15.35 GGGGCA -15.38 CTCGCA -15.38 GCACGG -15.39 AGCGAG -15.4 ACTGGC -15.44
CTGTCA -15.51 AGCGTC -15.52 GAGGAG -15.53 GTGTAA -15.58 TTGTAC -15.6 TCAGTG -15.65 GGCGCA -15.71 GCGAAC -15.71 TCTCTA -15.73 CCCGAA -15.75 TGAGGC -15.76 CCCCGG -15.78 CCTCGA -15.83 TATCGG -15.85 ATCCGT -15.86 AGCGGG -15.87 CCCACG -15.87 ACTGTC -15.88 GTTTAA -15.92 TAGTGG -15.97 AATGGG -15.99 ATCGAG -15.99 GTCCTT -16.01 AACGTG -16.03 CGCAAG -16.03 GGCCCT -16.05 CACGTA -16.06 TAGGGA -16.09 CGGCAA -16.12 CCTAAG -16.15 TCGAGA -16.16 GCCTGA -16.16 GACCCG -16.19 GTTAGA -16.27 TGCTTG -16.27 TCGAGC -16.29 ACGGTG -16.32 TCGATC -16.34 CAGGGG -16.36 GAATGT -16.41 TTGACT -16.46 TCAGTC -16.47 GCTCGA -16.48 AATCGT -16.48 GCCCTC -16.49 GACGGA -16.49 AAGAGG -16.52 CGTTAC -16.52 ATCCGG -16.55 TTATGT -16.55 CTTCGC -16.56 GAGTCC -16.57 GAGAGG -16.6 TGTCTT -16.61 AGAGTG -16.64 ACCCCG -16.65 TAACGG -16.65 CTCGGC -16.66 TAGAGG -16.67 CTTCCG -16.75 AACGGA -16.76 AAGTTT -16.76 GCCTGT -16.77 AGTCCT -16.79 GAACGG -16.8 GGCAAC -16.84 CTCGGA -16.85 TCGATA -16.85 ATGGGG -16.85 GGAGGC -16.88 CCGCCT -16.93 CCTCCT -16.95 AAGGGG -16.95 ACCGTG -17 GCCTAA -17.04 TGGGAC -17.08 TGGATG -17.08 TATCGC -17.09 GGACTA -17.1 CGAAGG -17.11 TCTAGT -17.14 GTCAAC -17.15 TTCTAG -17.16 CGAGAC -17.19 AAGGGT -17.2 GCGAAG -17.21 GCAAGT -17.22 CGGCCC -17.26 ATTTCG -17.3 GTGGTA -17.33 TGGTTC -17.37 GCATCG -17.37 GTACTC -17.39 ACGTAA -17.4 CTTGTT -17.4 GGACTG -17.41 GCCGTA -17.43 CCTGGC -17.44 AACGAG -17.52 CGCAGG -17.55 TCTTGG -17.58 AGACCG -17.62 TGCGAC -17.65 CAGTCG -17.66 GCCGTT -17.66 TAACGC -17.67 CGACAC -17.69 CCCGGA -17.72 GTCATT -17.72 ATCGGA -17.74 CCGAGT -17.76 GGTTTC -17.8 CGCATT -17.82 CCTTGC -17.83 TCTGCC -17.83 GCAAGG -17.84 CCCTGG -17.85 GTTTAC -17.87 AGGTCC -17.91 GCTTGT -17.93 CCGATC -17.95 TCGAAA -17.95 CTTGCC -17.99 TCCGAC -18 TATCGA -18 GATTGG -18.08
CGTTAT -18.09 TATCGT -18.16 TTTCGC -18.18 AAGTGG -18.22 GGCCCC -18.22 GGCCCA -18.24 ACCGGA -18.25 TCAGGC -18.26 CGTCTA -18.28 GTCATC -18.3 GACCTA -18.31 TTGTTC -18.38 TCCTAG -18.4 ACCCGT -18.48 ATCGTG -18.49 TTGGAC -18.49 CGGAAT -18.51 CAACGG -18.61 ACCGTT -18.62 CCGTAG -18.63 TGCCAG -18.65 TGTTAG -18.77 CGACCC -18.77 TTGTTT -18.77 TCGCAA -18.77 ATGGTC -18.81 CGTGGA -18.81 TCCTCT -18.83 TCGCCT -18.84 TCGGAT -18.89 GCGACC -18.9 ACGTTT -18.91 TTAGCC -18.92 CTCTTT -18.92 ACTTCG -18.95 CTATCG -18.96 GCGCAC -18.96 TCGAAG -18.97 TTATCG -19.01 TAAGTG -19.03 TGATCG -19.03 CTCGAT -19.04 CTCGAA -19.13 CTCACG -19.18 GGCTTG -19.19 CGCCGA -19.19 CTTGCT -19.24 GTAGTC -19.28 CACCGG -19.31 TTTGTT -19.31 TCTGTT -19.32 TTTACG -19.34 GTCCCC -19.35 CGAGGA -19.35 CGGATG -19.35 CCGATG -19.37 CATCGG -19.38 GGTAGT -19.38 CCGTGA -19.41 TCCGCC -19.41 TCTCTT -19.42 GGAGAG -19.43 CATTCG -19.47 CGAATG -19.54 TCTCTC -19.56 GGCCAA -19.57 GCTGTC -19.65 ACCGCG -19.66 GTGAGA -19.68 GGCCAC -19.7 CCTAGT -19.71 TCTTCG -19.73 GTGATC -19.73 ATGTAG -19.77 GTGACT -19.79 GACGGC -19.8 AGGGGC -19.83 ATTCCG -19.84 GTTTCC -19.85 GGCAAG -19.96 CGGCAT -19.96 TCCCGC -19.96 AGTGTT -19.97 GCCGAC -19.99 CCGATT -20.01 ATTCGG -20.03 TACCGT -20.03 TCAGGG -20.08 GTTTGA -20.11 GCTCCG -20.13 CCTGGT -20.17 CCTCTT -20.18 ACGTGA -20.22 GTCTAA -20.25 TAAGGG -20.27 TCCCCG -20.29 CACGTC -20.32 GGCAGG -20.33 CGTAAC -20.35 GAGGCC -20.36 TAGTCT -20.36 AGGGAG -20.39 ACTCGT -20.39 CGCTTA -20.4 GCGGAA -20.46 GGCTAA -20.5 CCTTCG -20.52 TAAGTT -20.52 TTGGCT -20.53 CCGGAG -20.53 ACGCCG -20.58 GTCTCT -20.59 CCGAAC -20.66 AGGGTT -20.69 GGTCAC -20.72 AGTGGT -20.73 TGTCAC -20.75 CCCCCG -20.77 TTCGAT -20.79 CGTAGT -20.82 GCGGCA -20.82 TCCGAG -20.86 TCAAGT -20.87 CCGTCT -20.88 GGAGGT -20.93
CTGACG -20.94 TGCCTC -20.94 AGTCAG -20.95 TTCTCT -20.97 CGGTTC -20.97 TGTCTA -21 TCTCCG -21.04 CACTCG -21.05 TGACGA -21.15 GTCTCA -21.17 GTCAAG -21.27 CTTGGC -21.28 ACGTCC -21.28 CGGTGA -21.32 TTGGGA -21.4 TCGTAA -21.4 CGGAAC -21.42 GGTATG -21.43 ACCGGT -21.5 CCGGAA -21.51 TCGTTA -21.53 AATGTC -21.55 CATGTG -21.55 GCGAGA -21.58 TTTAGG -21.6 GAGGTA -21.69 CCGGCC -21.71 TGTGGA -21.72 CTCTCT -21.73 GTGGCT -21.74 GCCGCC -21.76 GACCGA -21.76 GGTCAT -21.8 TCCCTG -21.84 GCGCTA -21.87 TCCGTA -21.87 TTGTTG -21.9 GTCCTA -21.93 GCCACG -21.95 TGCGTA -21.97 TCCGAA -21.99 GCCGGA -22.01 GAGCGG -22.07 TTCTCG -22.07 GACGAA -22.08 CTGCCG -22.11 CTGGTT -22.11 AGGCCG -22.12 GAGTCT -22.25 ATGGCG -22.26 GGGCAC -22.28 AGTCGC -22.31 GCGGAG -22.37 TCTCGA -22.4 GACCGC -22.5 CTCGAC -22.51 ACGGGC -22.53 GCGCAA -22.56 CTCCCG -22.58 GTATGT -22.6 GGGCAA -22.61 ATCTCG -22.63 AGTGCC -22.66 GTCTTC -22.66 CGGGAA -22.68 CGATGT -22.69 GACTTA -22.7 CGCGCA -22.71 GACGAC -22.71 GGGGCT -22.72 TCCCGA -22.78 TCAACG -22.81 CGTCAA -22.81 GATGGG -22.81 TGCCTT -22.82 TACGGT -22.84 TTTGCG -22.87 CGCCCC -22.92 GAGGTC -22.93 ATTGGG -22.97 CGGACT -22.99 AACGTA -23.02 ACGTTC -23.04 GACTCG -23.1 CTGTTG -23.16 GCTGGG -23.19 CGTTTT -23.21 TACGAG -23.26 GCCAGT -23.28 TTCGTA -23.29 CCTCCG -23.29 TTCTGG -23.3 GGGGAC -23.32 GATCGC -23.32 CCCGAC -23.33 CGGGAT -23.34 GTGTTA -23.34 GTAGAC -23.35 GCAGGG -23.38 AGAGGG -23.41 ACGGTT -23.42 CGCCTA -23.43 GGGCTA -23.43 GTACGA -23.43 TTTGAG -23.44 TACGTA -23.44 GTGACC -23.47 CTCGCT -23.49 ATTGTC -23.58 TTAAGT -23.58 TTACGC -23.64 GTTAAG -23.65 CCGGCA -23.74 AACGGT -23.77 CGAGTT -23.8 GGCCGA -23.81 GCGGTA -23.82 GCAACG -23.84 GCGATC -23.9 CTCCGA -23.94 CGGCCT -23.97 TCCGAT -23.99 AGACGT -24.01 TTTCGA -24.02 TTTTGT -24.03 ATTCGT -24.04
TCACGT -24.05 CCTGGG -24.05 TGTAAG -24.09 AATGCG -24.13 CGTTCT -24.15 CCGAGG -24.17 TCTAGG -24.2 TGGGTA -24.22 GTGTTT -24.23 TGATGT -24.25 TAGGTT -24.27 ACTTAG -24.29 AACGTC -24.31 AGGTTG -24.34 GTAGCG -24.4 GTTAAC -24.41 TATGGG -24.43 TAGCGC -24.44 CGTCAC -24.48 TTCCGA -24.5 GACTAG -24.54 TGGGGA -24.57 GCGCTT -24.58 TTCTGT -24.59 GGAGTC -24.6 CGCCTG -24.62 CGATTG -24.63 GGTGAC -24.68 TCGTAG -24.68 TGTCAA -24.69 GGGTTC -24.7 TTCGAC -24.76 TGTGTA -24.79 GAGTGA -24.81 GACGAG -24.82 CTAGGG -24.83 GTTGAG -24.87 TGACGC -24.87 CGCAAC -24.94 CGCCTC -24.96 GAGCGA -24.96 CAAGTG -25.01 TGGTGC -25.01 ACGGCG -25.02 CGAGGC -25.03 TACGCG -25.05 CATGGG -25.06 CTGTCC -25.07 GTAAGC -25.1 CGTGTA -25.17 ATGCCG -25.2 ACGTAC -25.24 TTCCGC -25.28 GTCTTT -25.31 TCCGGA -25.33 TTGTGA -25.35 AGTTCG -25.37 AGCGGT -25.47 GCCCGA -25.51 CTGGGC -25.54 TAGTGC -25.55 TTGCCC -25.57 TCTTGT -25.63 TGCGCC -25.65 CGAGAG -25.69 TATGTC -25.72 TGTCCT -25.75 AATCGG -25.77 TTTCCG -25.78 TATGTG -25.8 TGGGCA -25.88 GCTTGC -26.03 TCGACC -26.05 TTAGCG -26.06 CCGTTC -26.08 CTAACG -26.09 GGCGAT -26.11 GTTAGC -26.11 GTGGCA -26.14 CCGGGA -26.15 GCCTGG -26.17 CTTAGG -26.18 AACGCG -26.19 CGCGAA -26.21 ATCGTC -26.24 CTTGGG -26.27 GCACGC -26.29 GAGAGT -26.3 GCATGC -26.3 ATCGTT -26.33 GAGGTG -26.36 TTAACG -26.36 CTGCGG -26.38 ACGGGA -26.47 GGCCTG -26.49 CCTGCG -26.49 AGGGTA -26.49 GAACGT -26.5 TTTGGT -26.53 ACGGAG -26.54 GGAGCG -26.73 CCGCCG -26.75 CCTACG -26.76 GTAACG -26.81 CCCGTA -26.81 GCTTCG -26.82 TAGTCG -26.83 CGTCCA -26.91 TGAGTC -27.01 CTCTGG -27.01 ATTGCG -27.01 CGATGG -27.05 GCTAGG -27.14 GGGAGT -27.16 ATGTCT -27.2 CTGGGT -27.21 GGACGA -27.23 CGTTTC -27.24 ATGACG -27.27 TTCGCT -27.27 AGGGTG -27.33 CTTCGG -27.4 CGAAGT -27.41 TTGCCT -27.41 GGATCG -27.41
AGGCGC -27.45 GGGTTA -27.47 ACGCGC -27.48 TTGTCA -27.57 TAGTGT -27.58 GAGGTT -27.6 TGTCTC -27.6 GTGATG -27.65 GGTCCT -27.65 CGGACC -27.65 TCGCTT -27.66 TCGGAA -27.69 ACGTCA -27.74 TTCCCG -27.84 GCACGT -27.87 GTCGCA -27.88 CGTTAA -27.93 ACCTCG -27.95 TGGGAG -27.96 CTGTGT -27.97 TAGCGT -28.06 AGGACG -28.08 GGCCTC -28.1 AGTACG -28.14 TAAGCG -28.21 CTGCGT -28.23 TGTGTT -28.25 GGGTAA -28.26 TTTTCG -28.33 GCGTTT -28.33 TCTCGG -28.34 GCGGAC -28.36 CGACTT -28.38 CGACGA -28.4 GTTAGT -28.44 CCTCGC -28.53 TTGCGA -28.62 GTCGCT -28.65 GTTCTG -28.7 CGCGGA -28.75 GACGTA -28.8 ATGTGT -28.81 CCGCGT -28.84 TTAGGC -28.88 CTTTGG -28.94 TACCGG -29 GTAAGT -29.01 ACGAGG -29.02 ACGTAG -29.02 TGGCTC -29.02 GCTTGG -29.05 ACGTTA -29.06 AGGAGG -29.07 TGACGG -29.11 CCACGT -29.16 CGTATG -29.17 CGGGCA -29.21 AACGGG -29.25 CTCCGG -29.27 GGGCCA -29.28 CGTACC -29.28 CCGTAC -29.41 CGTACT -29.46 CTGTCT -29.48 TGCCTG -29.64 CTGTGG -29.64 TGGTTG -29.7 GGTTGA -29.72 GAGGGC -29.76 TTCGGC -29.83 GGTTGC -29.89 TCTGGT -29.9 CCTCGG -29.96 GTTGAC -30 TTGACG -30.03 AACGTT -30.07 CCGACC -30.12 GGGTTT -30.13 GTCTAC -30.13 ACGACG -30.19 CGGGCT -30.2 GTAGAG -30.23 GGAACG -30.3 GTCTTA -30.3 GCTGGC -30.31 CGTGCT -30.39 CTACGT -30.41 CTTTCG -30.42 TGTCCC -30.46 CGGTAG -30.52 TCTGCG -30.54 TCGATG -30.54 TCGGAC -30.58 TCCGGC -30.61 TTCGAG -30.64 CCCTCG -30.66 CCGCGA -30.67 ACGTGC -30.67 GGCCTA -30.68 CCGGAC -30.7 GCGTAA -30.77 GTCCTC -30.77 TTCGGA -30.82 CCCCGC -30.82 AGCGCG -30.84 CTCGCC -30.85 GGCTAG -30.87 CTTACG -30.96 GATGTC -30.96 GGACGC -30.98 ACGTCT -30.99 TGTCAG -31 ACGCGA -31.01 GTTCGA -31.06 TTGAGG -31.08 TCGTAC -31.09 TTAGGG -31.1 TGCCGC -31.12 TAGGCC -31.12 CCCGGG -31.15 CGACCT -31.16 CGAGTC -31.3 TCTGAC -31.36 GTCCCT -31.46 TCTGGG -31.48 CGCGTA -31.55
TGAGGG -31.55 CGGGGA -31.59 CGACGC -31.63 TGAGGT -31.63 TTTGGC -31.64 CGTCAG -31.68 GATGTG -31.69 TGGCGA -31.75 GTGAGC -31.75 GTCGTA -31.76 TCTGGC -31.78 GTGTCT -31.81 GCGTCA -31.86 GCGCCT -31.88 CCTGTG -31.89 AGTCGT -31.89 TCGGTA -31.95 CCGGTT -31.95 CGCGCT -31.96 CTTGGT -31.98 TTACGT -32.02 GTGTAC -32.06 CGCTTG -32.07 CCGACG -32.12 CCGTGT -32.13 GTATCG -32.13 TTAGTC -32.13 TCGGCC -32.14 CATGCG -32.19 GTCAGA -32.21 ACGTTG -32.23 CGCATG -32.23 TCCTGT -32.37 GCGAGC -32.37 ACGTGT -32.41 ATGCGG -32.41 TGGTCC -32.44 ATGGGT -32.58 CGTCTC -32.61 TGTGCC -32.64 CTTGTC -32.65 GGCGGA -32.72 GTCTGA -32.74 CTGGTC -32.79 GGGGGA -32.83 AGGGTC -32.86 TAGTCC -32.91 CGGGTA -32.94 GCGTTA -32.98 GACCGT -33 GATCGT -33.15 ATCGGT -33.22 CACGGG -33.24 GACGTT -33.25 CACGCG -33.27 GGTAAG -33.36 GTCGAT -33.37 GATGCG -33.38 GGACCG -33.38 GCCCCG -33.46 GCGGGA -33.56 GGTCCC -33.6 GTATGG -33.62 CCCGTT -33.63 CGCGAT -33.69 CCGTGC -33.75 GACGGT -33.89 CGACCG -33.91 CCTGTC -33.96 GTAGTG -34.01 GGGTCA -34.05 TAGGGC -34.19 GTTACG -34.32 AGGTAG -34.33 GGCCGC -34.45 GCGGCC -34.5 GCCTCG -34.53 CGAACG -34.71 GTCGAA -34.72 CGTCCC -34.81 CTAAGT -34.82 CCGGTA -34.83 GTCTGC -34.87 TCGTGA -34.87 CGGAGT -34.91 GGGTAC -34.91 GTGGAC -34.93 ACGGTC -34.94 CTCGTA -34.95 TCGAGT -35 TCTGTG -35 GGTTGT -35.09 AGGGGT -35.15 TACGTT -35.18 TCGTCA -35.34 AAGTGT -35.39 TGTAGG -35.44 GCGGTT -35.48 TACGTC -35.52 TGTTGC -35.56 TTGGTG -35.57 AGCGTG -35.58 CTGGCG -35.58 TGTACG -35.8 CGTCAT -35.87 TCCTCG -36.02 GGGCCT -36.04 CTAGTC -36.07 TGTTGG -36.07 GTGGAG -36.09 GGCCGT -36.15 GTTTGC -36.17 CCCCGT -36.18 GTGGTT -36.22 CGCCCT -36.23 TCGCCC -36.23 GATCGG -36.23 TGACCG -36.25 GGGTGA -36.29 TTCCGT -36.3 ATCGGG -36.36 TCCCGG -36.42 TGGCCA -36.53 GTGTAG -36.53 ATGCGT -36.65
GCCCGC -36.69 TGGCGC -36.74 GTGGGA -36.74 TGTTCG -36.88 TGGCCT -36.92 GGTCTA -36.94 TGCGGC -36.96 CGTGAC -37 TAACGT -37.18 TCGTTT -37.19 CGCTAG -37.2 CGGCCG -37.2 CTTGCG -37.21 AGGCGG -37.21 CGTTGA -37.28 TGTTTG -37.33 GTAAGG -37.38 CGGACG -37.41 CGCCGT -37.43 CGGAGG -37.44 CGTTCC -37.45 TGCGAG -37.46 GTTGGT -37.56 TTTGTC -37.57 GAGGGT -37.59 TAAGTC -37.59 GGCTCG -37.63 GACGCG -37.63 GGGTCT -37.66 TCGCTC -37.67 TCTCGC -37.72 TTTGTG -37.74 ATCGCG -37.75 GGGGTT -37.76 GTCACG -37.82 GGTCTT -37.95 CCCGTC -37.96 CTAGCG -37.99 CGCACG -38.02 TTAGGT -38.03 CGGGAG -38.06 GTTTAG -38.11 GCCCGT -38.11 GTCCGA -38.11 AGTGAG -38.2 CTTGTG -38.23 TCGAGG -38.24 TTGGCC -38.25 AGTCCG -38.38 CGGTTT -38.45 TGCGTT -38.48 CGTGAT -38.53 GCGTTC -38.53 TTGGGG -38.54 GGTTTG -38.55 CGGTAC -38.57 TGGCCC -38.57 GCTCGC -38.62 ACGCGT -38.63 TGTGAC -38.71 GACCGG -38.72 GCGCCC -38.73 ACCGGG -38.81 GGTGCC -38.81 TTGTCC -38.88 TTGCCG -38.89 ACGGGT -38.92 ATGTGG -39 GGTCTC -39.04 CGTAAG -39.11 TTCGTT -39.12 TACGGG -39.13 GTCATG -39.17 GGACGT -39.21 CGGGAC -39.25 TGGGTT -39.32 GAGTGC -39.35 CTCTCG -39.4 CGCGAC -39.42 TAGGGG -39.5 GGCACG -39.52 CCGCGC -39.55 TGGACG -39.58 GGCGAC -39.6 CTGGGG -39.69 CGGGTT -39.73 GTGCCT -39.76 TTGGGC -39.77 GCCGTC -39.8 GGCCAG -39.84 CCGTCC -39.9 GCGCGA -39.9 CGCGGC -39.95 TCGGGA -39.98 GTCTTG -40.04 AGTGGG -40.12 CCGGGG -40.16 TTTGGG -40.17 CTTCGT -40.23 CGGTCA -40.24 CACGTG -40.28 GGTGAG -40.43 GTCGAC -40.48 TGCTCG -40.49 TGGGGC -40.62 GGAGGG -40.68 TGTGAG -40.75 GGGGCC -40.89 GGTGGT -40.9 AGGCGT -40.91 TCCGTC -40.92 TCCGCG -40.92 GTACCG -41.02 AGGTGT -41.07 GCTCGT -41.08 TTTCGT -41.14 TGCCCG -41.17 CGATCG -41.22 CGTCTT -41.34 TTCCGG -41.5 GTTTTG -41.52 GCGAGT -41.58 GGGGAG -41.63 CTAGGT -41.64 CCGTGG -41.64 GAGGCG -41.68
CCGCGG -41.7 TTGTGC -41.74 TTTCGG -41.75 GCGTAC -41.83 GTACGC -41.88 GAGTCG -41.9 TCCGTG -42.01 CGGCGA -42.01 CTCCGT -42.07 TTGCGC -42.08 GTGCCC -42.11 GCGTGA -42.12 GTAGGC -42.16 CTCGTT -42.19 GTGCGA -42.23 AGTGCG -42.39 CGCCCG -42.43 GGCGTA -42.43 GAGCGT -42.48 TCGTTC -42.53 AAGTCG -42.67 GTCAGG -42.73 CGTTAG -42.84 TCGGTT -42.92 TCGCGA -42.92 GGGAGG -42.93 GGGACG -42.94 GTCAGT -43.2 TGCCGT -43.2 GGGGTA -43.2 GCGTCT -43.23 GCCGCG -43.26 AGTCGG -43.28 TCCGTT -43.36 CTCGGG -43.37 GGGCCC -43.5 TAGGCG -43.53 GGTCAG -43.58 GGGTAG -43.61 TACGTG -43.67 GTCCTG -43.69 CGCCGC -43.8 CTGGCC -43.85 TAGGGT -43.88 GCCGGG -43.92 GGTTAG -43.96 CCGGGT -44.07 CTCGTC -44.16 GTCTAG -44.19 GGTGTT -44.21 CCGGGC -44.24 AGTGTG -44.25 CGAGGG -44.3 GTTGGC -44.3 CGGCGC -44.3 AGTGTC -44.31 CGTTGT -44.33 GTTCGC -44.35 GTTGCC -44.36 GGCGGT -44.48 TTCGCG -44.51 TTGCGG -44.57 GTGTTC -44.64 ATGTCG -44.73 GGCGGC -44.81 TCGGAG -44.82 GACGGG -44.82 CGTCCT -44.86 TCGACG -44.94 GGACGG -44.99 TGGTGG -44.99 TCCCGT -45.06 TGTCGA -45.08 GCTCGG -45.1 GGGCCG -45.15 GTTTGT -45.27 GAGGGG -45.32 TTCGTG -45.45 GCGAGG -45.47 CCTCGT -45.53 GCCCGG -45.6 GTCTGT -45.62 TTGTCT -45.66 CGGTGT -45.71 CGTTTG -45.74 GGTAGG -45.84 GTCCGC -45.88 GCCGGC -45.88 CGCGTT -45.93 ACGGGG -45.94 CCGTTG -45.97 TCTGTC -46.05 GGGCGA -46.06 GACGTG -46.08 TTGGTC -46.16 GCCGGT -46.32 TTGCGT -46.32 GGGTTG -46.34 GGCGAG -46.43 CGTGTT -46.44 GGGTCC -46.51 TGGGCC -46.53 GCGTTG -46.58 CGACGG -46.68 AGGGGG -46.69 GTGTCA -46.75 GCGTAG -46.76 TAGGTC -46.77 CGCGAG -46.79 TGAGTG -47.04 GACGTC -47.04 GTCGGA -47.14 GGTTGG -47.18 TCGCGC -47.26 GCGCCG -47.28 TGTCTG -47.32 GCCGTG -47.35 CGTTGC -47.38 TCGTCT -47.39 GGCGCC -47.47 GGGGGC -47.53 TTGTGG -47.6 CGGTCC -47.61 CGCGCC -47.71 TTCGGT -47.79
TGACGT -47.8 TGTCCG -47.88 TGTTGT -47.91 CCCGGT -48.15 GCGTCC -48.17 TCCGGG -48.25 CCCGCG -48.5 TCGTCC -48.56 GTTCGT -48.56 GTTCCG -48.59 TTGGCG -48.69 TGGCCG -48.69 GCGACG -48.74 GGAGTG -48.78 GTTAGG -49.18 GGCCGG -49.22 CGGTTG -49.22 TCTCGT -49.23 CGAGCG -49.24 CGAGGT -49.43 CGTCTG -49.43 CTCGGT -49.55 TTCGTC -49.6 GGCGTT -49.72 TCGGCG -49.79 CGTCGA -49.86 GTGACG -49.87 CGACGT -49.9 GGTACG -49.96 CGGTGC -50.01 GTACGG -50.02 CGTGAG -50.26 CGGCGG -50.36 TTGTGT -50.37 GAGTGG -50.58 TTCGGG -50.66 TGTGTC -50.68 TGGGTC -50.7 GGTCGA -50.8 GTTTGG -50.88 CCCGTG -51.09 GTTTCG -51.17 CGAGTG -51.21 GAGTGT -51.21 TGGTGT -51.29 TCGGGC -51.42 TGCGCG -51.46 TCGCCG -51.51 CCGGTC -51.68 CGCGTC -51.71 GTCGTT -51.72 TGGTCT -51.83 CGCGGT -51.85 GGTCTG -51.86 CTCGCG -51.88 CTCGTG -51.94 CGGGCC -52.44 GTACGT -52.73 AGGGCG -52.77 GTGCCG -52.81 GTGAGT -52.89 TGTGGT -52.99 CGGTCT -53.11 TCGTGG -53.14 CGGGGC -53.26 TCGTTG -53.27 ACGTGG -53.35 GGTTCG -53.38 ACGTCG -53.48 GGCCCG -53.53 CGTGCC -53.55 TGGGGG -53.57 CGGCGT -53.63 CGTAGG -53.63 GTCTGG -53.69 GTGAGG -53.7 CGTACG -53.71 GTTGTC -53.73 TTGGGT -53.74 CGTCCG -53.8 TGCCGG -53.82 TCGTGC -53.92 CGGGTC -54 GTCGAG -54.01 CGTTGG -54.19 CCGGCG -54.27 TCCGGT -54.32 GCGGGT -54.37 TCGTGT -54.38 CGCCGG -54.53 CGCTCG -54.55 GTCCGT -54.62 GGTGGC -54.7 TGCGTC -54.83 GGGTGC -54.96 GTCGCC -55.39 TGTGCG -55.49 CGTGTC -55.5 GGCGTC -55.61 GCGCGC -55.66 CTGTCG -55.74 GTCCCG -56.36 GCGGGC -56.49 GTAGGG -56.76 TGTCGC -56.8 TCGCGG -56.94 TGGCGT -57.03 GTGCGC -57.04 TTGTCG -57.09 GTGTTG -57.15 TGGGGT -57.19 GGTCGC -57.25 CGTGGC -57.9 GGGCGC -58.19 TGCGGT -58.27 TGGCGG -58.3 GGGGGT -58.38 TCGGGT -58.51 CCGGTG -58.6 CGTTCG -58.67 TCGGTC -58.82 GTCGGC -58.88 GTGGTC -58.88 GTGTGA -59.14 CGTGGT -59.24 GTGGCC -59.29
GCGGTC -59.3 GCGCGT -59.36 AGGTCG -59.5 GTCTCG -59.51 GGTGTC -59.7 TGGTCG -59.72 GCGGTG -60.02 TGCGTG -60.04 GTGTGT -60.05 GGGGTC -60.15 CGCGCG -60.19 TGGGCG -60.25 GCGTGT -60.27 GTTGGG -60.36 TGCGGG -60.39 TGTGGC -60.71 GCGCGG -60.73 CGTCGC -60.8 CCGTCG -60.85 GTGGTG -60.86 GTTCGG -61.52 GGGCGG -61.53 TCGCGT -61.64 GTGTCC -61.73 GGGTGT -61.79 GGGGGG -62.06 TGTGTG -62.08 GCGTGC -62.32 CGGGGG -62.44 CGGGCG -62.52 GGCGTG -62.89 TCGGTG -63.03 GGCGGG -63.07 GTTGTG -63.22 GGTCGT -63.3 TCGGGG -63.6 GTTGCG -64.3 GGGCGT -64.62 TCGTCG -64.83 GGTCCG -64.88 GCGGCG -64.99 GTGCGG -65.11 GGTGCG -65.21 GCGTGG -65.85 GGGGCG -66.57 CGCGTG -66.73 GTGTGC -66.98 GTCCGG -67.1 GTGCGT -67.14 TGTCGT -67.26 TGTGGG -67.31 CGGTCG -67.35 CGGGGT -67.36 CGCGGG -67.6 TGTCGG -67.61 CGTCGG -68.18 GGCGCG -68.24 GGGGTG -68.68 CGTCGT -68.69 GTCGGT -68.84 TGGGTG -69.08 GTCGTC -69.14 GCGTCG -69.26 CGGGTG -69.69 GGGTGG -69.98 GTGGGC -70.27 CGTGTG -71.38 CGGTGG -71.52 CGTGCG -71.83 GCGGGG -72.46 GTGGGT -73.21 GTCGCG -73.55 GTCGTG -73.94 GTGGCG -73.94 GTGGGG -74.96 GGTGGG -75.37 CGTGGG -75.74 GGGTCG -76.6 GTCGGG -80.38 GGTCGG -81.93 GGTGTG -82.57 GTGTCG -84.85 GTGTGG -90.52
[0257] Another application of the rank ordering of all motifs for their ability to increase or decrease SHM-mediated mutagenesis is the creation of gene constructs that are colder or hotter relative to wildtype sequence. Any sequence position in a gene can be evulated for an equivalent sequence with a hotter or colder (relative to the starting or unmodified sequence) motif consistent with the amino acid according to the z-score shown in Tables 2 and 3. So while no best preferred hot spot or cold spot motif from Table 7 may be found to substitute at a particular sequence position, a relative improvement in the SHM properties of the replacement motif may almost always be made where there is an underlying degeneracy in the codon sequence. A log-odds based score of the observed to expected mutation frequencies at each motif might also be used to score a tile-library for a polynucleotides cumulative hotness or coldness to SHM.
[0258] Thus, one can appreciate that the replacement of any SHM motif with one that has a greater probability of SHM, mediated mutagenesis can result in a sequence that is more susceptible to somatic hypermutation, and that the replacement of any SHM motif with one with a lower probability of SHM mediated mutagenesis can result in a sequence that is more resistant to somatic hypermutation.
[0259] Tables 2 and 3 shows the 3-mer, 4-mer, and 6-mer motifs ranked by z-score for their ability to attract SHM-mediated mutation. Another possible representation of hot and cold hot spot motifs can be made by constructing a position specific matrix from the assembly of motifs represented amongst the highest and lowest scoring z-scores. Below is a single example of a 6-mer motif overrepresented amongst the top scores motif "hot spots," given as a position specific matrix in Table 4:
TABLE-US-00004 TABLE 4 Posi- Posi- Posi- Posi- Posi- Posi- tion 1 tion 2 tion 3 tion 4 tion 5 tion 6 A 0.0 1.0 0.0 0.0 0.2 0.5 C 0.75 0.0 0.0 1.0 0.0 0.0 G 0.0 0.0 1.0 0.0 0.0 0.5 T 0.25 0.0 0.0 0.0 0.8 0.0
[0260] In one non-limiting example, the term "preferred hot spot SHM codon" or "preferred hot spot SHM motif" refers to a codon or motif, including but not limited to codons TAC, TAT, or AGT, AGC, potentially embedded within the context of a larger hot spot motif which recruits AID-mediated mutagenesis and generates targeted amino acid diversity at that position. SHM introduces specific nucleotide transitions at each position of a "hot spot" motif with a frequency that can quantified. This spectrum of nucleotide transitions results in different possible silent or non-silent amino acid transitions is dependent on which of the three possible reading frames is used. By defining the most likely codon transitions mediated by SHM and the sequential flow mutation events, "preferred hot spot SHM codons" or "preferred hot spot SHM motifs" can be chosen in such a way as to generate a specific panel of amino acid transitions that suit the functionality of a library at each amino acid position, as described in Section V.
IV. Polynucleotide Design Strategies for SHM
[0261] Provided herein is a method to design nucleotide templates to either maximize or minimize the tendency of a polynucleotide to undergo SHM, while at the same time maximizing protein expression, RNA stability, and the presence of conveniently located restriction enzyme sites.
[0262] Also provided herein are synthetic versions of a polynucleotide that are altered to either enhance, or decrease the impact of SHM on the rate of mutagenesis of that polynucleotide compared to its wild type's susceptibility to undergo SHM (i.e., SHM susceptible or SHM resistent).
[0263] The SHM susceptible sequences facilitate the rapid evolution and selection of improved mutant versions of proteins and the system combines the power of rational design with accelerated random mutagenesis and directed evolution.
[0264] Conversely, the SHM resistant sequences facilitate the rapid evolution and selection of improved mutant versions of proteins and the system combines the power of rational design with decreased random mutagenesis and directed evolution
[0265] Also included in the invention are SHM resistant polynucleotide sequences that allow for conserved domains to be resistant to SHM-mediated mutagenesis, while simultaneously targeting desired sequences for increased susceptibility to SHM-mediated mutagenesis.
[0266] Polynucleotides for which these methods are applicable include any polynucleotide sequence that can be transcribed and a functional assay devised for screening. Preferred polynucleotide sequences include those encoding proteins, polypeptides and peptides such as, for example, specific binding members, antibodies or fragment thereof, an antibody heavy chain or portion thereof, an antibody light chain or portion thereof, an intrabodies, selectable marker genes, enzymes, receptors, peptide growth factors and hormones, co-factors, and toxins.
[0267] Other non-limiting examples of molecules for use herein include polynucleotides that have enzymatic or binding activity without the need for translation into a protein or peptide sequence, such polynucleotides including for example, enzymatic nucleic acids, antisense nucleic acids, triplex forming oligonucleotides, 2,5-A chimeras, RsiNA, dsRNA, allozymes, abd aptamers.
[0268] Biologically active molecules of the invention also include molecules capable of modulating the pharmacokinetics and/or pharmacodynamics of other biologically active molecules, for example, lipids and polymers such as polyamines, polyamides, polyethylene glycol and other polyethers. For example, polypeptides are those such as, for example, VEGF, VEGF receptor, Diptheria toxin subunit A, B. pertussis toxin, CC chemokines (e.g., CCL1-CCL28), CXC chemokines (e.g., CXCL1-CXCL16), C chemokines (e.g., XCL1 and XCL2) and CX3C chemokines (e.g., CX3CL1), IFN-gamma, IFN-alpha, IFN-beta, TNF-alpha, TNF-beta, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-10, IL-12, IL-13, IL-15, TGF-beta, TGF-alpha, GM-CSF, G-CSF, M-CSF, TPO, EPO, human growth factor, fibroblast growth factor, nuclear co-factors, Jak and Stat family members, G-protein signaling molecules such as chemokine receptors, JNK, Fos-Jun, NF-κB, CD40, CD4, CD8, B7, CD28 and CTLA-4.
[0269] One strategy for altering the ability of a polynucleotide to undergo SHM is through modulating the frequency and location of hot stops within the polynucleotide sequence of interest. The position or reading frame of a hot spot or cold spot is also an important factor governing whether SHM mediated mutagenesis can result in a mutation that is silent with regards to the resulting amino acid sequence. Both the degree of SHM recruitment and the reading frame of the motif are considered in the design of hot and cold spots.
[0270] An optimized polynucleotide sequence has been made "susceptible for SHM" if the polynucleotide sequence, or a portion thereof, has been altered, or designed, to increase the frequency and/or location of hot spots within the open reading frame and/or has been altered, or designed, to decrease the frequency and for location of cold spots within the open reading frame of the polynucleotide sequence compared to the wild type polynucleotide sequence.
[0271] Conversely, an optimized polynucleotide sequence has been made "resistant to SHM" if the polynucleotide sequence, or a portion thereof, has been altered to decrease the frequency and/or location of hot spots within the open reading frame of the polynucleotide sequence, and/or has been altered, or designed, to increase the frequency and for location of cold spots within the open reading frame of the polynucleotide sequence compared to the wild type polynucleotide sequence.
[0272] One can target specific regions of a polynucleotide for optimization of either hot spots, cold spots or both. In one embodiment, regions of a polynucleotide can be made hot (e.g., ligand binding, enzymatic activity, etc.) while other regions (e.g., those needed for structural folding, conformation, etc.) of a polynucleotide can be made cold. For example, it has been observed that in antibody genes, the codon usage and precise concomitant hot spot/cold spot targeting of AID activity and pol eta errors has evolved under selective pressure to maximize mutations in the variable regions and minimize mutations in the framework regions.
[0273] A polynucleotide sequence can be prepared that has a greater or lesser propensity to undergo SHM mediated mutagenesis by selectively altering the codon usage to modulate SHM hot spot and/or cold spot density. Based on this information, it is possible to optimize particular regions of a polynucleotide that appear to be directly involved in a functional attribute of a protein encoded by the polynucleotide. In one non-limiting example, nucleotides to be optimized can encode amino acids that can lie within, or within about 5 Å of a specific functional or structural attribute of interest. Specific examples include, but are not limited to, amino acids within CDRs of antibodies, binding pockets of receptors, catalytic clefts of enzymes, protein-protein interaction domains, of co-factors, allosteric binding sites, etc.
[0274] SHM hot spot and cold spot motifs have been described elsewhere herein such as, for example, in Tables 2, 3 and 7. Non-limiting examples of 4-mer nucleotide hot spot motifs that can be used for this purpose, include for example, nucleotide sequences of TACC, TACA, TACT, TGCC, TGCA, TGCT, AACC, AACA, AACT, AGCC, AGCA, AGCT, GGTA, TGTA, AGTA, GGCA, TGCA, AGCA, GGTT, TGTT, AGTT, GGCT, TGCT and AGCT, and their complementary sequences encoded on the alternative DNA strand. Exemplary 3-mer cold spot motifs include, for example, nucleotide sequences of CCC, CTC, GCC, GTC, GGG, GAG, GGC and GAC.
[0275] An additional consideration is the reading frame of the hot or cold spot. Hot spot motifs can be situated relative to the reading frame such that SHM-mediated mutation is more likely to occur at the wobble position of a codon (the third position), making a silent mutation more likely to result. Conversely, a hot spot motif can be situated relative to the reading frame such that a non-silent mutations result from changes in codons (data not shown). As discussed below, these design parameters can be conveniently optimized using an iterative computer algorithm.
[0276] In addition to optimizing hot spot and/or cold spot motif density, it can also desirable to consider the following characteristics such that optimized polynucleotides are efficiently translated, and stable in a host system.
[0277] The density of CpG dinucleotides motifs: Excessive CG motifs can result in gene methylation leading to gene silencing, and can be normalized to the density found in highly transcribed gene in the host system in question (see for example, Kameda et al., Biochem. Biophys. Res. Commun. (2006) 349(4): 1269-1277).
[0278] The ability of single stranded sequences to form stem-loop structures: the formation of stem-loop structures can result inefficient transcription and or translation, particularly when located near the 5' region of the coding frame (see, e.g., Zuker M., Mfold web server for nucleic acid folding and hybridization prediction. Nucl. Acid Res. (2003); 31(13): 3406-3415). Stem loop structure formation can be minimized by avoiding repetitive or palindromic stretches of greater than 6 nucleotides, for example, near the 5' end. Alternatively, longer stems are acceptable if the loop contains greater than about 25 nucleotides (nt).
[0279] Codon Usage: Appropriate codon usage, i.e., the use of codons that encode for more common and frequently used tRNAs, rather than very rare tRNAs, is important to enable efficient translation in the expression system being used (see generally Nakamura et al., Nuc. Acid. Res. (2000) 28 (1): 292, "Codon usage tabulated from international DNA sequence databases: status for the year 2000;" which includes codon frequency tables of each of the complete protein sequences in the GenBank DNA sequence database as of 2000). Generally codon usage is more important near the 5' end of the gene where transcription of the polynucleotide begins, and rare codons should be avoided in this region where ever possible. Preferred is the elimination of about 80% or more, of the codons that are used less than 10% of the time within the coding frame of the expressed genes in the organism of interest.
[0280] GC content: Generally this should be matched, to the GC content of highly expressed genes in the host organism, for example in mammalian systems GC content should be less than about 60%.
[0281] Restriction sites: Restriction sites should be placed judiciously where desired. Similarly, important restriction sites (i.e. those that are intended to be used to clone the entire gene, or other genes) within a polynucleotide should be removed where not desired by altering wobble positions.
[0282] Stretches of the same nucleotide: Minimize or eliminate stretches of the same nucleotide to less six (6) contiguous nucleotides.
[0283] In addition, expression can be further optimized by including a Kozak consensus sequence [i.e., (a/g)cc(a/g)ccATGg] at the start codon. Kozak consensus sequences useful for this purpose are known in the art (Mantyh et al. PNAS 92: 2662-2666 (1995); Mantyh et al. Prot. Exp. & Purif. 6,124 (1995)).
[0284] Avoid, or minimize the usage of certain codons ("Non preferred SEM codons") that can be mutated in one step to create a stop codon. "Non preferred codons" include, UGG (Trp), UGC (Cys), UCA (Ser), UCG (Ser) CAA, (O) GAA (Glu) and CAG (Gln).
[0285] Beyond sequence specific constraints within the coding sequence of the polynucleotide of interest, additional design criteria for engineering a polynucleotide sequence with altered susceptibility to SHM can include the following factors:
[0286] The choice of promoter; a strong promoter will generally induce a higher rate of transcription resulting a higher overall rate of mutagenesis compared to a weaker promoter. Further, an inducible promoter, such as the tet-promoter enables expression, and hence SHM, to be inducibly controlled, to switch on, or off, transcription and mutagenesis of the polynucleotide of interest. Gossen and Bujard, Tight control of gene expression in mammalian cells by tetracycline-responsive promoters. Proc Natl Acad Sci USA. 1992 Jun. 15; 89(12):5547-51; Gossen et al., Transcriptional activation by tetracyclines in mammalian cells. Science. 1995 Jun. 23; 268(5218):1766-9.
[0287] The location of the coding sequence relative to the transcriptional start point; generally for high level mutagenesis, the polynucleotide of interest should be located between about 50 nucleotides, and 2 kb of the transcriptional start site.
[0288] One convenient approach to optimizing a polynucleotide sequence to SHM, involves analyzing the corresponding amino acid sequence of interest via a computer algorithm that compares and scores (according to the parameters above) possible alternative polynucleotides sequences that can be used, via alternative codon usage to encode for the amino acid sequence of interest. By iteratively replacing codons, or groups of codons (tiles or SHM motifs) with progressively preferred sequences it is possible to computationally evolve a polynucleotide sequence with desired properties. Specifically, for example, a sequence that is susceptible to SHM, or that is resistant to SHM, and yet also exhibits reasonable translational efficiency, stability, minimizes restriction sites and avoids rare codons in the particular organism of interest.
[0289] Using this approach, a library of files can be generated that is based on the starting amino acid or polynucleotide sequence. In one non limiting example of the analysis and optimization strategy, the library can be created based on the analysis of groups of 9 nucleotides, corresponding to 3 codons (a "tile" or a "SHM motif"). Each tile can be scored for the attributes described above, to create an initial library data set of tiles, containing hundreds of thousands of 9-mer permutations, and their respective scores.
[0290] A representative sample of a section of the library file is shown in Table 5 which shows the potential diversity in nucleotide sequences arising from alternative codon usage for just the three amino acids, Serine (S), Arginine (R) and Leucine (L). A person of skill in the art readily appreciates that a complete set of files can be readily assembled for all possible amino acid combinations using known codon usage patterns. Sequence identifiers are next to each sequence in parenthesis.
TABLE-US-00005 TABLE 5 Representative polynucleotide diversity encoding a three amino acid sequence (Ser Arg Leu) 3-mer AA Potential nucleotides Hotspots Coldspots CpG MaxNt Log(πp(AA)) SRL AGTCGACTT (43) 0 2 1 1 -5 SRL AGTCGACTG (44) 0 2 1 1 -3 SRL AGTCGATTA (45) 0 1 1 2 -5 SRL AGTCGACTA (46) 0 2 1 1 -5 SRL AGTCGACTC (47) 0 3 1 1 -4 SRL AGTCGATTG (48) 0 1 1 2 -5 SRL AGTAGGCTT (49) 2 0 0 2 -4 SRL AGTAGGCTG (50) 2 0 0 2 -2 SRL AGTAGGTTA (51) 2 0 0 2 -4 SRL AGTAGGCTA (52) 2 0 0 2 -4 SRL AGTAGGCTC (53) 2 1 0 2 -3 SRL AGTAGGTTG (54) 2 0 0 2 -4 SRL AGTCGTCTT (55) 0 2 1 1 -5 SRL AGTCGTCTG (56) 0 2 1 1 -3 SRL AGTCGTTTA (57) 0 1 1 3 -5 SRL AGTCGTCTA (58) 0 2 1 1 -5 SRL AGTCGTCTC (59) 0 3 1 1 -4 SRL AGTCGTTTG (60) 0 1 1 3 -5 SRL AGTAGACTT (61) 1 1 0 1 -4 SRL AGTAGACTG (62) 1 1 0 1 -2 SRL AGTAGATTA (63) 1 0 0 2 -4 SRL AGTAGACTA (64) 1 1 0 1 -4 SRL AGTAGACTC (65) 1 2 0 1 -3 SRL AGTAGATTG (66) 1 0 0 2 -4 SRL AGTCGGCTT (67) 1 1 1 2 -4 SRL AGTCGGCTG (68) 1 1 1 2 -2 SRL AGTCGGTTA (69) 1 1 1 2 -4 SRL AGTCGGCTA (70) 1 1 1 2 -4 SRL AGTCGGCTC (71) 1 2 1 2 -3 SRL AGTCGGTTG (72) 1 1 1 2 -4 SRL AGTCGCCTT (73) 0 2 1 2 -4 SRL AGTCGCCTG (74) 0 2 1 2 -2 SRL AGTCGCTTA (75) 0 1 1 2 -4 SRL AGTCGCCTA (76) 0 2 1 2 -4 SRL AGTCGCCTC (77) 0 3 1 2 -3 SRL AGTCGCTTG (78) 0 1 1 2 -4 SRL TCACGACTT (79) 0 1 1 1 -5 SRL TCACGACTG (80) 0 1 1 1 -3 SRL TCACGATTA (81) 0 0 1 2 -5 SRL TCACGACTA (82) 0 1 1 1 -5 SRL TCACGACTC (83) 0 2 1 1 -4 SRL TCACGATTG (84) 0 0 1 2 -5 SRL TCAAGGCTT (85) 1 0 0 2 -4 SRL TCAAGGCTG (86) 1 0 0 2 -2 SRL TCAAGGTTA (87) 1 0 0 2 -4 SRL TCAAGGCTA (88) 1 0 0 2 -4 SRL TCAAGGCTC (89) 1 1 0 2 -3 SRL TCAAGGTTG (90) 1 0 0 2 -4 SRL TCACGTCTT (91) 0 1 1 1 -5 SRL TCACGTCTG (92) 0 1 1 1 -3 SRL TCACGTTTA (93) 0 0 1 3 -5 SRL TCACGTCTA (94) 0 1 1 1 -5 SRL TCACGTCTC (95) 0 2 1 1 -4 SRL TCACGTTTG (96) 0 0 1 3 -5 SRL TCAAGACTT (97) 0 1 0 2 -4 SRL TCAAGACTG (98) 0 1 0 2 -2 SRL TCAAGATTA (99) 0 0 0 2 -4 SRL TCAAGACTA (100) 0 1 0 2 -4 SRL TCAAGACTC (101) 0 2 0 2 -3 SRL TCAAGATTG (102) 0 0 0 2 -4 SRL TCACGGCTT (103) 1 0 1 2 -4 SRL TCACGGCTG (104) 1 0 1 2 -2 SRL TCACGGTTA (105) 1 0 1 2 -4 SRL TCACGGCTA (106) 1 0 1 2 -4 SRL TCACGGCTC (107) 1 1 1 2 -3 SRL TCACGGTTG (108) 1 0 1 2 -4 SRL TCACGCCTT (109) 0 1 1 2 -4 SRL TCACGCCTG (110) 0 1 1 2 -2 SRL TCACGCTTA (111) 0 0 1 2 -4 SRL TCACGCCTA (112) 0 1 1 2 -4 SRL TCACGCCTC (113) 0 2 1 2 -3 SRL TCACGCTTG (114) 0 0 1 2 -4 SRL AGCCGACTT (115) 1 2 1 2 -5 SRL AGCCGACTG (116) 1 2 1 2 -3 SRL AGCCGATTA (117) 1 1 1 2 -5 SRL AGCCGACTA (118) 1 2 1 2 -5 SRL AGCCGACTC (119) 1 3 1 2 -4 SRL AGCCGATTG (120) 1 1 1 2 -5 SRL AGCAGGCTT (121) 2 0 0 2 -4 SRL AGCAGGCTG (122) 2 0 0 2 -2 SRL AGCAGGTTA (123) 2 0 0 2 -4 SRL AGCAGGCTA (124) 2 0 0 2 -4 SRL AGCAGGCTC (125) 2 1 0 2 -3 SRL AGCAGGTTG (126) 2 0 0 2 -4 SRL AGCCGTCTT (127) 1 2 1 2 -5 SRL AGCCGTCTG (128) 1 2 1 2 -3 SRL AGCCGTTTA (129) 1 1 1 3 -5 SRL AGCCGTCTA (130) 1 2 1 2 -5 SRL AGCCGTCTC (131) 1 3 1 2 -4 SRL AGCCGTTTG (132) 1 1 1 3 -5 SRL AGCAGACTT (133) 1 1 0 1 -4 SRL AGCAGACTG (134) 1 1 0 1 -2 SRL AGCAGATTA (135) 1 0 0 2 -4 SRL AGCAGACTA (136) 1 1 0 1 -4 SRL AGCAGACTC (137) 1 2 0 1 -3 SRL AGCAGATTG (138) 1 0 0 2 -4 SRL AGCCGGCTT (139) 2 1 1 2 -4 SRL AGCCGGCTG (140) 2 1 1 2 -2 SRL AGCCGGTTA (141) 2 1 1 2 -4 SRL AGCCGGCTA (142) 2 1 1 2 -4 SRL AGCCGGCTC (143) 2 2 1 2 -3 SRL AGCCGGTTG (144) 2 1 1 2 -4 SRL AGCCGCCTT (145) 1 2 1 2 -4 SRL AGCCGCCTG (146) 1 2 1 2 -2 SRL AGCCGCTTA (147) 1 1 1 2 -4 SRL AGCCGCCTA (148) 1 2 1 2 -4 SRL AGCCGCCTC (149) 1 3 1 2 -3 SRL AGCCGCTTG (150) 1 1 1 2 -4 SRL TCGCGACTT (151) 0 1 2 1 -6 SRL TCGCGACTG (152) 0 1 2 1 -4 SRL TCGCGATTA (153) 0 0 2 2 -6 SRL TCGCGACTA (154) 0 1 2 1 -6 SRL TCGCGACTC (155) 0 2 2 1 -5 SRL TCGCGATTG (156) 0 0 2 2 -6 SRL TCGAGGCTT (157) 1 1 1 2 -5 SRL TCGAGGCTG (158) 1 1 1 2 -3 SRL TCGAGGTTA (159) 1 1 1 2 -5 SRL TCGAGGCTA (160) 1 1 1 2 -5 SRL TCGAGGCTC (161) 1 2 1 2 -4 SRL TCGAGGTTG (162) 1 1 1 2 -5 SRL TCGCGTCTT (163) 0 1 2 1 -6 SRL TCGCGTCTG (164) 0 1 2 1 -4
SRL TCGCGTTTA (165) 0 0 2 3 -6 SRL TCGCGTCTA (166) 0 1 2 1 -6 SRL TCGCGTCTC (167) 0 2 2 1 -5 SRL TCGCGTTTG (168) 0 0 2 3 -6 SRL TCGAGACTT (169) 0 2 1 1 -5 SRL TCGAGACTG (170) 0 2 1 1 -3 SRL TCGAGATTA (171) 0 1 1 2 -5 SRL TCGAGACTA (172) 0 2 1 1 -5 SRL TCGAGACTC (173) 0 3 1 1 -4 SRL TCGAGATTG (174) 0 1 1 2 -5 SRL TCGCGGCTT (175) 1 0 2 2 -5 SRL TCGCGGCTG (176) 1 0 2 2 -3 SRL TCGCGGTTA (177) 1 0 2 2 -5 SRL TCGCGGCTA (178) 1 0 2 2 -5 SRL TCGCGGCTC (179) 1 1 2 2 -4 SRL TCGCGGTTG (180) 1 0 2 2 -5 SRL TCGCGCCTT (181) 0 1 2 2 -5 SRL TCGCGCCTG (182) 0 1 2 2 -3 SRL TCGCGCTTA (183) 0 0 2 2 -5 SRL TCGCGCCTA (184) 0 1 2 2 -5 SRL TCGCGCCTC (185) 0 2 2 2 -4 SRL TCGCGCTTG (186) 0 0 2 2 -5 SRL TCCCGACTT (187) 0 2 1 3 -5 SRL TCCCGACTG (188) 0 2 1 3 -3 SRL TCCCGATTA (189) 0 1 1 3 -5 SRL TCCCGACTA (190) 0 2 1 3 -5 SRL TCCCGACTC (191) 0 3 1 3 -4 SRL TCCCGATTG (192) 0 1 1 3 -5 SRL TCCAGGCTT (193) 1 0 0 2 -4 SRL TCCAGGCTG (194) 1 0 0 2 -2 SRL TCCAGGTTA (195) 1 0 0 2 -4 SRL TCCAGGCTA (196) 1 0 0 2 -4 SRL TCCAGGCTC (197) 1 1 0 2 -3 SRL TCCAGGTTG (198) 1 0 0 2 -4 SRL TCCCGTCTT (199) 0 2 1 3 -5 SRL TCCCGTCTG (200) 0 2 1 3 -3 SRL TCCCGTTTA (201) 0 1 1 3 -5 SRL TCCCGTCTA (202) 0 2 1 3 -5 SRL TCCCGTCTC (203) 0 3 1 3 -4 SRL TCCCGTTTG (204) 0 1 1 3 -5 SRL TCCAGACTT (205) 0 1 0 2 -4 SRL TCCAGACTG (206) 0 1 0 2 -2 SRL TCCAGATTA (207) 0 0 0 2 -4 SRL TCCAGACTA (208) 0 1 0 2 -4 SRL TCCAGACTC (209) 0 2 0 2 -3 SRL TCCAGATTG (210) 0 0 0 2 -4 SRL TCCCGGCTT (211) 1 1 1 3 -4 SRL TCCCGGCTG (212) 1 1 1 3 -2 SRL TCCCGGTTA (213) 1 1 1 3 -4 SRL TCCCGGCTA (214) 1 1 1 3 -4 SRL TCCCGGCTC (215) 1 2 1 3 -3 SRL TCCCGGTTG (216) 1 1 1 3 -4 SRL TCCCGCCTT (217) 0 2 1 3 -4 SRL TCCCGCCTG (218) 0 2 1 3 -2 SRL TCCCGCTTA (219) 0 1 1 3 -4 SRL TCCCGCCTA (220) 0 2 1 3 -4 SRL TCCCGCCTC (221) 0 3 1 3 -3 SRL TCCCGCTTG (222) 0 1 1 3 -4 SRL TCTCGACTT (223) 0 2 1 1 -5 SRL TCTCGACTG (224) 0 2 1 1 -3 SRL TCTCGATTA (225) 0 1 1 2 -5 SRL TCTCGACTA (226) 0 2 1 1 -5 SRL TCTCGACTC (227) 0 3 1 1 -4 SRL TCTCGATTG (228) 0 1 1 2 -5 SRL TCTAGGCTT (229) 1 0 0 2 -4 SRL TCTAGGCTG (230) 1 0 0 2 -2 SRL TCTAGGTTA (231) 1 0 0 2 -4 SRL TCTAGGCTA (232) 1 0 0 2 -4 SRL TCTAGGCTC (233) 1 1 0 2 -3 SRL TCTAGGTTG (234) 1 0 0 2 -4 SRL TCTCGTCTT (235) 0 2 1 1 -5 SRL TCTCGTCTG (236) 0 2 1 1 -3 SRL TCTCGTTTA (237) 0 1 1 3 -5 SRL TCTCGTCTA (238) 0 2 1 1 -5 SRL TCTCGTCTC (239) 0 3 1 1 -4 SRL TCTCGTTTG (240) 0 1 1 3 -5 SRL TCTAGACTT (241) 0 1 0 1 -4 SRL TCTAGACTG (242) 0 1 0 1 -2 SRL TCTAGATTA (243) 0 0 0 2 -4 SRL TCTAGACTA (244) 0 1 0 1 -4 SRL TCTAGACTC (245) 0 2 0 1 -3 SRL TCTAGATTG (246) 0 0 0 2 -4 SRL TCTCGGCTT (247) 1 1 1 2 -4 SRL TCTCGGCTG (248) 1 1 1 2 -2 SRL TCTCGGTTA (249) 1 1 1 2 -4 SRL TCTCGGCTA (250) 1 1 1 2 -4 SRL TCTCGGCTC (251) 1 2 1 2 -3 SRL TCTCGGTTG (252) 1 1 1 2 -4 SRL TCTCGCCTT (253) 0 2 1 2 -4 SRL TCTCGCCTG (254) 0 2 1 2 -2 SRL TCTCGCTTA (255) 0 1 1 2 -4 SRL TCTCGCCTA (256) 0 2 1 2 -4 SRL TCTCGCCTC (257) 0 3 1 2 -3 SRL TCTCGCTTG (258) 0 1 1 2 -4
[0291] Each polynucleotide sequence is ranked based on the following attributes; number of SHM hot and cold motifs, number of CpG motifs, MaxNt (maximum number of nucleotides in a single stretch) and codon usage frequency of the host cell to be used. The term "Log(πp(AA))" contained in the final column of Table 5 was calculated as the log of the product of the individual probabilities of observing each of the amino acids in the trimer, given by the formula:
[0292] Log(πp(AA)=ln(p(codoni-1|amino acidi-1)*p(codoni|amino acidi)*p(codoni+1|amino acidi+1).
[0293] Individual probabilities for each amino acid were based on published codon usage patterns in the organism of interest, in this case, for mammalian cells. (See generally Nakamura et al., Nucleic Acid Res. (2000) 28 (1): 292 Codon usage tabulated from international DNA sequence databases: status for the year 2000).
[0294] As can be readily seen from above, codon usage diversity alone enables polynucleotide sequences to be created that vary widely in their susceptibility to somatic hypermutation, as measured by the number (density) of hot or cold spot motifs present within the sequence.
[0295] This analysis readily identifies potential combinations of codons or motifs that are optimized for SHM and minimize CpGs and use optimal codons for efficient translation. For example, the sequences listed below in Table 6 represent top ranking hot sequences because they comprise the maximum number of hot spots and no cold spots. Sequence identifiers are next to each sequence in parenthesis.
TABLE-US-00006 TABLE 6 Top Hot Spot Sequences SRL AGTAGGCTT (259) 2 0 0 2 -4 SRL AGTAGGCTG (260) 2 0 0 2 -2 SRL AGTAGGTTA (261) 2 0 0 2 -4 SRL AGTAGGCTA (262) 2 0 0 2 -4 SRL AGCAGGCTT (263) 2 0 0 2 -4 SRL AGCAGGCTG (264) 2 0 0 2 -2 SRL AGCAGGTTA (265) 2 0 0 2 -4 SRL AGCAGGCTA (266) 2 0 0 2 -4 SRL AGCAGGTTG (267) 2 0 0 2 -4 SRL AGTAGGTTG (268) 2 0 0 2 -4
[0296] Of these, the sequences AGTAGGCTG and AGCAGGCTG are preferred because they encompass codons with a higher frequency of use in mammalian cells.
[0297] Having defined and scored all possible 9-mer nucleotide tiles, it is possible to scan through a starting amino acid or nucleotide template, identifying positions in the gene/protein that can be improved by substitution from the tile library. This process can be conveniently completed using a computer algorithm, such as the peri program SHMredesign.pl; the code of which is shown below:
TABLE-US-00007 #! /usr/bin/perl ############ # # A program to redesign protein and nucleic acid sequences to be hot or cold to SHM # ############ ##########################################################################- ### ##################### # # Read in the genetic code, amino acids, and mammalian codon usage frequencies # # $cod_aa{ } -> mapping of codon to amino acid # $cod_anti{ } -> mapping of codon to its opposite strand sequence # $codnum{ } -> frequency per 1000 of observing the codon in mammals # $tot_cod{ } -> frequency per 1000 of observing that codon in mammals, given the identity of the amino acid # $aa_cod{ }{ } -> maps an amino acid to its codons with the frequency found in mammalian genes # ##########################################################################- ### ################### open(GENE,."/geneticcode.txt"); while (<GENE>) { if (/{circumflex over ( )}(\S+)\s+(\S+)\s+(\S+)\s+(\S+)\t(\d+)\t(\d+)/) { $one=$1; $four=$4; $five=$5; $six=$6; $thr=$3; $cod_aa{$one}=$thr; $cod_anti{$one}=$four; $codnum{$one}=$five; $tot_cod{$one}=int(1000*$five/$six); if (!defined($i{$cod_aa{$one}})) { $i{$cod_aa{$one}}=1 } for ($j=$i{$cod_aa{$one}}; $j<=$i{$cod_aa{$one}}+$tot_cod{$one}; $j++) { $aa_cod{$thr}{$j}=$one; } $i{$cod_aa{$one}}=$j; } } close(GENE); ##########################################################################- ### ################### # # Read in motifs that are hot or cold to SHM, for assessing output only # # $hot{ } -> hash containing a list of 4-mer hot spots # $cold{ } -> hash containing a list of 3-mer cold spots # ##########################################################################- ### ################### open(SHM,."/hotncold.txt"); while (<SHM>) { if (/{circumflex over ( )}(\S+)\s+(\S+)/) { $one=$1; $two=$2; if ($one eq `COLD`) { $cold{$two}++; } if ($one eq `HOT`) { $hot{$two}++; } } } close(SHM); ##########################################################################- ### ################### # # Read in a library of all 9-mer nucleotide motifs that have been # scored for several properties, including # hot spots, # cold spots, # CpG motifs, # the length of the longest uninterupted stretch of the same nucleotide, and a codon usage score # # $hotsc{ }{ } -> hash mapping the tiles 3-mer aa and 9-mer na to the number of SHM hot spots it contains # $coldsc{ }{ } -> hash mapping the tiles 3-mer aa and 9-mer na to the number of SHM cold spots it contains # $cgsc{ }{ } -> hash mapping the tiles 3-mer aa and 9-mer na to the number of CpG motifs it contains # $longsc{ }{ } -> hash mapping the tiles 3-mer aa and 9-mer na to the length of its longest stretch of the same na # $codindexsc{ }{ } -> hash mapping the tiles 3-mer aa and 9-mer na to its aggregate codon usage score # ##########################################################################- ### ################### open(LIB,"gunzip -c ./3mer_library.txt.gz |"); while (<LIB>) { if (/{circumflex over ( )}(\S+)\t(\S+)\t(\d+)\t(\d+)\t(\d+)\t(\d+)\t(\S+)/) { $hotsc{$1}{$2}=$3; $coldsc{$1}{$2}=$4; $cgsc{$1}{$2}=$5; $longsc{$1}{$2}=$6; $codindexsc{$1}{$2}=$7; } } close(LIB); ##########################################################################- ### ################ # # Program begins by reading in a fasta-like file containing a amino acid or nucleic acid sequence # and a second line that contains design instructions for each position in the construct # `+` make this position hot to SHM # `-` make this position cold to SHM # `.` this position is neutral to SHM # # Usage: ./SHMdesign.pl inputfile.fasta A/N # where either A or N is given to indicate an amino acid or nucleic acid sequence # # $seq -> captures the sequence vector # $change -> captures the design change vector # ##########################################################################- ### ################ open (FILE,"$ARGV[0]"); while (<FILE>) { if (/\<(\S+)/) { $change=$1; } if (/\>(\S+)/) { $seq=uc($1); } } close(FILE); ##########################################################################- ### ################ # # if an amino acid sequence is indicated, a starting nucleic acid sequence is generated that # is consistent with codon usage, and loaded into the arrays listed below. Else, if a nucleic # acid sequence was given as a starting reference the sequence is taken directly from the # input file and loaded into arrays # # $aa_vector[ ] -> array containing amino acid identities of the sequence # $ch_vector[ ] -> array containing amino acid identifies of the design changes # $nuc_vector[ ] -> array containing codons for each position # $length -> variable holding the length of the construct in amino acids/codons # ##########################################################################- ### ################ if ($ARGV[1] eq `A`) { @aa_array=split(//,$seq); foreach $aa (@aa_array) { chomp $aa; $count++; $aa_vector[$count]=$aa; } @ch_array=split(//,$change); foreach $ch (@ch_array) { chomp $ch; $count2++; $ch_vector[$count2]=$ch; } if ($count != $count2) {print "COUNT Mismatch\n"} for ($length=1; $length<=$count; $length++) { $r=int(rand(1000)+1); $nuc_vector[$length]=$aa_cod{$aa_vector[$length]}{$r}; } } elsif ($ARGV[1] eq `N`) { $count=0; @nuc_array=split(//,$seq); foreach $nuc (@nuc_array) { chomp $nuc; $length = int($count/3)+1; $nuc_vector[$length] .= $nuc; $count++; } $count2=0; @ch_array=split(//,$change); foreach $ch (@ch_array) { chomp $ch; $length = int($count2/3)+1; $ch_vector[$length] = $ch; $count2++; } if ($count != $count2) {print "COUNT Mismatch\n"} $templength = int($count/3); for ($length=1; $length<=$templength; $length++) { $aa_vector[$length]=$cod_aa{$nuc_vector[$length]}; } } else { print "\n\n input format:\n ./SHMdesign.pl inputfile.fasta A/N \n\n"; exit; } ##########################################################################- # # # The program begins the process of construct optimization with 20 rounds # of 100 attempted tile substitutions at random positions throughout the construct. # At the beginning of each round for ($j=1; $j<=20; $j++) { ############ Print starting state for the round ########################## print "ITERATION\t$j\n";undef $nuclear; $length2=0; ### Amino acid sequence of construct for ($i=1; $i<=$length; $i++) { print "$cod_aa{$nuc_vector[$i]} "; } print "\n"; ### Nucleic acid sequence of the construct for ($i=1; $i<=$length; $i++) { print "$nuc_vector[$i]"; @temp=split(//,$nuc_vector[$i]); foreach $n (@temp) { $length2++; $nuclear[$length2]=$n } } print "\n"; ### SHM Design vector for the construct for ($i=1; $i<=$length; $i++) { print "$ch_vector[$i] "; } print "\n"; for ($i=1; $i<=$length2; $i++) { ### SHM hot spots for the construct $temp="$nuclear[$i].""$nuclear[$i+1].""$nuclear[$i+2].""$nuclear[$i+3]"; if (defined($hot{$temp})) {print "+"} else {print " "} } print "\n"; ### SHM cold spots for the construct for ($i=1; $i<=$length2; $i++) { $temp="$nuclear[$i].""$nuclear[$i+1].""$nuclear[$i+2]"; if (defined($cold{$temp})) { print "-" } else {print " "} } print "\n"; ### CpG motifs within the construct for ($i=1; $i<=$length2; $i++) { $temp="$nuclear[$i].""$nuclear[$i+1]"; if ($temp eq `CG`) { print "C" } else {print " "} } print "\n"; ############# End printing section ########################################
### Substitute 100 3mer amino acid positions ########################### # # At a randomly chosen position in the construct, a 9-mer nucleic acid in- frame section is chosen # all other nucleotide sequences consistent with the amino acid sequence are evaluated, # depending on whether this position is designated a hot, cold or neutral, and the sequence that results in the best # design improvement is chosen and subsititued. After a 100 interations, the programs evaluates its current state # and prints to the screen # # $position -> randomly chosen position within the construct # $nucleicacid -> current 9-mer nucleic acid at the position chosen for evaluation # $aminoacid -> current 3-mer amino acid at the position chosen for evaluation # $better -> flag for best sequence substitution at the position, if one is selected # $cur_coldsc, $cur_hotsc, $cur_cgsc, $cur_codindexsc -> place holders for the scores # of the currently selected 9-mer/3-mer at the position being evaluated # ######################################################################### for ($k=1; $k<=100; $k++) { $position=int(rand($length-4))+2; $pos1=$position-1; $pos2=$position; $pos3=$position+1; $nucleicacid="$nuc_vector[$pos1]$nuc_vector[$pos2]$nuc_vector[$pos3]"; $aminoacid="$cod_aa{$nuc_vector[$pos1]}$cod_aa{$nuc_vector[$pos2]}$cod_aa- {$nuc_vector[$pos3]}"; $cur_hotsc=$hotsc{$aminoacid}{$nucleicacid}; $cur_coldsc=$coldsc{$aminoacid}{$nucleicacid}; $cur_cgsc=$cgsc{$aminoacid}{$nucleicacid}; $cur_longsc=$longsc{$aminoacid}{$nucleicacid}; $cur_codindexsc=$codindexsc{$aminoacid}{$nucleicacid}; # print "$k\t$position\t$length\t$aminoacid\t$nucleicacid\t # $cur_hotsc\t$cur_coldsc\t$cur_cgsc\t$cur_longsc\t # $cur_codindexsc\n"; undef $better; if ($ch_vector[$pos2] eq `-`) { foreach $spot3 (keys %{$hotsc{$aminoacid}}) { if (($cur_coldsc < $coldsc{$aminoacid}{$spot3}) && ($cur_hotsc >= $hotsc{$aminoacid}{$spot3}) && ($cur_cgsc >= $cgsc{$aminoacid}{$spot3}) && ($cur_codindexsc <= $codindexsc{$aminoacid}{$spot}) && ($longsc{$aminoacid}{$spot} <=4)) { $better=$spot3; $cur_coldsc = $coldsc{$aminoacid}{$spot3}; $cur_hotsc = $hotsc{$aminoacid}{$spot3}; $cur_cgsc = $cgsc{$aminoacid}{$spot3}; $cur_codindexsc = $codindexsc{$aminoacid}{$spot}; } } } if ($ch_vector[$pos2] eq `+`) { foreach $spot3 (keys %{$hotsc{$aminoacid}}) { if (($cur_coldsc >= $coldsc{$aminoacid}{$spot3}) && ($cur_hotsc < $hotsc{$aminoacid}{$spot3}) && ($cur_cgsc >= $cgsc{$aminoacid}{$spot3}) && ($cur_codindexsc <= $codindexsc{$aminoacid}{$spot}) && ($longsc{$aminoacid}{$spot} <=3)) { $better=$spot3; $cur_coldsc = $coldsc{$aminoacid}{$spot3}; $cur_hotsc = $hotsc{$aminoacid}{$spot3}; $cur_cgsc = $cgsc{$aminoacid}{$spot3}; $cur_codindexsc = $codindexsc{$aminoacid}{$spot}; } } } if ($ch_vector[$pos2] eq `.`) { foreach $spot3 (keys %{$hotsc{$aminoacid}}) { if (($cur_cgsc >= $cgsc{$aminoacid}{$spot3}) && ($cur_codindexsc <= $codindexsc{$aminoacid}{$spot}) && ($longsc{$aminoacid}{$spot} <=3)) { $better=$spot3; $cur_coldsc = $coldsc{$aminoacid}{$spot3}; $cur_hotsc = $hotsc{$aminoacid}{$spot3}; $cur_cgsc = $cgsc{$aminoacid}{$spot3}; $cur_codindexsc = $codindexsc{$aminoacid}{$spot}; } } } ##########################################################################- ### ############################## # # if the variable $better is defined after exhaustively searching for an improved nucleic acid sequence # at the position, substitute that sequence into the evolving $nuc_vector sequence, then proceed with the next trial # # else, go to the next of the 100 random trails and try again # ##########################################################################- ### ########################## if (defined($better)) { @array=split(//,$better); $tempcount=0; $tempvector[1]=``; $tempvector[2]=``; $tempvector[3]=``; foreach $nuc (@array) { chomp $nuc; $new_position = int($tempcount/3)+1; $tempvector[$new_position] .= $nuc; $tempcount++; } ####### print "$nuc_vector[$pos1].$nuc_vector[$pos2].$nuc_vector[$pos3]\t$tempvector[1].- - $tempvector[2].$tempvector[3]\n"; $nuc_vector[$pos1]=$tempvector[1]; $nuc_vector[$pos2]=$tempvector[2]; $nuc_vector[$pos3]=$tempvector[3]; } } } exit;
[0298] In addition to the file of potential 3 amino acid tiles shown above, the program also calls upon a file of hot spots and cold spot motifs as outlined below in Table 7, and a listing of the genetic code to translate amino acid sequences to polynucleotide sequences:
TABLE-US-00008 TABLE 7 Canonical Hot and Cold Spot Motifs Coldspots Hotspots CCC TACC GGTA CTC TACA TGTA GCC TACT AGTA GTC TGCC GGCA GGG TGCA TGCA GAG TGCT AGCA GGC AACC GGTT GAC AACA TGTT AACT AGTT AGCC GGCT AGCA TGCT AGCT AGCT
[0299] One can recognize that there are many potential approaches, and computational methods which can be used to find the best codon usage to maximize hot spot or cold spot density, and that the invention is not intended to be limited to any one specific method of determining the optimum sequence.
[0300] When a starting amino acid template is given (for instance when the underlying DNA sequence may not be known), the algorithm begins by first generating a DNA nucleotide sequence that is consistent with both the given amino acid sequence and known codon usage in that organism. The starting nucleotide template contains an additional line that instructs the perl program SHMredesign.pl as to whether HOT or COLD sites should be incorporated at a given position, making it possible to silence or minimize SHM in portions of evolving proteins, while simultaneously directing SHM to areas for targeting, for instance, the CDRs of an antibody molecule. A given 9-mer SHM motif in the polynucleotide can be compared with all other possible nonameric oligonucleotides that would encode the same three amino acids at that position.
[0301] If a sequence, or portion thereof, is susceptible to SHM (made "hot"), an exhaustive search of all nucleotide sequences consistent with the amino acid sequence is made, and the nucleotide sequence of the evolving construct is replaced by a new nucleotide sequence if the following conditions are met: (1) the new 9-mer SHM motif contains more hot spot motifs that the existing sequence, (2) the new 9-mer contains a number of cold spotmotifs equal to or less than the evolving sequence, (3) the new 9-mer contains a number of CpG sequence motifs equal to or less than the evolving sequence, (4) the evolving sequence has a codon usage score that equals or improves known aggregate codon usage at the position, and (5) the sequence does not contain a stretch of any one nucleotide greater than 4 residues.
[0302] If a sequence, or portion thereof, is being made resistant to SHM (being made "cold"), an exhaustive search of all nucleotide sequences consistent with the amino acid sequence is made, and the nucleotide sequence of the evolving construct is replaced by a new nucleotide sequence if the following conditions are met: (1) the new 9-mer SHM motif contains more cold spot motifs that the existing sequence, (2) the new 9-mer contains a number of hot spot motifs equal to or less than the evolving sequence, (3) the new 9-mer contains a number of CpG sequence motifs equal to or less than the evolving sequence, (4) the evolving sequence has a codon usage score that equals or improves known aggregate codon usage at the position, and (5) the new 9-mer nucleotide sequence does not contain a stretch of any one nucleotide greater than 4 residues.
[0303] If a sequence is being optimized for other factors other than SHM (being made "neutral"), an exhaustive search of all nucleotide sequences consistent with the amino acid sequence is made, and the nucleotide sequence of the evolving construct is replaced by the new nucleotide sequence if the following conditions are met: (1) the new 9-mer contains a number of CpG sequence motifs equal to or less than the evolving sequence, (2) the evolving sequence has a codon usage score that equals or improves known aggregate codon usage at the position, and (3) the new 9-mer nucleotide sequence does not contain a stretch of any one nucleotide greater than 4 residues.
[0304] Starting from any given polynucleotide sequence, this approach can be used to generate polynucleotide sequences that rapidly converge to a small number of possible sequences that are optimized for the properties described herein (Example 1).
[0305] Following computational analysis, a final optimized polynucleotide can be synthesized using standard methodology and sequenced to confirm correct synthesis. Once the sequence of the polynucleotide has been confirmed, the polynucleotide can be inserted into a vector. The vector can be introduced into a host cell as described herein and tested for expression, activity, or increased and/or decreased susceptibility to SHM.
V. Construction of Synthetic Libraries for SHM Mediated Diversification
[0306] Synthetic polynucleotide libraries can be used for the directed evolution and selection of proteins with novel phenotypes by exploiting the diversity generating and targeting properties of SHM.
[0307] In the case of antibodies, this means targeted diversification of complementarity determining regions (CDRs) that can bind new or altered epitopes. Simplified CDR libraries containing four and even 2 amino acid alphabets (serine and tyrosine) have also been described and were found to be capable of binding antigens with high affinity and selectivity. See, e.g., Fellouse F A, Li B, Compaan D M, Peden A A, Hymowitz S G, Sidhu SS Molecular recognition by a binary code. J Mol. Biol. (2005) 348:1153-62; and Fellouse F A, Wiesmann C, Sidhu SS Synthetic antibodies from a four-amino-acid code: a dominant role for tyrosine in antigen recognition. Proc Natl Acad Sci USA. (2004) 101:12467-72.
[0308] Synthetic polynucleotide libraries can also be used the case of non-antibody polypeptides such as enzymes and other protein classes, this refers to targeting diversification to regions of the enzyme or protein of interest which regulate the biological activity of said enzyme or protein, such as binding specificity, enzymatic function, fluorescence, or other properties. Libraries are usually combined with one or more selection strategies as disclosed below, which provide for the identification and/or separation of the improved, or functional members of the library from the non-functional members of the library.
[0309] Static libraries are, in some embodiments, limited in their Size and scope. Phage display libraries, for example can display as many as 1012 members, and ribosomal libraries have been constructed that potentially contain ˜1016 members. Libraries presented on the surface of bacterial and mammalian cells are not usually this complex, with fewer than about 109 members. In addition, robust library construction and selection usually requires that libraries contain several fold redundancy, which further limits this theoretical complexity, and makes screening the entire library slow, expensive, and in some cases in-practical.
[0310] Despite these levels of complexity, such static libraries can explore only a small fraction of possible sequence space. In one non-limiting example, a heavy chain IgG sequence can contain more than 30 amino acids within the CDR1, CDR2, and CDR3 complementarity regions, giving this single chain more than 2030 possible permutations, dwarfing even the largest of potential libraries. Because of this limitation, researchers have explored methodologies for evolving protein sequences and libraries. SHM, as addressed in the present application, uses AID and error-prone polymerases as the mechanism for evolving antibody sequences undergoing affinity maturation. A system that would facilitate SHM-mediated mutagenesis and selection at each position of interest within a polynucleotide library of a given gene would permit the selective exploration of functional sequence space. Such a search strategy enables a much larger sequence diversity to be explored, making this method very attractive for the rapid development of new functionalities and therapeutics. For instance, a library composed of only a small number of hot spot codons at each coding position of a stretch of 10 amino acids (210 permuations=1.6*104), where each position is capable of evolving under SHM to a diverse panel of resulting amino acids, represents a vast simplication of the complexity/diversity needed to encode an equivalent static library of all 20 amino acids at each of the ten library positions (2010 permutations=1.6*1014).
[0311] In one aspect, the present invention includes a synthetic dynamic library that is capable of rapid evolution through SHM-mediated mutagenesis. Such a synthetic library has the following properties: i) The library is easy to synthesize and is based around a limited number of discrete functional sequences; ii) The library contains synthetic polynucleotide sequences that comprises one or more synthetic variable regions that are targeted for selective mutagenesis and includes a high density of SHM hot spots; iii) The library contains synthetic polynucleotide sequences that comprise one or more synthetic framework regions that are resistant to SHM mediated mutagenesis and include a low density of SHM hot spots; iv) The library does not contain, or contains a minimum number of, certain codons ("non preferred codons") that can be mutated to stop codons in one step through SHM, including, UGG (Trp), UGC (Cys), UCA (Ser), UCG(Ser), CAA(Gln), GAA (Glu) and CAG (Gln); and v). From the starting set of codons, AID-mediated mutagenesis produces a large potential diversity at each position for further evolution and selection of function ("preferred SHM hot spot codons" or "preferred SHM hot spot motifs").
[0312] A method for SHM optimization of gene sequences as described herein uses a previously scored library of 9-mer tiles (SHM motifs) that can be substituted to modify a sequence in order to generate a `hotter` or `colder` sequence as described above, while still maintaining the amino acid sequence and other desirable properties. It should be noted that the tiles, while chosen to be 9 nucleotides in this application, can be of any length, as long as they permit the accurate assessment of sequence based properties. Likewise, the hot and cold SHM motifs can be used to score the 9-mer tile libraries for substitution, it is possible to use any other sized or defined SHM hot or cold spot motifs in combination with this approach; for example based on hot and cold scores derived from statistical analyses, to make improved constructs. Tiles can be scored based on their use of in-frame SHM hot spot motifs as a way of seeding not just mutagenesis but the resulting amino acid diversity (or lack of same) at various positions throughout the construct. Tiles can be scored based on their use of in-frame SHM cold spot motifs as a way of stabilizing a polynucleotide against AID-mediated mutagenesis at various positions throughout the construct.
[0313] One can recognize that there are many potential approaches, and computational methods which could be used to find the best codon usage to maximize hot spot or cold spot motif density, and that the invention is not intended to be limited to any one specific method of determining the optimum sequence.
VI. Library Design
[0314] A synthetic library around a specific protein of interest can be designed in light of any known pre-existing information regarding structure activity relationships, homology between different species, and x-ray or NMR structural information of the protein or protein family in question, if available.
[0315] In one aspect, initial library design can involve the following steps:
[0316] 1. The amino acid sequence of the protein of interest is identified, and the corresponding polynucleotide sequence determined or reverse transcribed.
[0317] 2. Any relevant structural information on the protein of interest, and related proteins, or on homologous proteins of interest is obtained.
[0318] 3. A sequence comparison is preformed on the protein of interest compared to all other proteins from closely related species, and known isoforms, and in certain embodiments, a sequence alignment can be created to identify conserved, and variable amino acid sequences between species.
[0319] This information can be used to establish whether a specific amino acid or protein domain is likely to be important in a functional, or structural, attribute of the protein of interest, and whether it is conserved or variant across functional isoforms of the protein across protein families.
[0320] Based on this information, it is possible to establish particular regions of interest that appear to be directly involved in functional or structural attributes of the protein of interest. For example, these amino acids can lie within, or within about 5 Å of a specific functional or structural attribute of interest. Specific examples include, but are not limited to, amino acids within CDRs of antibodies, binding pockets of receptors, catalytic clefts of enzymes, protein-protein interaction domains, of co-factors, allosteric binding sites etc.
[0321] Based on the structural and sequence analysis as set forth above, one or more polynucleotides can be designed to increase or decrease SHM-mediated mutagenesis using the parameters described above. Furthermore, the design can incorporate one or more of the following concepts:
[0322] i) Highly conserved amino acids, or amino acids known, or believed to directly contribute key binding energy can be initially conserved, and the codon usage within their immediate vicinity changed to either create a cold spot motif, or altered to promote mostly conservative amino acid changes during SHM as described herein.
[0323] ii) Amino acid domains that appear to be involved in maintaining the core structural framework of the protein can be initially conserved, and their codon usage changed to promote mostly conservative amino acid changes during SHM. Amino acid residues in particularly important frame work regions can be altered to use a higher percentage of cold spots, and utilize codons or motifs that are resistant to SHM, or result in silent mutations during SUM.
[0324] iii) Amino acids in regions of interest can be varied to incorporate synthetic variable regions enabling high efficiency SHM, as described below.
[0325] iv) Amino acids that are not identified as playing clearly identified roles with respect to a function or structure of a polypeptide can be modified to enable effective SHM, i.e., the frequency of SHM hot spots can be maximized and the frequency of SHM cold spots can be minimized.
VII. The Design of Synthetic Variable Regions
[0326] The rank ordering of susceptibility to mutagenicity of all SHM hot spots for AID and error prone polymerases was presented in the Section III. We further identified a reading frame context that is critical for generation of silent vs. non-silent mutations. Herein we describe a synthetic library approach that includes the use of a high-density of preferred SHM hot spot codons or motifs that lead to generation of diverse amino acids at each library position which is desired to be mutated. Such high density hot spot motifs are particularly important at the boundary of synthetic variable regions to ensure efficient mutagenesis.
[0327] A. WAC Based Motifs
[0328] Polynucleotide sequences comprising only the sequence WAC (WAC, where W=A or T is encoded in equal proportions, and where the reading frame of reference places C at the wobble or 3rd position of each codon) provides for a high density of hot spots.
[0329] This simple pattern would produce only 4 potential 6-mer nucleotide patterns containing only two codons (AAC and TAC) encoding the 2 amino acids, Asparagine (Asn) and Tyrosine (Tyr). Sequence identifiers are next to each sequence in parenthesis.
TABLE-US-00009 TABLE 8 Codons Amino acids AACTAC (269) Asn Tyr AACAAC (270) Asn Asn TACTAC (271) Tyr Tyr TACAAC (272) Tyr Asn
[0330] All of the motifs encoded by the WAC library, given in any of the three possible reading frames, produce a concentration of hot spots. FIG. 3 compares these motifs with all other possible 4096 6-mer nucleotide combinations for their ability to recruit SHM-mediated machinery. Longer assemblies result in the same high density of SHM "hot spots" with no "cold spots." It is also worth noting that this assembly of degenerate codons (WACW) results in a subset of possible 4-mer hot spots described by Rogozin et al. (WRCH), where R=A or G, H=A or C or T, and W=T or A.
[0331] As seen in FIG. 4, the preferred SHM hot spot codons AAC and TAC, which are the basis for this synthetic library, can result in a set of primary and secondary mutation events that create considerable amino acid diversity, as judged by equivalent SHM mutation events observed in Ig heavy chains antibodies. From these two codons, basic amino acids (histidine, lysine, arginine), an acidic amino acid (aspartate), hydrophilic amino acids (serine, threonine, asparagine, tyrosine), hydrophobic amino acids (alanine, and phenylalanine), and glycine are generated as a result of SHM events.
[0332] B. WRC Based Motifs
[0333] A second potential synthetic high density SHM motif, termed here the WRC motif, is one that contains two possible codons: AGC and TAC encoding the 2 amino acids, Serine (Ser) and Tyrosine (Tyr). In this embodiment, the four possible 6-mer nucleotides include:
TABLE-US-00010 TABLE 9 Codons Amino acids AGCTAC (273) Ser Tyr AGCAGC (274) Ser Ser TACAGC (275) Tyr Ser TACTAC (271) Tyr Tyr
Sequence identifiers are next to each sequence in parentheses.
[0334] The distribution of all 4096 6-mer nucleotide z-scores describing the hotness or coldness of the motif to SHM-mediated mutation is illustrated in FIG. 5. The z-scores for all permutations of 6-mers in the WRC synthetic library are superimposed on this distribution, with the dashed line denoting the top 5% of all possible motifs.
[0335] The series of mutation events that lead to the creation of amino acid diversity, starting from "preferred SHM hot spot codons" AGC and TAC, as observed in affinity matured IGV heavy chain sequences is illustrated in FIG. 6. 4200 primary and secondary mutation events, starting from codons encoding asparagine and tyrosine, lead to a set of functionally diverse amino acids.
[0336] Again this motif results in an unusually high density of optimal SHM hot spots and hot codons, as visualized in FIG. 5, when compared with all other 6-mer nucleotide motifs. Like the WAC synthetic motif, the WRC synthetic motif presents preferred SHM hot spot codons that, when combined with the activity of SHM, AID and one or more error-prone polymerases, generates a broad spectrum of potential amino acid diversity at each position (FIG. 6).
[0337] Thus in one aspect, such synthetic variable regions can be targeted to specific regions of interest within a polynucleotide sequence that encode specific domains, or sub domains of interest and for which a high degree of diversity is desired.
[0338] In another aspect WAC or WRC motifs can be inserted systematically throughout the open reading frame of the protein of interest. For example, for a 100 amino acid residue protein, 300 discrete polynucleotides could be generated in which a WAC or WRC motif was separately introduced once into every possible position within the protein. Each of these 100 polynucleotides could then be screened, either separately, or after being pooled into a library, to identify optimal amino acid substitutions at each position. The improved mutations at each position could then be re-combined to create a next generation construct comprising all of best individual amino acids identified at each position.
[0339] C. Region Mutagenesis
[0340] To provide for effective mutagenesis within larger regions, codons or motifs can be modified as discussed previously to increase the density of hot spots throughout one or more regions of interest. This approach has the advantage of needing no preconceived idea of where SHM should be targeted, or what specific amino acids are essential for activity.
[0341] For regions in which efficient SHM is desired, a synthetic variable region can be created by both changing codon usage and by making conservative amino acid substitutions so as to insert codons or motifs that have an improved hot spot density. Suitable amino acid substitutions can be selected from those listed below in Table 10, while observing the same overall criteria for stable gene creation, and domain structure.
TABLE-US-00011 TABLE 10 Preferred SHM Codons Use in Codons Amino Acid Group/Sub group place of: AGC/AGU Ser Aliphatic/Slightly Thr/Cys non polar GGU Gly Aliphatic/Small Ala residue GCU/GCA Ala Aliphatic/Small Gly residue CUA/UUG/CUU Leu Aliphatic/Large Val/Met Charged AAA/AAG Lys Charged/Positive Arg CAU His Charged/Positive Arg/Phe GAU Asp Charged/Negative Glu GAG Glu Charged/Negative Asp Charged/Polar CAG Gln Charged/Polar Asn AAU/AAC Asn Charged/Polar Gln Aromatic/Phenyl UAU/UAC Tyr Aromatic/Phenyl Trp UUU/UUA/UUC Phe Aromatic/Phenyl Trp/Phe
[0342] In some embodiments, the amino acids Trp, Pro and Gly are conserved where their location suggests a functional or structural role. Other than these amino acids, if an amino acid to be optimized is not listed, an amino acid from the same sub-group as listed below is selected.
[0343] Such synthetic variable regions can be interspersed with framework regions containing primarily SHM resistant sequences, which can be designed as described previously.
[0344] Depending on the amount of information available, a number of distinct library design strategies can be employed, ranging from a very aggressive targeted approach based on the use of WAC or WRC motifs, to a more conservative strategy of using fairly selective amino acid replacements, to a cautious strategy in which only codon usage is changed. An advantage of the present invention is that each approach results in the generation of only a limited number of distinct nucleotide sequences; thus all of these strategies can be subjected to SHM mediated diversity in parallel without significant additional burden.
VIII. Methods for Monitoring SHM Activity
[0345] Art-recognized methods for monitoring SHM in antibody and non-antibody proteins using various vectors and cell lines are known (Ruckerl et al. (Mol. Immunol. 43 (2006); 1645-1652), Bacl et al. (J. Immunol., 2001, 166: 5051-5057), Cumbers et al. (Nat. Biotechnol. 2002; 20(11): 1129-1134), Wang, et al. (Proc Natl Acad Sci USA. 2004; 101(19):7352-7356)). In addition, various methods for directly measuring cytidine deamination are known in the art; see, e.g., Genetic and In vitro assays of DNA deamination, Coker et al., Meth. Enzymol. 408: 156-170 (2006).
[0346] Such methods provide rapid means for evaluating the rate of on-going SHM. The methods include, for example, the use of reporter genes, or selectable marker genes that have been modified to include a stop codon within the coding frame which can be mutated in the presence of AID activity.
[0347] As AID acts on a population, it can produce mutations that restore or improve function (of a selectable marker, for instance), or mutations that reduce or eliminate function. The balance in these two rates generates early and rare mutation events that restore function, followed by secondary and ternary mutation events that destroy function in these proteins. The net effect of these competing rates on the observation of gain-of-function events in a population. Given three different assumptions regarding number of inactivating mutations needed to silence GFP, one would expect to observe three very different profiles of reversion events as a function of time, dependent on the rate of enzymatic activity of the AID.
[0348] Additionally, polynucleotides subjected to SHM activity can be sequenced to determine if the nucleotide sequence of has been modified and to what degree. Polynucleotides can be rescued from culture to determine SHM at various time points. Methods of isolating and sequencing genes are well known in the art, and include, the use of standard techniques such as, for example, Reverse Transcription-Polymerase Chain Reaction (RT-PCR). Briefly, the polynucleotide can be reverse transcribed and subjected to PCR using appropriate primers. Clones can be sequenced using automated DNA sequences from companies such as Applied Biosystems (ABI-377 or ABI 3730 DNA sequencers). Sequences can be analyzed for frequency of nucleotide modifications. The polynucleotide can be compared with the polynucleotide from the starting material and analyzed for sequence modifications.
IX. Somatic Hypermutation (SHM) Systems
[0349] A. Synthetic Polynucleotide Sequences
[0350] The development of a practical system for the use of SHM requires that mutations be directed to specific genes (polynucleotides) or regions of interest (made "hot"), and be directed away from structural or marker genes that are functionally required within the cell or episome, to maintain overall system functionality and/or stability (made "cold"). In certain embodiments, a synthetic gene is one that does naturally undergo SHM when expressed in a B cell (i.e., an antibody gene). In other embodiments, a synthetic gene is one that does not naturally undergo SHM when expressed in a B cell (i.e., a non-antibody gene).
[0351] The present invention is based on the development of a system to design and make or generate SHM susceptible and SHM resistant polynucleotide sequences within a cell or cell-free, environment. The present invention is further based on the development of a SHM system that is stable over a suitable time period to reproducibly maintain increased and/or decreased rates of SHM without affecting structural portions or polypeptides or structural proteins, transcriptional control regions and selectable markers. The system allows for stable maintenance of a mutagenesis system that provides for high level targeted SHM in a polynucleotide of interest, while sufficiently preventing non-specific mutagenesis of structural proteins, transcriptional control regions and selectable markers.
[0352] In part, the present system is based around the creation of a more stable version of cytidine deaminase that can provide for high level sustained SHM. High level over-expression of wild type AID in mammalian cells does not necessarily lead to a stable increase in SHM activity because the enzyme itself can either accumulate inactivating mutations through SHM of its own DNA sequence, or be silenced through post-translational modifications (Ronai et al., PNAS USA 2005; 102(33): 11829-34; Iglesias-Ussel et al., J. Immunol. Methods. 2006, 316: 59-66). The present SHM system, therefore, includes a synthetic AID gene (SEQ ID NO: 22) that is resistant to SHM (cold) and exhibits a reduced rate of self mutation.
[0353] Thus, in one aspect, the present invention includes a synthetic AID gene that has been altered at the polynucleotide level to have a reduced number of hot spots, and/or increased number of cold spots. In one embodiment of this synthetic gene, the gene also has a modified content of CpG methylation sites. In another aspect, the synthetic gene has been optimized for SHM codon usage specific to the organism in which the synthetic gene is to be expressed or mutated.
[0354] Additionally, there are a variety of other component nucleotide sequences, such as coding sequences and genetic elements that can make up the core system that one would, in some embodiments, prefer not to hypermutate to maintain overall system integrity. These component nucleotide sequences include without limitation, i) selectable markers such as neomycin, blasticidin, ampicillin, etc; ii) reporter genes (e.g. fluorescent proteins, epitope tags, reporter enzymes); iii) genetic regulatory signals, e.g. promoters, inducible systems, enhancer sequences, IRES sequences, transcription or translational terminators, kozak sequences, splice sites, origin of replication, repressors; iv) enzymes or accessory factors used for high level enhanced SHM, or it's regulation, or measurement, such as AID, pol eta, transcription factors, and MSH2; v) signal transduction components (kinases, receptors, transcription factors) and vi) domains or sub domains of proteins such as nuclear localization signals, transmembrane domains, catalytic domains, protein-protein interaction domains, and other protein family conserved motifs, domains and sub-domains.
[0355] Thus, in another aspect of the present invention, the SHM system described herein can include any synthetic gene that has been altered, at the polynucleotide level, either in whole, or part, to have a reduced number of hot spots, and/or an increased number of cold spots using the methods described herein. In one embodiment, the synthetic gene also has a modified content of CpG methylation sites.
[0356] Provided herein is an expression vector, comprising at least one synthetic gene. In one aspect, the expression vector is an integrating expression vector. When the expression vector is an integrating expression vector, the expression vector can further comprise one or more sequences to direction recombination. In another aspect, the expression vector is an episomal expression vector. In yet another aspect, the expression vector is a viral expression vector.
[0357] In another aspect, the synthetic gene has been optimized for SHM codon usage specific to the organism in which the synthetic gene is to be expressed and/or mutated.
[0358] Provided herein is a SHM resistant synthetic gene encoding a protein, or a portion thereof, wherein one or more first SHM motifs in an unmodified polynucleotide sequence encoding said protein or portion thereof has been replaced by one or more second SHM motifs having a lower probability of SHM, wherein said SHM resistant synthetic gene exhibits a lower rate of AID-mediated mutagenesis compared to said unmodified polynucleotide sequence.
[0359] The present invention also contemplates that a SHM resistant synthetic gene can be created in a step-wise or sequential fashion such that some modifications are made to the gene and then a subsequent round of modification is made to the gene. Such sequential or step-wise modifications are contemplated by the present invention and are one way of carrying out the process and one way of producing the genes claimed herein.
[0360] In one embodiment, the SHM resistant synthetic gene encodes a protein or portion thereof having about 95%, about 90% amino, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, about 55%, about 50%, or any percentage between about 50% and about 100% identity to the unmodified gene.
[0361] In one embodiment, the SHM resistant synthetic gene exhibits a lower rate of AID-mediated mutagenesis including, but not limited to, 1.05-fold, 1.1-fold, 1.2-fold, 1.5-fold, 2-fold, 5-fold, 10-fold, 50-fold, 100-fold, 200-fold, 500-fold, 1000-fold or less, or any range therebetween.
[0362] In one embodiment, the SHM resistant synthetic gene exhibiting a rate of AID-mediated mutagenesis at a level which is less than about 99%, less than about 95%, less than about 90%, less than about 85%, less than about 80%, less than about 75%, less than about 70%, less than about 65%, less than about 60%, less than about 55%, or less than about 50%, of that exhibited by an unmodified gene.
[0363] In other embodiments, a high rate of SHM mediated mutagenesis targeted to a polynucleotide of interest is desirable to direct rapid directed evolution of the polynucleotide.
[0364] Provided herein is a SHM susceptible synthetic gene encoding a protein, or a portion thereof, wherein one or more first SHM motifs in an unmodified polynucleotide sequence encoding said protein or portion thereof has been replaced by one or more second SHM motifs having a higher probability of SHM, wherein said SHM susceptible synthetic gene exhibits a higher rate of AID-mediated mutagenesis compared to said unmodified polynucleotide sequence.
[0365] The present invention also contemplates that a SHM susceptible synthetic gene can be created in a step-wise or sequential fashion such that some modifications are made to the gene and then a subsequent round of modification is made to the gene. Such sequential or step-wise modifications are contemplated by the present invention and are one way of carrying out the process and one way of producing the genes claimed herein.
[0366] In one embodiment, the SHM susceptible synthetic gene encodes a protein or portion thereof having about 95%, about 90% amino, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, about 55%, about 50%, or any percentage between about 50% and about 100% identity to the unmodified gene.
[0367] In one embodiment, the SHM susceptible synthetic gene exhibits a higher rate of AID-mediated mutagenesis including, but not limited to, 1.05-fold, 1.1-fold, 1.25-fold, 1.5-fold, 2-fold, 5-fold, 10-fold, 50-fold, 100-fold, 200-fold, 500-fold, 1000-fold or more, or any range therebetween.
[0368] In one embodiment, the SHM susceptible synthetic gene exhibits a rate of activation induced cytidine deaminase (AID)-mediated mutagenesis at a level which is at least about 101%, at least about 105%, at least about 110%, at least about 115%, at least about 120%, at least about 125%, at least about 130%, at least about 135%, at least about 1140%, at least about 145%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 350%, at least about 400%, at least about 450%, at least about 5000%, or higher of that exhibited by an unmodified gene.
[0369] Provided herein is a selectively targeted, SHM optimized synthetic gene encoding a protein, or a portion thereof, wherein one or more first SHM motifs in an unmodified polynucleotide sequence encoding said protein or portion thereof has been replaced by one or more second SHM motifs having a higher probability of SHM; and one or more third SHM motifs in said unmodified polynucleotide sequence encoding said protein or portion thereof has been replaced by one or more fourth SHM motifs having a lower probability of SHM; wherein said selectively targeted, SHM optimized synthetic gene exhibits targeted AID-mediated mutagenesis. In such an embodiment, the selectively targeted, SHM optimized synthetic gene has some portions that exhibit a higher rate of AID-mediated mutagenesis and some portions that exhibit a lower rate of AID-mediated mutagenesis.
[0370] The present invention also contemplates that a selectively targeted SHM optimized synthetic gene can be created in a step-wise or sequential fashion such that some modifications are made to the gene and then a subsequent round of modification is made to the gene. Such sequential or, step-wise modifications are contemplated by the present invention and are one way of carrying out the process and one way of producing the genes claimed herein.
[0371] Further provided herein is a system that enables high level somatic hypermutation that can be targeted to specific polynucleotides (e.g., synthetic genes or areas within synthetic genes) of interest, while avoiding the non-specific mutagenesis of components involved in the maintenance of the mutagenesis and expression system. Polynucleotides which can be mutated in the present system include any polynucleotide sequence that can be expressed and modified through AID-mediated mutagenesis. Such polynucleotides include those that encode polypeptides including, for example, specific binding members, enzymes, receptors, neurotransmitters, hormones, cytokines, chemokines, structural proteins, co-factors, toxins, or any other polypeptide or protein of interest or portion thereof. In one aspect such polynucleotides encode immunoglobulin polypeptides (antibodies) such as variable heavy chains or light chains or portions thereof.
[0372] Provided herein is a SHM system, e.g. one or more vectors (e.g., expression vectors) for SHM comprising at least one component (e.g. polynucleotide, gene, nucleic acid sequence, coding sequence, genetic element, a portion thereof, etc.) that includes, but is not limited to, a polynucleotide that has been altered from wild type to either positively or negatively influence the rate of SHM experienced by that component, or portion thereof.
[0373] In one aspect of the SHM system, at least one component of the expression system comprises a polynucleotide that has been altered, in whole, or part, to negatively influence the rate of SHM experienced by that component. In one aspect of this system, the component is a polynucleotide encoding a protein such as, but not limited to, an AID, or an AID homolog, Pol eta, a selectable marker, a fluorescent protein, EBNA1, or a represser (or transactivator) protein.
[0374] In one aspect of the SHM system, at least one component of the expression system comprises a polynucleotide that has been altered, in whole, or part, from wild-type to positively influence the rate of SHM experienced by that component; or comprises a polynucleotide that has a high rate of SHM, such as, for example, a hypervariable region of an antibody gene, the DNA binding domain of a transcription factor, the active site of an enzyme, the binding domain of a receptor, or a sub domain or domain of interest.
[0375] In another aspect, the SHM system comprises; i) at least one polynucleotide that can be a polynucleotide that has been altered in whole or part, from wild type to positively influence the rate of SHM experienced by that polynucleotide, or a polynucleotide that has a naturally high frequency of hot spots, ii) and the expression system also includes a polynucleotide that has been altered in whole or part, from wild-type to negatively influence the rate of SHM.
[0376] In one embodiment, provided herein is a SHM susceptible gene encoding a protein or a portion thereof wherein one or more first SHM motifs in an unmodified polynucleotide sequence encoding said protein or portion thereof has been replaced by one or more second SHM motifs having a higher probability of SHM, said synthetic gene having a greater density of hot spot motifs than said unmodified polynucleotide sequence.
[0377] In another embodiment, provided herein is a SHM resistant synthetic gene encoding a protein or a portion thereof wherein one or more first SHM motifs in an unmodified polynucleotide sequence encoding said protein or portion thereof has been replaced by one or more second SHM motifs having a lower probability of SHM, said synthetic gene having a greater density of cold spots than said unmodified polynucleotide sequence.
[0378] In yet another embodiment, provided herein is a selectively targeted, SHM optimized synthetic gene encoding a protein or portion thereof, wherein one or more first SHM motifs in an unmodified polynucleotide sequence encoding said protein or portion thereof has been replaced by one or more second SHM motifs having a higher probability of SHM, said synthetic gene having a greater density of hot spot motifs than said unmodified polynucleotide sequence; and one or more third SHM motifs in said unmodified polynucleotide sequence encoding said protein or portion thereof has been replaced by one or more fourth SHM motifs having a lower probability of SHM, said synthetic gene having a greater density of cold spots than said unmodified polynucleotide sequence; wherein said selectively targeted, SHM optimized synthetic gene exhibits targeted AID-mediated mutagenesis.
[0379] In yet another non-limiting aspect, the said synthetic gene includes one or more amino acid mutations that introduce preferred SHM hot spot motifs.
[0380] Thus, one aspect the present invention includes a method of creating SHM resistant ("cold") or SHM susceptible ("hot") genes wherein the hot spot or cold spot density is altered from the unmodified density, while maintaining translational efficiency of the synthetic protein (i.e. the ability to be successfully expressed in a mammalian cell).
[0381] In one aspect, a synthetic SHM resistant gene of the present invention has an average hot spot density of 7, or less, hot spots per 100 nucleotides. In another aspect, said synthetic SHM resistant gene has an average cold spot density of greater than 16 cold spots per 100 nucleotides.
[0382] In a preferred aspect, a synthetic SHM resistant gene of the present invention has an average hot spot density of less than 6 hot spots per 100 nucleotides. In another aspect, said synthetic SHM resistant gene has an average cold spot density of greater than 18 cold spots per 100 nucleotides. In another aspect, said synthetic SHM resistant gene has an average cold spot density of greater than 20 cold spots per 100 nucleotides. In another aspect, said synthetic SHM resistant gene has an average cold spot density of greater than 22 cold spots per 100 nucleotides.
[0383] In one aspect, a synthetic SHM susceptible gene of the present invention has an average cold spot density of 13 or less cold spots per 100 nucleotides. In another aspect, said synthetic SHM susceptible gene has an average hot spot density of greater than 10 hot spots per 100 nucleotides.
[0384] In a preferred aspect, a synthetic SHM susceptible gene of the present invention has an average cold spot density of less than 11 cold spots per 100 nucleotides. In another aspect, said synthetic SHM susceptible gene has an average hot spot density of greater than 13 hot spots per 100 nucleotides. In another aspect, said synthetic SHM susceptible gene has an average hot spot density of greater than 14 hot spots per 100 nucleotides. In another aspect, said synthetic SHM susceptible gene has an average hot spot density of greater than 16 hot spots per 100 nucleotides
[0385] In another aspect, a synthetic SHM susceptible polynucleotide has an average hot spot density of greater than 20 hot spots per 100 nucleotides over at least 12 contiguous nucleotides. In another aspect, a synthetic SHM susceptible polynucleotide has an average hot spot density of greater than 20 hot spots per 100 nucleotides over at least 15 contiguous nucleotides. In another aspect, a synthetic SHM susceptible polynucleotide has an average hot spot density of greater than 20 hot spots per 100 nucleotides over at least 18 contiguous nucleotides. In another aspect, a synthetic SHM susceptible polynucleotide has an average hot spot density of greater than 20 hot spots per 100 nucleotides over at least 30 contiguous nucleotides.
[0386] In one non-limiting example, a synthetic gene does not include genes comprising a stop motif inserted into an open reading frame.
[0387] In each of the SHM systems described herein, the systems can further include one or more of the following additional elements: i) an inducible system to regulate the expression of AID, or an AID homolog, ii) one or more enhancers, iii) one or more E-boxes, iv) one or more auxiliary factors for SHM, or v) one or more factors for stable episomal expression, such as EBNA1, or EBP2.
[0388] In another aspect of the SHM systems, the system includes two polynucleotides in which both polynucleotides are located in proximity to a promoter. In one aspect of the system, the promoter can be a bi-directional promoter; such as a bi-directional CMV promoter.
[0389] In another aspect, the polynucleotide can encode antibody chains. For example, heavy or light chains can be inserted into a vector for expression. In other aspects the polynucleotide can encode any protein, i.e. a wild-type polypeptide, a non-wild-type polypeptide, a synthetic polypeptide, a recombinant polypeptide or any portion thereof such as, without limitation, antibody heavy chains or fragments thereof, antibody light chains or fragments thereof, enzymes, receptors, structural proteins, co-factors, synthetic peptides, intrabodies, or toxins.
[0390] Provided herein is a method for preparing a gene product having a desired property, comprising: a) preparing a synthetic gene encoding a gene product which exhibits increased somatic hypermutation; b) expressing said synthetic gene in a population of cells; wherein said population of cells express activation induced cytidine deaminase (AID), or can be induced to express AID via the addition of an inducing agent; and c) selecting a cell or cells within the population of cells which express a mutated gene product having the desired property. In one aspect, the method, optionally, further comprises activating or inducing the expressing AID in said population of cells. In another aspect, the method, optionally, further comprises establishing one or more clonal populations of cells from the cell or cells identified in (c). In yet another aspect of the method, at least one synthetic gene is located in an expression vector such as any one of the vectors described elsewhere herein. In one aspect of the method, the cell is a cell as described elsewhere herein.
[0391] Provided herein is a method for preparing a gene product having a desired property, comprising: a) expressing said gene product in a population of cells; wherein said population of cells comprises at least one synthetic gene which exhibits decreased somatic hypermutation; and wherein said population of cells express an activation induced cytidine deaminase (AID), or can be induced to express AID via addition of an inducing agent; Provided herein is a method of generating SHM-susceptible or SHM-resistant polynucleotides by modifying hot and/or cold spots in a polynucleotide encoding a polypeptide. The method of generating a SHM-susceptible or SHM-resistant polypeptide by includes the following: a) identifying a polypeptide or portion thereof; b) generating a polynucleotide sequence that codes for the identified polypeptide sequence, c) changing the codon usage in the polynucleotide sequence to increase or decrease the frequency, or location with respect to the reading frame of hot spots and/or cold spots within that polynucleotide sequence, without substantially changing the amino acids encoded by the polynucleotide sequence; d) selecting a polynucleotide sequence in which the frequency and b) selecting a cell or cells within the population of cells which express a mutated gene product (e.g., a polypeptide encoded by the mutated synthetic gene, the gene having one or more mutations) having the desired property. In one aspect, the method, optionally, further comprises activating or inducing the expressing AID in said population of cells. In another aspect, the method, optionally, further comprises establishing one or more clonal populations of cells from the cell or cells identified in (b). In yet another aspect of the method, at least one synthetic gene is located in an expression vector such as any one of the vectors described elsewhere herein. In one aspect of the method, the cell is a cell as described elsewhere herein.
[0392] In one aspect, a protein encoded by a synthetic gene is selected from among antibodies or antigen-binding fragments thereof, selectable markers, fluorescent proteins, cytokines, chemokines, growth factors, hormones, enzymes, receptors, structural proteins, toxins, co-factors and transcription factors.
[0393] Provided herein is a method of generating SHM-susceptible or SHM-resistant polynucleotides by modifying hot and/or cold spots in a polynucleotide encoding a polypeptide. The method of generating a SHM-susceptible or SHM-resistant polypeptide includes the following: a) identifying a polypeptide or portion thereof; b) generating a polynucleotide sequence that codes for the identified substantially changing the amino acids encoded by the polynucleotide sequence; d) selecting a polynucleotide sequence in which the frequency of hot and/or cold spots has been altered to the desired degree. In one aspect the frequency of hot spots can be altered by about 0% to about 25%, in another aspect, by about 25% to about 50%. In still another aspect by about 50% to about 75%, and in yet another aspect by about 75% to about 100% of all possible hot spots or cold spots.
[0394] Provided herein is a method for preparing a gene product having a desired property, comprising: (a) expressing a synthetic gene in a population of cells; wherein said population of cells express AID, or can be induced to express AID via the addition of an inducing agent; and (b) selecting a cell or cells within the population of cells which express a modified gene product having the desired property.
[0395] In another aspect of the present invention, the polynucleotide sequence can also be altered by the substitution of non preferred codons or motifs for more preferred codons or motifs.
[0396] In another aspect of the present invention, the polynucleotide sequence can also be altered by the substitution or replacement of nucleotides to further alter the frequency and or location of hot spots. In one aspect, these nucleotide substitutions can be conservative amino acid replacements, or be located in variable regions across protein families.
[0397] Provided herein is a method of optimizing a sequence for SHM by making it susceptible or resistant to SHM, comprising the steps of a) identifying a polynucleotide sequence; b) changing the codon usage in the polynucleotide sequence to alter the frequency and/or location of hot spots, or cold spots within the polynucleotide sequence and at least two parameters selected from the group of optimization factors consisting of, CpG dinucleotide frequency, the predicted formation of step-loop structures; restriction site frequency, mammalian codon usage; limiting global GC content to less than about 60%; minimizing or eliminating stretches greater than (>) 6 of same nucleotide; wherein said SHM susceptible or SHM resistant sequence exhibits altered susceptibility to SHM, and is translated into protein within a cell at a level that is equivalent to an unmodified polynucleotide sequence.
[0398] In one aspect of this method, step b) involves the alteration of at least three parameters from the group of optimization factors.
[0399] In one aspect of this method, step b) involves the alteration of at least four parameters from the group of optimization factors.
[0400] In one aspect of this method, step b) involves the alteration of at least five parameters from the group of optimization factors.
[0401] In one aspect of this method, step b) involves the alteration of at least six parameters from the group of optimization factors.
[0402] In one aspect, step b) is conducted by using a perl program SHMredesign.pl (www.PERL.COM/DOWNLOAD.CSP).
[0403] These methods can be used for generating SHM-susceptible or SHM-resistant polynucleotides of any sequence. In either case, the polynucleotide can include an open reading frame of at least 18 nucleotides, and can be operatively linked to regulatory elements to enable the polynucleotide of interest to be efficiently transcribed into RNA. The polynucleotides can be cloned using standard, art-recognized techniques into a vector. In one aspect, the vector is a vector described herein.
[0404] Non-limiting examples of polynucleotides to be modified in whole, or part, using such methods include wild-type polynucleotides, synthetic polynucleotides, recombinant polynucleotides or any portion thereof. The polynucleotide can encode a protein or polypeptide sequence.
[0405] Provided herein are SHM resistant polynucleotide sequences encoding various genes generated using the methods described herein. In one non-limiting embodiment, the gene is an enzyme involved in SHM, including without limitation, activation-induced cytidine deaminase (AID), Pol eta, and UDG made by the methods described herein.
[0406] In one embodiment, the SHM resistant polynucleotide that encodes an enzyme involved in SHM is derived from a vertebrate. In one aspect the gene is derived from a mammal, in one aspect from a mammal selected from the group consisting of rat, dog, human, mouse, cow, and primate.
[0407] In one embodiment the SHM resistant enzyme is AID having a nucleic acid sequence that is at least 90% identical to SEQ ID NO: 22.
[0408] In one embodiment, the SHM resistant gene is Pol eta having a nucleic acid sequence that is at least 90% identical to SEQ ID NO: 23.
[0409] In one embodiment, the SHM resistant gene is UDG having a nucleic acid sequence that is at least 90% identical to SEQ ID NO: 24.
[0410] In one embodiment, the cold AID is a mutant form of the enzyme which exhibits increased mutator activity. Mutant forms of AID can contain a strong nuclear import signal (NLS), a mutation that alters the activity of the nuclear export signal or both.
[0411] In one aspect, the mutated AID contains a modified nuclear export sequence made by one or more mutations independently selected at positions 180 to 198 of AID (SEQ ID NO: 311), which one or more mutations enhance mutator activity of the modified AID.
[0412] In one embodiment of the mutated AID, the modified nuclear export sequence contains one or more mutations at amino acid residue positions Leucine 181 (L181), Leucine 183 (L183), Leucine 189 (L189), Leucine 196 (L196) and/or Leucine 198 (L198). In one non-limiting example, each of the leucine residues in the nuclear export sequence can be mutated to an alanine.
[0413] In one embodiment, each of Leucines 181, 183, 189, 196 and 198 can be independently substituted with glycine, alanine, isoleucine, valine, serine, threonine, aspartate or lysine. In another embodiment, each Leucine can be independently substituted with glycine, alanine or serine. In one embodiment, the mutant protein comprises at least one, at least two, at least three or at least four mutations selected from L181A, L183A, L189A, L196A and L198A.
[0414] In one embodiment of the mutated AID, the modified nuclear export sequence comprises a mutation at one or more of amino acid residue positions aspartate 187 (D187), aspartate 188 (D188), aspartate 191 (D191) and/or threonine 195 (T195). In one non-limiting example, the modified nuclear export sequence comprises a D187E mutation. In one non-limiting example, each of the aspartate residues in the nuclear export sequence can be mutated to a glutamate. In another non-limiting example, threonine 195 can be mutated to isoleucine.
[0415] In one embodiment, each of aspartates 187, 188, and 191 can be independently substituted with serine, threonine, glutamate, asparagine or glutamine. In another embodiment, each aspartate can be independently substituted with glutamate or asparagine. In one aspect, the mutant protein comprises at least one, at least two, at least three or at least four mutations selected from D187E, D188E, D191E, T195I and L198A.
[0416] Mutated AID polypeptides can also contain a nuclear localization signal which can be N-terminal or C-terminal. In one non-limiting example, a mutated AID can contain a strong nuclear localization signal such as, but not limited to PKKKRKV (SEQ ID NO: 340). In another non-limiting example, the NLS can be a sequence conforming to the motif K-K/R-X-K/R.
[0417] In another aspect, the mutated AID contains both a strong NLS and a modified nuclear export sequence. In one non-limiting example, the modified nuclear export sequence contains one or more of the following mutations: L181A, L183A, L189A, L196A and L198A. In another non-limiting example, the modified nuclear export sequence contains one or more of the following mutations: D187E, D188E, D191E, T195I and L198A.
[0418] In any of these mutant forms of AID, the gene may be SHM resistant, SHM susceptible, or can include the appropriate optimal codon usage for expression of the AID in the host cell of choice, without regard for SHM susceptibility. When used in an expression system to target SHM to a protein of interest, the mutant form of AID can be SHM resistant.
[0419] In another embodiment, the SHM resistant gene is a selectable marker gene. In one-non-limiting embodiment the selectable marker gene is selected from the group consisting of tetracycline, ampicillin, blasticidin, puromycin, hygromycin, kanamycin DHFR neomycin, Zeocin®, thymidine kinase, hypoxanthine-guanine phosphoribosyltransferase, adenine phosphoribosyltransferase and adenosine deaminase.
[0420] In one aspect, the SHM resistant gene is the tetracycline resistance gene having a nucleic acid sequence that is at least 90% identical to SEQ ID NO: 25.
[0421] In one aspect, the SHM resistant gene is the blasticidin resistance gene having a nucleic acid sequence that is at least 90-95% identical to SEQ ID NO: 26.
[0422] In one aspect, the SHM resistant gene is the puromycin resistance gene having a nucleic acid sequence that is at least 90% identical to SEQ ID NO: 27.
[0423] In one aspect, the SHM resistant gene is the hygromycin resistance gene having a nucleic acid sequence that is at least 90% identical to SEQ ID NO: 28.
[0424] In one aspect, the SHM resistant gene is the neomycin resistance gene having a nucleic acid sequence that is at least 90% identical to SEQ ID NO: 29.
[0425] In one aspect, the SHM resistant gene is the Zeocin resistance gene having a nucleic acid sequence that is at least 90% identical to SEQ ID NO: 30.
[0426] In one aspect, the SHM resistant gene is thymidine kinase having a nucleic acid sequence that is at least 95% identical to SEQ ID NO: 31.
[0427] Also included in the present invention are optimized versions of particular genes of interest that are specifically susceptible to SHM mediated inactivation, and for which the activation of SHM can be used to selectively knock out the function of the genes. For example, the gene of interest can include one or more hot spot motifs that introduce a stop codon as a result of SHM mediated mutagenesis.
[0428] Also provided herein are SHM optimized polynucleotide sequences, or potions thereof, encoding various proteins of interest that enable improved versions of the proteins to be rapidly evolved using the SHM systems of the present invention. For example, the proteins, or portions thereof, encoded by said polynucleotides includes antibody genes that can be iteratively evolved to higher affinity, selectivity, stability or solubility.
[0429] Other exemplary polynucleotide sequences to be optimized by SHM include, but are not limited to, the following proteins toxins, growth factors, neurotransmitters, co-factors, transcription factors (e.g., zinc finger binding proteins), receptors (e.g., an Fc receptor) all of which can be evolved using the present invention. Specific, proteins of interest, and their evolution to improved forms, are discussed in detail in Section X.
[0430] B. Vector Systems
[0431] Provided herein are replicons for use in any of the SHM systems described herein to facilitate the selective modification of target nucleic acid sequences, genes, or portions thereof, while repressing the mutagenesis of structural proteins, resistance markers and other factors for SHM.
[0432] Such replicons can include at least one synthetic polynucleotide sequence that is resistant to SHM. In one aspect the replicon can include at least one unmodified, or synthetic polynucleotide sequence of interest that is designed, or contains, nucleotide sequences that are optimized for SHM. In some embodiments the replicon can include expression control sequences to enable the expression of one or more polynucleotides of interest in the mutator cell line.
[0433] Suitable replicons can be based on any known viral, or non-viral vector or an artificial chromosome. An expression system can include any combination of different replicons which can be used in sum to create a coordinated system for SHM.
[0434] In one aspect, a replicon suitable for the present invention is created by the insertion, or replacement of at least one polynucleotide sequence with a synthetic polynucleotide sequence that is resistant to SHM.
[0435] In another aspect a replicon suitable for the present invention is created by the insertion, or replacement of at least one polynucleotide sequence with a synthetic polynucleotide sequence that is optimized for SHM.
[0436] In another aspect a replicon suitable for the present invention is created by the insertion, or replacement of at least one polynucleotide sequence with a synthetic polynucleotide sequence that is optimized for SHM, and said replicon also includes at least one polynucleotide sequence with a synthetic polynucleotide sequence that is resistant to SHM. In a preferred embodiment, the replicon is capable of expression of one or more synthetic polynucleotide sequences within the mutator cell line.
[0437] Suitable, vectors can be based on any known episomal vector or integrating vector, including those described herein, known in the art, or discovered or designed in the future.
[0438] Representative commercially available viral expression vectors include, but are not limited to, the adenovirus-based systems, such as the Per.C6 system available from Crucell, Inc., lentiviral-based systems such as pLP1 from Invitrogen, and retroviral vectors such as Retroviral Vectors pFB-ERV and pCFB-EGSH from Stratagene.
[0439] An episomal expression vector is able to replicate in the host cell, and persists as an extrachromosomal episome within the host cell in the presence of appropriate selective pressure. (See for example, Conese et al., Gene Therapy 11: 1735-1742 (2004)). Representative commercially available episomal expression vectors include, but are not limited to, episomal plasmids that utilize Epstein Barr Nuclear Antigen 1 (EBNA1) and the Epstein Barr Virus (EBV) origin of replication (oriP), specific examples include the vectors pREP4, pCEP4, pREP7 from Invitrogen. The host range of EBV based vectors can be increased to virtually any eukaryotic cell type through the co-expression of EBNA1 binding protein 2 (EPB2) (Kapoor et al., EMBO. J. 20: 222-230 (2001)), vectors pcDNA3.1 from Invitrogen, and pBK-CMV from Stratagene represent non-limiting examples of an episomal vector that uses T-antigen and the SV40 origin of replication in lieu of EBNA1 and oriP.
[0440] An integrating expression vector can randomly integrate into the host cell's DNA, or can include a recombination site to enable the specific recombination between the expression vector and the host cells chromosome. Such integrating expression vectors can utilize the endogenous expression control sequences of the host cell's chromosomes to effect expression of the desired protein. Examples of vectors that integrate in a site specific manner include, for example, components of the flp-in system from Invitrogen (e.g., pcDNA®5/FRT), or the cre-lox system, such as can be found in the pExchange-6 Core Vectors from Stratagene. Examples of vectors that integrate into host cell chromosomes in a random fashion include, for example, pcDNA3.1 (when introduced in the absence of T-antigen) from Invitrogen, pCI or pFN10A (ACT) Flexi® from Promega.
[0441] Alternatively, the expression vector can be used to introduce and integrate a strong promoter or enhancer sequences into a locus in the cell so as to modulate the expression of an endogenous gene of interest (Capecchi M R. Nat Rev Genet. (2005); 6 (6):507-12; Schindehutte et al., Stem Cells (2005); 23 (1):10-5). This approach can also be used to insert an inducible promoter, such as the Tet-On promoter (U.S. Pat. Nos. 5,464,758 and 5,814,618), in to the genomic DNA of the cell so as to provide inducible expression of an endogenous gene of interest. The activating construct can also include targeting sequence(s) to enable homologous or non-homologous recombination of the activating sequence into a desired locus specific for the gene of interest (see for example, Garcia-Otin & Guillou, Front Biosci. (2006) 11:1108-36). Alternatively, an inducible recombinase system, such as the Cre-ER system, can be used to activate a transgene in the presence of 4-hydroxytamoxifen (Indra et al. Nuc. Acid. Res. (1999) 27 (22): 4324-4327; Nuc. Acid. Res. (2000) 28(23): e99; and U.S. Pat. No. 7,112,715).
[0442] Elements to be included in an expression vector are well known in the art, and any existing vector can be readily modified for use in the present invention, for example, through the insertion or replacement of one or more polynucleotide sequences with synthetic polynucleotide sequences as described above.
[0443] An expression vector of the present invention can include one or more of the following elements operatively linked together, either on a single replicon, or within multiple replicons; expression control sequences, polynucleotides comprising an open reading frame of a gene of interest, transcription termination signals, origin of replication, and selectable marker genes.
[0444] Expression vectors can also include, one or more internal ribosomal entry sites, one or more tags for ease of purification of the protein encoded by the gene of interest (e.g., VSV tag, HA tag, 6×His tag, FLAG tag), one or more reporter genes, EBNA1 (in cases where episomal replication is desired for a OriP base vector and or EBP2; T-antigen can also be used in conjunction with the SV40 on as an alternative to EBNAI plus oriP), one or more moieties for copy analysis such as portions of a gene that can be used to verify copy number of the vector relative to the host cell's chromosomal DNA, (e.g. glucose-6-phosphate dehydrogenase (hG6PDH) (or variants thereof), one or enzymes or factors for SHM, (e.g. AID, pol eta, UDG, enhancer sequences).
[0445] Expression vectors can also include anti-sense, ribozymes or siRNA polynucleotides to reduce the expression of target sequences such as, for example, to reduce the level of Pol beta (See, e.g., Sioud M, & Iversen, Curr. Drug Targets (2005) 6 (6):647-53; Sandy et al., Biotechniques (2005) 39 (2):215-24).
[0446] It may be desirable in some instances to convert a surface displayed protein into a secreted protein for further characterization. Conversion can be accomplished through the use of a specific linker that can be cleaved by incubation with a selective protease such as factor X, thrombin or any other selective proteolytic agent. It is also possible to include polynucleotide sequences that enable the genetic manipulation of the encoded protein in the vector (i.e., that allow excision of a surface attachment signal from the protein reading frame). For example, the insertion of one or more unique restriction sites, or cre/lox elements, or other recombination elements that enable the selective removal of an attachment signal and subsequent intracellular accumulation (or secretion) of the protein of interest at will. Further examples include the insertion of flanking loxP sites around an attachment signal (such as a transmembrane domain) allowing for efficient cell surface expression of a protein of interest. However, upon expression of the cre recombinase in the cell, recombination occurs between the LoxP sites resulting in the loss of the attachment signal, and thus leading to the secretion of the protein of interest.
[0447] A plasmid encoding the cre recombinase protein (open reading from synthesized by DNA2.0 and inserted into an expression vector) can be transiently transfected (or virally transduced) into a cell population of interest. Action by the expressed cre recombinase protein leads to the in situ removal of the transmembrane portion of the coding region resulting in the translation and production of a secreted form of the protein in the transfected cell population, which can then be used for further studies.
[0448] The order and number of elements can be determined by one of ordinary skill in the art.
[0449] Example 5 below provides a brief description of the vectors that could be used in any of the SHM systems provided herein.
[0450] Briefly, in one aspect, provided herein is an episomal hypermutation competent expression vector comprising: one or more origins (e.g., a prokaryotic ori, such as colE1, and one or more eukaryotic origins, such as oriP, or SV40-ori, or both oriP and SV40 ori), one or more selectable markers (e.g., an ampicillin resistance gene), one or more b-actin or G6PDH fragments or variants thereof, one or more promoters (e.g., a pCMV promoter) at least one of which drives the transcription of a gene or genes in which hypermutation is desired, one or more restriction sites for insertion of a nucleic acid sequence or gene, optionally including one or more secretion signals, attachment signals, purification tags (e.g., a hemagglutinin (HA) tag) for the gene(s) of interest, an internal ribosomal entry site (IRES), one or more puromycin genes, and one or more transcriptional termination signals. The transcriptional termination signal can include a region of 3' untranslated region, an optional intron (also referred to as intervening sequence or IVS) and one or more poly adenylation signals (p(A)). In one non-limiting example, episomal expression vectors can have the nucleic acid sequence for a fluorescent protein, inserted into the vector for SHM, to increase or decrease fluorescence or to alter wavelength of absorption or emission.
[0451] In another aspect, provided herein is an integrating expression vector comprising a recombination system, and one or more of the following elements operatively linked together; expression control sequences, polynucleotides comprising an open reading frame of a gene of interest, transcription termination signals, origin of replication, and selectable marker genes.
[0452] Expression vectors can also include, one or more internal ribosomal entry sites, one or more tags for ease of purification of the protein encoded by the gene of interest (e.g., VSV tag, HA tag, 6×His tag, FLAG tag), one or more reporter genes, one or more moieties for copy analysis, one or enzymes or factors for SHM, (e.g. AID, pol eta, UDG, Ig enhancer sequences)
[0453] In one non-limiting embodiment, the expression vector is designed to enable the insertion of a gene of interest into a genomic locus, for example an Ig gene locus.
[0454] C. Systems for Transcription and Hypermutation.
1. In Vitro Expression and Hypermutation Systems
[0455] In vitro expression and hypermutation systems include cell free systems that enable the transcription, or coupled transcription and translation of DNA templates and on-going mutagenesis via SHM. In one embodiment, such in vitro translation and hypermutation systems can be used in combination with ribosome display to enable the ongoing mutagenesis and selection of proteins.
[0456] In vitro translation systems include, for example, the classical rabbit reticulocyte system, as well as novel cell free synthesis systems, (J. Biotechnol. (2004) 110 (3) 257-63; Biotechnol Annu. Rev. (2004) 10 1-30). Systems for ribosome display are described for example in Villemagne et al., J. Imm. Meth. (2006) 313 (1-2) 140-148).
[0457] In one aspect, an in vitro hypermutation system can comprise a polynucleotide, or library of polynucleotides, that include an expression cassette for the expression of a gene of interest. The gene of interest can be a synthetic or semi-synthetic gene comprising a sequence that has been optimized for SHM. For ribosome display, the polynucleotide can lack a stop codon so that it remained attached to the ribosome after translation.
[0458] To effect transcription and or translation of the gene of interest the system would include purified or semi-purified components for in vitro transcription and translation, for example via the use of recombinant factors with purified 70S ribosomes. To enable on-going SHM, the system would further include recombinant, or purified AID and/or other factors for SHM/DNA repair. Optimized proteins would be selected via functional selection as described for surface displayed proteins, and then the associated ribosomes sequenced to determine the identity of favorable mutations.
[0459] Provided herein is an in vitro hypermutation system, comprising: a) a polynucleotide comprising a synthetic gene; b) a recombinant AID; and c) an in vitro expression system. In one aspect the synthetic gene has been optimized for SHM. The in vitro system can further comprise a polymerase to amplify nucleic acids after transcription. The in vitro system can further comprise an in vitro translation system. In one aspect, the polynucleotide is located in an expression vector such as any one of the vectors described elsewhere herein. The in vitro system can further comprise a cell population of a cell as described elsewhere herein.
[0460] Provided herein is a kit for in vitro mutagenesis, comprising: a) a recombinant AID protein; b) one or more reagents for in vitro transcription; and c) instructions for design or use of a synthetic gene. The kit can further comprise one or more reagents for in vitro translation. The kit can further comprise comprising an expression vector such as, for example, any one of the expression vectors as described herein. The kit can further comprise a cell population of a cell as described elsewhere herein.
2. Cell Expression and Hypermutation Systems
[0461] Cell based expression and hypermutation systems include any suitable prokaryotic or eukaryotic expression systems. Preferred systems are those that can be easily and reliably grown, have reasonably fast growth rates, have well characterized expression systems and can be transformed or transfected easily and efficiently.
a. Prokaryotic Expression Systems
[0462] Within these general guidelines, useful microbial hosts include, but are not limited to, bacteria from the genera Bacillus, Escherichia (such as E. coli), Pseudomonas, Streptomyces, Salmonella, Erwinia, Bacillus subtilis, Bacillus brevis, the various strains of Escherichia coli (e.g., HB101, (ATCC NO. 33694) DH5α DH10 and MC1061 (ATCC NO. 53338)).
b. Yeast
[0463] Many strains of yeast cells known to those skilled in the art are also available as host cells for the expression of polypeptides including those from the genera Hansenula, Kluyveromyces, Pichia, Rhinosporidium, Saccharomyces, and Schizosaccharomyces, and other fungi. Preferred yeast cells include, for example, Saccharomyces cerivisae and Pichia pastoris.
c. Insect Cells
[0464] Additionally, where desired, insect cell systems can be utilized in the methods of the present invention. Such systems are described, for example, by Kitts et al., Biotechniques, 14:810-817 (1993); Lucklow, Curr. Opin. Biotechnol., 4:564-572 (1993); and Lucklow et al. (J. Virol., 67:4566-4579 (1993). Preferred insect cells include Sf-9 and HI5 (Invitrogen, Carlsbad, Calif.).
d. Mammalian Expression Systems
[0465] A number of suitable mammalian host cells are also known in the art and many are available from the American Type Culture Collection (ATCC), 10801 University Boulevard, Manassas, Va. 20110-2209. Examples include, but are not limited to, mammalian cells, such as Chinese hamster ovary cells (CHO) (ATCC No. CCL61) CHO DHFR-cells (Urlaub et al., Proc. Natl. Acad. Sci. USA, 97:4216-4220 (1980)), human embryonic kidney (HEK) 293 or 293T cells (ATCC No. CRL1573), or 3T3 cells (ATCC No. CCL92). The selection of suitable mammalian host cells and methods for transformation, culture, amplification, screening and product production and purification are known in the art. Other suitable mammalian cell lines are the monkey COS-1 (ATCC No. CRL1650) and COS-7 cell lines (ATCC No. CRL1651), and the CV-1 cell line (ATCC No. CCL70). Further exemplary mammalian host cells include primate cell lines and rodent cell lines, including transformed cell lines. Normal diploid cells, cell strains derived from in vitro culture of primary tissue, as well as primary explants, are also suitable. Candidate cells can be genotypically deficient in the selection gene, or can contain a dominantly acting selection gene. Other suitable mammalian cell lines include, but are not limited to, mouse neuroblastoma N2A cells, HeLa, mouse L-929 cells, 3T3 lines derived from Swiss, Balb-c or NIH mice, BHK or HaK hamster cell lines, which are available from the ATCC. Each of these cell lines is known by and available for protein expression.
[0466] Also of interest are lymphoid, or lymphoid derived cell lines, such as a cell line of pre-B lymphocyte origin. Specific examples include without limitation RAMOS(CRL-1596), Daudi (CCL-213), EB-3 (CCL-85), DT40 (CRL-2111), 18-81 (Jack et al., PNAS (1988) δ 1581-1585), Raji cells, (CCL-86) and derivatives thereof.
[0467] For use in an SHM system, any of the vectors described herein can be co-transfected into a host cell with a separate vector containing the nucleic acid sequence of AID. In one aspect, the vectors described herein can be transfected into a host cell that contains endogenous AID. In another aspect, the vectors described herein can be co-transfected into a host cell that contains endogenous AID with a separate vector containing the nucleic acid sequence of AID such that AID is over-expressed in the cell. In yet another aspect, the vectors described herein can be modified to include the sequence of AID for transfection into a host cell that does, or does not, contain endogenous AID. In a preferred embodiment the AID is a synthetic AID that comprises a polynucleotide sequence that is SHM resistant.
[0468] In one embodiment, the SHM system comprises one or more of the following selected from among: i) at least one polynucleotide that comprises either a polynucleotide that has been altered in whole or part, from wild type polynucleotide to positively influence the rate of SHM experienced by that polynucleotide, or a polynucleotide that has a naturally high percentage of hot spots prior to any modification; and ii) at least one component of the expression system comprises a polynucleotide that has been altered in whole or part, to negatively influence the rate of SHM.
[0469] In one aspect, the SHM system comprises one or more polynucleotides that have been altered from wild-type to negatively influence the rate of SHM. The polynucleotides can encode, for example, one or more of factors for SHM (e.g. AID, Pol eta, UDG), one or more selectable marker genes, or one or more reporter genes.
[0470] In another aspect, the SHM system comprises one or more polynucleotides that have been altered in whole, or part, from wild-type to positively influence the rate of SHM. The polynucleotide can be, for example, a polynucleotide of interest encoding an enzyme, receptor, transcription factor, structural protein, toxin, co-factor, specific binding protein of interest.
[0471] In yet another aspect, the SHM system comprises a polynucleotide having an intrinsically high rate of SHM such as, for example, a polynucleotide of interest encoding an immunoglobulin heavy chain or an immunoglobulin light chain, or a hypervariable region of an antibody gene.
[0472] An SHM system as described herein can further comprise one or more of the following additional elements selected from among: i) an inducible system to regulate the expression of AID, or AID homolog, one or more Ig enhancers, iii) one or more E-boxes, iv) one or more auxiliary factors for SHM, v) one or more factors for stable episomal expression, such as EBNA1, EBP2 or ori-P, vi) one or more selectable marker genes, one or more secondary vectors containing the gene for AID and vii) a combination thereof.
[0473] In one aspect, the system includes two polynucleotides of interest in which both polynucleotides are located in proximity to a promoter, and expressed and co-evolved in the same cell simultaneously. In one embodiment, the promoter is a bi-directional promoter such as a bi-directional CMV promoter. In another embodiment, the two polynucleotides of interest are placed in front of two uni-directional promoters. The two promoters can be the same promoter or different promoters. The two polynucleotides of interest can be in the same vector or on different vectors.
[0474] Following recombinant introduction of one or more polynucleotides of interest into an expression vector, the vector can be amplified, purified, introduced into a host cell using standard transfection techniques and characterized using standard molecular biological techniques. Purified plasmid DNA can be introduced into a host cell using standard transfection/transformation techniques and the resulting transformants/transfectants grown in appropriate medium containing antibiotics, selectable agents and/or activation/transactivator signals (e.g. inducible agents such as doxycycline) to induce expression of the polynucleotides of interest. If the host cell endogenously expresses AID, the vector containing the one or more polynucleotides of interest can be introduced alone into the host cell. Alternatively, if the cell does not endogenously express AID, then the AID gene, or more preferably, a synthetic AID gene that is more resistant to SHM than wild-type can be transfected into the host cell. Thus, AID expression can be achieved by either using the same, or a different expression vector, as described above for the polynucleotide of interest.
[0475] Enhancers (e.g., Ig enhancers) can be inserted into a vector to increase expression, and/or targeting of SHM to the polynucleotide of interest.
[0476] If an inducible system is used, such as the Tet-controlled system, doxycycline can be added to the medium to induce expression of the polynucleotide of interest, or AID for a period of time (e.g., 1 hour (hr), 2 hrs, 4 hrs, 6 hrs, 8 hrs, 10 hrs, 15 hrs, 20 hrs, 24 hrs or any other time) prior to analysis by an appropriate assay. The cells can be allowed to grow for a certain time to provide for on-going diversification, for example, for 1-3 cell generations, or in certain cases 3-6 generations, or in some cases 6 to 10 generations, or longer.
[0477] Cells can be iteratively grown, assayed and selected as described herein to selectively enrich those cells that express a polynucleotide of interest exhibiting a desired property. Suitable assay and enrichment strategies (e.g., fluorescent activated cell sorting (FACS); affinity separation, enzyme activity, toxicity, receptor binding, growth stimulation, etc.) are described below.
[0478] Once a population of cells has been obtained that is of interest, the polynucleotides of interest can be rescued and the corresponding mutations sequenced and identified. For example, total mRNA, or extrachromosal plasmid DNA can be amplified by co-expression of SV40 T antigen (J. Virol. (1988) 62 (10) 3738-3746) and/or can be extracted from cells and used as a template for polymerase chain reaction (PCR) or reverse transcriptase (RT)-PCR to clone the modified polynucleotide using appropriate primers. Mutant polynucleotides can be sub-cloned into a vector and expressed in E. coli. A tag (e.g., His-6 tag) can be added to the carboxy terminus to facilitate protein purification using chromatography.
X. Proteins of Interest
[0479] As used herein, the term "proteins of interest" relates to proteins, or portions thereof, for which it is desired that the polynucleotide encoding the protein is optimized for SMH by AID in order to rapidly create, select and identify improved variants of that protein. Such optimized polynucleotide can be made more susceptible to SHM as a result of codon usage, thereby inducing amino acid changes when the polynucleotide is subjected to AID, and screened for improved function. Conversely, such optimized polynucleotide can be made more resistant to SHM, thereby decreasing amino acid changes when the polynucleotide is subjected to AID as a result of codon usage, and screened for improved function.
[0480] It should be understood however that the present invention also includes compositions and methods that relate to polynucleotide sequences that encode proteins that are resistant to SHM, or comprise codons that can be converted to stop codons. Such synthetic genes confer certain advantages in the present invention and are specifically disclosed, for example, in Section IX.
[0481] Any protein for which the amino acid, or corresponding nucleotide sequence is known, or available (e.g. can be cloned into a vector of the present invention) and a phenotype or function can be improved is a candidate for use in the vectors and SHM systems provided herein. Proteins of interest include, for example, surface proteins, intracellular proteins, membrane proteins and secreted proteins from any unmodified or synthetic source. Exemplary, but non-limiting types of proteins for use in the vectors and SHM systems provided herein include an antibody heavy chain or portion thereof, an antibody light chain or portion thereof, an enzyme, a receptor, a structural protein, a co-factor, a polypeptide, a peptide, an intrabody, a selectable marker, a toxin, growth factor, peptide hormone, and any other protein which can be optimized, is intended to be included.
[0482] Biologically active proteins (molecules) also include molecules capable of modulating the pharmacokinetics and/or pharmacodynamics of other biologically active proteins (molecules), for example, lipids and polymers such as polyamines, polyamides, polyethylene glycol and other polyethers. For example, polypeptides are those such as, for example, VEGF, VEGF receptor, Diptheria toxin subunit A, B. pertussis toxin, CC chemokines (e.g., CCL1-CCL28), CXC chemokines (e.g., CXCL1-CXCL16), C chemokines (e.g., XCL1 and XCL2) and CX3C chemokines (e.g., CX3CL1), IFN-gamma, IFN-alpha, IFN-beta, TNF-alpha, TNF-beta, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-10, IL-12, IL-13, IL-15, TGF-beta, TGF-alpha, GM-CSF, G-CSF, M-CSF, TPO, EPO, human growth factor, fibroblast growth factor, nuclear co-factors, Jak and Stat family members, G-protein signaling molecules such as chemokine receptors, JNK, Fos-Jun, NF-κB, I-KB, CD40, CD4, CD8, B7, CD28 and CTLA-4.
[0483] Additionally, there are a variety of other component nucleotide sequences, such as coding sequences and genetic elements that can make up the core system that one would, in some embodiments, prefer not to hypermutate to maintain overall system integrity. These component nucleotide sequences include without limitation, i) selectable markers such as neomycin, blasticidin, ampicillin, etc; ii) reporter genes (e.g. fluorescent proteins, epitope tags, reporter enzymes); iii) genetic regulatory signals, e.g. promoters, inducible systems, enhancer sequences, IRES sequences, transcription or translational terminators, kozak sequences, splice sites: origin of replication, repressors; iv) enzymes or accessory factors used for high level enhanced SHM, or it's regulation, or measurement, such as AID, pol eta, transcription factors, and MSH2; v) signal transduction components (kinases, receptors, transcription factors) and vi) domains or sub domains of proteins such as nuclear localization signals, transmembrane domains, catalytic domains, protein-protein interaction domains, and other protein family conserved motifs, domains and sub-domains.
[0484] One could, based on the present application, select a protein of interest as a suitable candidate for optimization, and devise a suitable assay to monitor the desired trait of the protein of interest.
[0485] Depending on the nature of the protein of interest, and amount of information available on the protein of interest, a practioner can follow any combination of the following strategies prior to mutagenesis to create the optimized polynucleotide.
[0486] 1. No optimization: Although it can be desirable to enhance the number of hot spots within the polynucleotide sequence encoding a protein of interest, it should be noted that any unmodified protein is expected to undergo a certain amount of SHM, and can be used in the present invention without optimization, or any specific knowledge of the actual sequence. Additionally certain proteins, for example antibodies, naturally comprise polynucleotide sequences which have evolved suitable codon usage, and do not require codon modification. Alternatively, it can be desirable to enhance the number of cold spots within the polynucleotide sequence encoding a protein of interest (e.g., framework regions of antibodies or fragments thereof).
[0487] 2. Global Hot spot optimization: In some aspects, the number of hotspots in a polynucleotide encoding a protein can be increased, as described herein. This approach can be applied to the entire coding region of the gene, thereby rendering the entire protein more susceptible to SHM. As discussed herein, this approach can be preferred if relatively little is known about structure activity relationships within the protein, or between related protein isotypes.
[0488] 3. Selective hot spot modification: Alternatively, as discussed herein, a polynucleotide sequence encoding the protein of interest can be selectively, and or systematically modified through the targeted replacement of regions of interest with synthetic variable regions, which provide for a high density of hot spots and seed maximal diversity through SHM at specific loci.
[0489] One of ordinary skill in the art would understand, based on the teaching provided herein, that any or all of the above approaches can be undertaken using the present invention. Approaches relating to global hot spot optimization, and selective hot spot modification, are however likely to lead to faster and more efficient optimization of protein function.
[0490] Following the design of an optimized polynucleotide encoding the protein of interest, it can be synthesized using standard methodology and sequenced to confirm correct synthesis. Once the sequence of the polynucleotide has been confirmed, the polynucleotide can be inserted into a vector of the present invention, and the vector then introduced into a host cell as described herein to effect mutagenesis.
[0491] Once introduced into a suitable host cell, cells can be induced to express AID, and/or other factors to initiate SHM, thereby inducing on-going sequence diversification of the protein of interest. After an appropriate period of time, (e.g., 2-10 cell divisions) the resulting host cells, including variants of the protein of interest can be screened and improved mutants identified and separated for the cell population. This process can be iteratively repeated to selectively improve the properties of the protein of interest.
[0492] A cell-surface displayed protein can be created through the creation of a chimeric molecule of a protein of interest coupled in frame to a suitable transmembrane domain. In the case of mammalian cell expression, for example, a MHC type 1 transmembrane domain such as that from H2kk (including peri-transmembrane domain, transmembrane domain, and cytoplasmic domain; NCBI Gene Accession number AK153419) can be used. Likewise the surface expression of proteins in prokaryotic cells (such as E. coli and Staphylococcus) insect cells, and yeast is well established in the art. For reviews, see for example Winter, G. et al., Arum. Rev. Immunol. (1994) 12:433-55; Pluckthun, A., (1991) Bio/Technology 9: 545-551; Gunneriusson et al., (1996) J. Bacteriol 78 1341-1346; Ghiasi et al., (1991) Virology 185 187-194; Boder and Wittrup, (1997) Nat. Biotechnol. 15 553-557; and Mazor et al., (2007) Nat. Biotech. 25(5) 563-565.
[0493] Surface displayed antibodies or proteins can be created through the secretion and then binding (or association) of the secreted protein on the cell surface. Conjugation of the antibody or protein to the cell membrane can occur either during protein synthesis or after the protein has been secreted from the cell. Conjugation can occur via covalent linkage, by binding interactions (e.g., mediated by specific binding members) or a combination of covalent and non-covalent linkage.
[0494] In yet another aspect, proteins can be coupled to a cell through the creation of an antibody or binding protein fusion protein comprising a first specific binding member that specifically binds to a target of interest fused to a second binding member specific for display on a cell surface (e.g., in the case of exploiting the binding of protein A and a Fc domain: protein A is expressed on and attached to a cell surface and binds to, and localizes, a secreted antibody (or a protein of interest expressed as an Fc fusion protein)).
[0495] Transfection of appropriate expression vectors containing the corresponding polynucleotide sequences into suitable mutator positive cells can be performed using any art recognized or known transfection protocol. An exemplary surface expressed library of proteins is described in Examples 4 and 5 of priority U.S. Application Nos. 60/904,622 and 61/020,124.
[0496] Cells expressing a plurality of antibodies or binding proteins from the transfections above can, optionally, be characterized to select cells expressing specific ranges of surface expression of the protein on the cell surface using conventional assays including, but not limited to, FACS.
[0497] Staining of light and heavy chain expression can be accomplished, for example, by using commercially available fluorescein Isothiocyanate (FITC) or R-Phycoerythrin (R-PE) conjugated rat anti-mouse Ig, kappa light chain, and FITC or R-PE conjugated rat anti-mouse Ig G1 monoclonal antibodies (BD Pharmingen). Staining can be performed using the manufacture's suggested protocols, usually via incubation of the test cells in the presence of labeled antibody for 30 minutes on ice. Expression levels of cellular antigen expression can be quantified using Spherotech rainbow calibration particles (Spherotech, IL).
[0498] Transfected, cell populations exhibiting specific ranges of expression can be selected. For example, cells with a surface copy number of greater than about 10,000, about 50,000, about 100,000, or about 500,000 proteins per cell can be selected, and can then be used for efficient affinity profiling.
[0499] Populations of stably transfected cells can be created via, for example, growth for 2 to 3 weeks in the presence of appropriate selectable agents; the resulting cell library can be frozen and stored as a cell bank. Alternatively, cells can be transiently transfected and used within a few days of transfection.
[0500] It may be desirable in some instances to convert a surface displayed protein into a secreted protein for further characterization. Conversion can be accomplished through the use of a specific linker that can be cleaved by incubation with a selective protease such as factor X, thrombin or any other selective proteolytic agent. It is also possible to include polynucleotide sequences that enable the genetic manipulation of the encoded protein in the vector (i.e., that allow excision of a surface attachment signal from the protein reading frame). For example, the insertion of one or more unique restriction sites, or cre/lox elements, or other recombination elements that enable the selective removal of an attachment signal and subsequent intracellular accumulation (or secretion) of the protein of interest at will. Further examples include the insertion of flanking loxP sites around an attachment signal (such as a transmembrane domain) allowing for efficient cell surface expression of a protein of interest. However, upon expression of the cre recombinase in the cell, recombination occurs between the LoxP sites resulting in the loss of the attachment signal, and thus leading to the secretion of the protein of interest.
[0501] Once a polypeptide has been optimized to a determined degree, the cell or population of cells expressing an optimized polypeptide of interest can be isolated or enriched and the phenotype (function) of the optimized polypeptide can be assayed using art-recognized assays.
[0502] Cells can then be re-grown, SHM re-induced, and re-screened over a number of cycles to effect iterative improvements in the desired function. At any point, the polynucleotide sequence encoding the protein of interest can be rescued and/or sequenced to monitor on-going mutagenesis.
[0503] For example, episomal plasmid DNA can be extracted (or amplified by co-expression with SV40 T Antigen (J. Virol. (1988) 62 (10) 3738-3746)) and then extracted and amplified by PCR using DNA primers that are specific for the polynucleotide or interest or flanking regions, using standard methodology. Alternatively, total RNA can be isolated from various cell populations that have been isolated by flow cytometry or magnetic beads; episomal DNA and/or total RNA and can be amplified by RT-PCR using primers that are specific for the polynucleotide or interest or flanking regions using standard methodology. Clones can be sequenced using automated DNA sequences from companies such as Applied Biosystems (ABI-377 or ABI 3730 DNA sequencers). Sequences can be analyzed for frequency of nucleotide insertions and deletions compared to the starting sequence.
[0504] A. Antibodies and Fragments Thereof
[0505] With respect to antibodies, the present invention provides the ability to bypass the need for immunization in vivo to select antibodies that bind to key surface epitopes that are aligned with producing the most robust biological effects on target protein function. Additionally, mammalian antibodies intrinsically process optimal codon usage patterns for targeted SHM, greatly simplifying template design strategies. For certain antigens, in vivo immunization leads to epitope selection that does not impact target function, thereby hindering the selection of potent and efficacious antibody candidates. In still other embodiments, the present invention can provide for the rapid evolution of site-directed antibodies that have potent activity by nature of the role of that epitope in determining target protein function. This provides the ability to scan target proteins for optimal epitope position and produce best in class antibodies drugs for use in the clinic.
[0506] As described herein, all naturally occurring germline, affinity matured, synthetic, or semi-synthetic antibodies, as well as fragments thereof, may be used in the present invention. In general, such antibodies can be altered through SHM to improve one or more of the following functional traits: affinity, avidity, selectivity, thermostability, proteolytic stability, solubility, folding, immunotoxicity and expression. Depending upon the antibody format, antibody libraries can comprise separate heavy chain and light chain libraries which can be co-expressed in a host cell. In certain embodiments, full length antibodies can be secreted, and/or surface displayed at the plasma membrane of the host cell. In still other embodiments, heavy and light chain libraries can be inserted in to the same expression vector, or different expression vectors to enable simultaneous co-evolution of both antibody chains.
[0507] In one embodiment, increasing the hotspot density in specific sub domains of antibodies or fragments thereof (e.g., F(ab')2, Fab', Fab, Fv, scFv, dsFv, dAb or a single chain binding polypeptide) can result in an improvement in a characteristic such as one or more of increased binding affinity, increased binding avidity and/or decreased non-specific binding. In another embodiment, the use of synthetic antibodies with increased hotspots in the constant domain (e.g., Fc) can result in increased binding affinity for an Fc receptor (FcR), thereby modulating signal cascades. Heavy chains and light chains, or portions thereof, can be simultaneously modified using the procedures described herein.
[0508] Intrabodies used in the methods provided herein can be modified to improve or enhance folding of the heavy and/or light chain in the reducing environment of the cytoplasm. Alternatively, or in addition, a sFv intrabody can be modified to stabilize frameworks that could fold properly in the absence of intradomain disulfide bonds. Intrabodies can also be modified to increase, for example, one or more of the following characteristics: binding affinity, binding avidity, epitope accessibility, competition with endogenous proteins for the target epitope, half-life, target sequestration, post-translational modification of the target protein, etc. Because intrabodies act within the cell, their activity is more analogous to assay methodologies for enzyme activity assays, which are discussed below in section B.
[0509] Polynucleotide Identification and Design
[0510] Methods for designing and creating targeted antibody libraries, as well as methods for identifying optimal epitopes that provide for the selection of antibodies with superior selectivity, cross species reactivity, and blocking activity are known in the art and described herein. Such methods are disclosed in sections IV and V of the present specification, as well as commonly owned priority U.S. Patent Application Nos. 60/904,622 and 61/020,124.
[0511] Screening Methodology
[0512] Specific screens to detect and select surface exposed or secreted antibodies with improved traits, are well known in the art, and are described in detail in section XI. Such screens can involve several rounds of selection based on the simultaneous selection of multiple parameters, for example, affinity, avidity, selectivity and thermostability in order to evolve the overall best antibody.
[0513] Once an antibody or fragment thereof has been optimized using SHM, the phenotype/function of the optimized antibody or fragment thereof can be further analyzed using art-recognized assays. Assays for antibodies or fragments thereof include, but are not limited to enzyme-linked immunosorbant assays (ELISA), enzyme-linked immunosorbent spot (ELISPOT assay), gel detection and fluorescent detection of mutated IgH chains, Scatchard analysis, BIACOR analysis, western blots, polyacrylamide gel (PAGE) analysis, radioimmunoassays, etc. which can determine binding affinity, binding avidity, etc. Such assays are more fully described in Section XI below.
[0514] Once optimized antibodies have been identified, episomal DNA can be extracted (or amplified by co-expression with SV40 T Antigen (J. Virol. (1988) 62 (10) 3738-3746)) and then extracted and subjected to PCR using variable heavy chain (VH) leader region and/or variable light chain (VL) leader region specific sense primers and isotype specific anti-sense primers. Alternatively, total RNA from selected sorted cell populations can be isolated subjected to RT-PCR using variable heavy chain (VH) leader region and/or variable light chain (VL) leader region specific sense primers and isotype specific anti-sense primers. Clones can be sequenced using standard methodologies and the resulting sequences can be analyzed for frequency of nucleotide insertions and deletions, receptor revision and V gene selection. The resulting data can be used to populate a database linking specific amino acid substitutions with changes in one or more of the desired properties. Such databases can then be used to recombine favorable mutations or to design next generation polynucleotide library with targeted diversity in newly identified regions of interest, e.g. nucleic acid sequences which encode a functional portion of a protein.
[0515] B. Enzymes
[0516] Enzymes and pro-enzymes present another category of polypeptides which can be readily improved, and for which SHM is useful. Of particular interest is the application of the present invention to the co-evolution of multiple enzymatic pathways, involving the simultaneous mutation of two or more enzymes. Enzymes and enzyme systems of particular note include, for example, enzymes associated with microbiological fermentation, metabolic pathway engineering, protein manufacture, bio-remediation, and plant growth and development.
[0517] Specific high throughput screening systems to measure, select and evolve enzymes with improved traits, are well known in the art, and are outlined in Section XI. Such screens can involve several rounds of selection based on the simultaneous selection of multiple parameters, for example, pH stability, Km, Kcat, thermostability, solubility, proteolytic stability, substrate specificity, co-factor dependency, and tendency for hetero or homo dimerization.
[0518] Polynucleotide Identification and Design
[0519] As described previously, the starting point for mutagenesis is either a cDNA clone of the gene of interest, or it's amino acid or polynucleotide sequence. To maximize the effectiveness of SHM, the starting polynucleotide sequence can be modified to maximize the density of hot spots and to reduce the density of cold spots. Such methods are disclosed in sections IV and V of the present specification, as well as commonly owned priority U.S. Patent Application Nos. 60/904,622 and 61/020,124.
[0520] If particular regions of interest have been defined in the protein or proteins of interest, these areas can be targeted with preferred hot spot motifs, alternatively a scanning approach can be used to systematically insert hot spot motifs throughout the reading frame of the enzyme or enzymes of interest, as described previously.
[0521] For the co-evolution of a particular enzymatic pathway involving multiple enzymes, a particular advantage of the present invention is the ability to co-evolve all the enzymes simultaneously with a single cell. This approach exploits the ability to identify mutations that only confer an advantage to the overall system when all of the members of the system are present. For example, mutations that induce heterodimerization between enzymes involved in consecutive enzymatic reactions.
[0522] Screening Methodology
[0523] Many high throughput screening approaches are well known in the art and can be readily applied to identify and select improved enzymes (see, e.g., Olsen et al., Methods. Mol. Biol. (2003) 230: 329-349; Turner, Trends Biotechnol. (2003) 21 (11): 474-478; Zhao et al., Curr. Opin. Biotechnol. (2002) 13 (2): 104-110; and Mastrobattista et al., Chem. Biol. (2005) 12 (12): 1291-300). The screening modality used can depend on the nature of the enzyme and whether the enzyme of interest is intracellular, or extracellular, and further whether it is membrane associated or freely secreted.
[0524] Initial screens that provide useful quantitative information over a wide dynamic window, and which have a high screening capacity, are preferred. Representative screening approaches include, for example, assays based on the altered ability, or speed of growth of improved cells, and/or based on the sorting of cells using a flow cytometer. FACS based approaches can detect the presence of intracellular fluorogenic reaction products or altered reporter gene expression, and specific protocols for the FACS based optimization of enzyme activity are reviewed in the following references; Farinas et al., Comb. Chem. High Throughput Screen (2006) 9(4): 321-8; Becker et al., Curr. Opin. Biotechnol. (2004) 15(4): 323-9; Daugherty et al., J. Immunol. Methods (2000) 243 (1-2): 211-227.
[0525] Once an enzyme or set of enzymes has been optimized using SHM, a complete biochemical analysis of the optimized enzyme(s) can be further analyzed using art-recognized assays. Additionally as previously discussed, once optimized enzymes have been identified, episomal DNA can be extracted or amplified by co-expression with SV40 T Antigen (J. Virol. (1988) 62 (10) 3738-3746), then extracted and subjected to PCR using specific primers. Alternatively, total RNA can be obtained from selected cell populations and subjected to RT-PCR using specific primers. Clones can be sequenced using standard methodologies and the resulting sequences can be analyzed for the frequency of nucleotide mutations. The resulting data can be used to populate a database linking specific amino acid substitutions with changes in one or more of the desired properties. Such databases may then be used to recombine favorable mutations, or to design next generation polynucleotide library with targeted diversity in newly identified regions of interest, e.g. nucleic acid sequences which encode a functional portions of a protein.
[0526] C. Receptors
[0527] Receptors bind ligands and encompass a broad genus of unmodified and synthetic polypeptides encoding specific binding members, including, but not limited to, cell-bound receptors such as antibodies (B cell receptors), T cell receptors, Fc receptors, G-coupled protein receptors, cytokine receptors, carbohydrate receptors, and Avimer® based receptors.
[0528] In one embodiment, such receptors can be altered through SHM to improve one or more of the following traits; affinity, avidity, selectivity, thermostability, proteolytic stability, solubility, dimerization, folding, immunotoxicity, coupling to signal transduction cascades and expression.
[0529] Polynucleotide Identification and Design
[0530] As described previously, the starting point for mutagenesis can be either a cDNA clone of the gene of interest, or its amino acid or polynucleotide sequence. To maximize the effectiveness of SHM, the starting polynucleotide sequence can be modified to maximize the density of hot spots and to reduce the density of cold spots. Such methods are disclosed in sections IV and V of the present specification.
[0531] Such receptors possess clearly defined domains that can be either targeted for mutagenesis through the use of SHM optimized sequences, or conserved during mutagenesis through the use of SHM resistant sequences. Domains (regions) targeted for mutagenesis include, but are not limited to, sites of post-translational modification, surface exposed loop domains, positions of variation between species, protein-protein interaction domains, and binding domains. Domains (regions) conserved during mutagenesis include transmembrane domains, invariant amino acid positions, signal sequences, and intracellular trafficking domains. Alternatively, a scanning approach can be used to systematically insert hot spot motifs throughout the reading frame of the receptor of interest, as described previously.
[0532] Screening Methodology
[0533] Many high throughput screening approaches are well known in the art and can be readily applied to identify and select improved receptors. Representative screening approaches include, for example, binding assays, growth assays, reporter gene assays and FACS based assays.
[0534] Once an enzyme or set of enzymes has been optimized using SHM, a complete pharmacological analysis of the optimized receptor can be further analyzed using art-recognized assays. Additionally as previously discussed, once an optimized receptor has been identified, episomal DNA can be extracted or amplified by co-expression with SV40 T Antigen (J. Virol. (1988) 62 (10) 3738-3746), then extracted and subjected to PCR using specific primers. Alternatively, total RNA can be obtained from selected cell populations and subjected to RT-PCR using specific primers. Clones can be sequenced using standard methodologies and the resulting sequences can be analyzed for the frequency of nucleotide mutations. The resulting data can be used to populate a database linking specific amino acid substitutions with changes in one or more of the desired properties. Such databases may then be used to recombine favorable mutations or to design next generation polynucleotide library with targeted diversity in newly identified regions of interest, e.g., nucleic acid sequences which encodes functional portions of a protein.
XI. Screening and Enrichment Systems
[0535] Polypeptides generated by the expression of the synthetic libraries, semi-synthetic libraries, or seed libraries of polynucleotides described herein can be screened for improved phenotype using a variety of standard physiological, pharmacological and biochemical procedures. Such assays include for example, biochemical assays such as binding assays, fluorescence polarization assays, solubility assays, folding assays, thermostability assays, proteolytic stability assays, and enzyme activity assays (see generally Glickman et al., J. Biomolecular Screening, 7 No. 1 3-10 (2002); Salazar et al., Methods. Mol. Biol. 230 85-97 (2003)), as well as a range of cell based assays including signal transduction, motility, whole cell binding, flow cytometry and fluorescent activated cell sorting (FACS) based assays. Cells expressing polypeptide of interest encoded by a synthetic or semi-synthetic library as described herein can be enriched any art-recognized assay including, but not limited to, methods of coupling peptides to microparticles.
[0536] Many FACS and high throughput screening systems are commercially available (see, e.g., Zymark Corp., Hopkinton, Mass.; Air Technical Industries, Mentor, Ohio; Beckman Instruments Inc., Fullerton, Calif.; Precision Systems, Inc., Natick, Mass.) that enable these assays to be run in a high throughput mode. These systems typically automate entire procedures, including all sample and reagent pipetting, liquid dispensing timed incubations, and final readings of the microplate in detector(s) appropriate for the assay. These configurable systems provide high throughput and rapid start up as well as a high degree of flexibility and customization. The manufacturers of such systems provide detailed protocols for various high throughput systems. Thus, for example, Zymark Corp. provides technical bulletins describing screening systems for detecting the modulation of gene transcription, ligand binding, and the like.
A. Cell-based Methods to Measure Activities.
[0537] 1. Signal Transduction Based Assays
[0538] Proteins such as, for example, growth factors, enzymes, receptors and antibodies can influence signal transduction within a cell or cell population, and thereby influence transcriptional activity that can be detected using a reporter gene assay. Such modulators can behave functionally as full or partial agonists, full or partial antagonists, or full or partial inverse agonists.
[0539] Thus in one assay format, signal transduction assays can be based on the use of cells comprising a reporter gene whose expression is directly or indirectly regulated by the protein of interest, which can be measured by a variety of standard procedures.
[0540] Reporter plasmids can be constructed using standard molecular biological techniques by placing cDNA encoding for the reporter gene downstream from a suitable minimal promoter (that is, any sequence that supports transcription initiation in eukaryotic cells) that sits 5' to the coding sequence of the reporter gene. A minimal promoter can be derived from a viral source such as, for example: SV40 early or late promoters, cytomegalovirus (CMV) immediate early promoters, or Rous Sarcoma Virus (RSV) early promoters; or from eukaryotic cell promoters, for example, beta actin promoter (Ng, Nuc. Acid Res. 17:601-615, 1989; Quitsche et al., J. Biol. Chem. 264:9539-9545, 1989), GADPH promoter (Alexander, M. C. et al., Proc. Nat. Acad. Sci. USA 85:5092-5096, 1988, Ercolani, L. et al., J. Biol. Chem. 263:15335-15341, 1988), TK-1 (thymidine kinase) promoter, HSP (heat shock protein) promoters, or any eukaryotic promoter containing a TATA box.
[0541] A reporter plasmid also typically includes an element 5' to the minimal promoter that contains a consensus recognition sequence, usually repeated 2 to 7 times in a concatenate, to the appropriate branch of the signal transduction pathway for which monitoring is desired. Examples include, but are not limited to: cyclic AMP response elements (CRE, which responds to changes in intracellular cAMP concentrations, available from Stratagene in phagemid vector pCRE-Luc, Cat. No. 219076), serum response elements (SRE, Stratagene phagemid vector pSRE-Luc. Cat. No. 219080), nuclear factor B response elements (NF-kB, Stratagene phagemid vector pNFKB-Luc Cat. No. 219078), activator protein 1 response elements (AP-1, Stratagene phagemid vector pAP-1-Luc, Cat. No. 219074), serum response factor response elements (Stratagene phagemid vector pSRF-Luc, Cat. No. 219082), or p53 binding sites.
[0542] Numerous reporter gene systems are known in the art and include, for example, alkaline phosphatase Berger, J., et al. (1988) Gene 66 1-10; Kain, S. R. (1997) Methods. Mol. Biol. 63 49-60), β-galactosidase (See, U.S. Pat. No. 5,070,012, issued Dec. 3, 1991 to Nolan et al., and Bronstein, I., et al., (1989) J. Chemilum. Biolum. 4 99-111), chloramphenicol acetyltransferase (See Gorman et al., Mol Cell Biol. (1982) 2 1044-51), β-glucuronidase, peroxidase, beta-lactamase (U.S. Pat. Nos. 5,741,657 and 5,955,604), catalytic antibodies, luciferases (U.S. Pat. Nos. 5,221,623; 5,683,888; 5,674,713; 5,650,289; 5,843,746) and naturally fluorescent proteins (Tsien, R. Y. (1998) Annu. Rev. Biochem. 67 509-44).
[0543] Alternatively, intermediate signal transduction events that are proximal to gene regulation can also be observed, such as, by measuring fluorescent signals from reporter molecules that respond to intracellular changes including, but not limited to, fluctuations in calcium concentration due to release from intracellular stores, alterations in membrane potential or pH, increases in inositol triphosphate (IP3) or cAMP concentrations, or release of arachidonic acid.
[0544] As used herein, agonists refer to modulators that stimulate signal transduction and can be measured using various combinations of the construct elements listed above. As used herein, partial agonists refer to modulators able to stimulate signal transduction to a level greater than background, but less than 100% as compared to a full agonist. A superagonist is able to stimulate signal transduction to greater than 100% as compared to a full agonist reference standard.
[0545] As used herein, antagonists refer to modulators that have no influence on signal transduction on their own, but are able to inhibit agonist- (or partial agonist-) induced signaling. As used herein, partial antagonists refer to modulators that have no influence on signal transduction on their own, but are able to inhibit agonist- (or partial agonist-) induced signaling to an extent that is measurable, but less than 100%.
[0546] As used herein, inverse agonists refer to modulators that are able to inhibit agonist- (or partial agonist-) induced signaling, and are also able to inhibit signal transduction when added alone.
[0547] 2. Motility Assays
[0548] Agonistic activity on several categories of cell surface molecules (e.g., GPCR's such as chemokine receptors, histamine H4, cannabinoid receptors, etc.) can lead to cell movements. Thus, partial or full agonist or antagonist activities of test molecules can be monitored via effects on cell motility, such as in chemotaxis assays (Ghosh et al., (2006) J Med. Chem. May 4; 49(9):2669-2672), chemokinesis (Gillian et al., (2004) ASSAY and Drug Development Technologies. 2(5): 465-472) or haptotaxis (Hintermann et al., (2005) J. Biol. Chem. 280(9): 8004-8015).
[0549] 3. Whole Cell Binding Assays
[0550] Binding assays that utilize receptors, membrane associated antibodies, and cell surface proteins can be performed using whole cells (as opposed to membrane preparations) in order to monitor activity or binding selectivity of proteins of interest. Such assays can also be used to directly select desired cell populations via the use of FACS. (Fitzgerald et al., (1998) J Pharmacol Exp Ther. 1998 November; 287(2):448-456; Baker, (2005) Br J. Pharmacol. February; 144(3):317-22)
[0551] A large number of fluorescently tagged compounds are available to perform whole cell binding assays. In addition, specific peptides can be readily labeled in order to profile the binding affinity and selectivity of membrane associated antibodies. In general peptides can be conjugated to a wide variety of fluorescent dyes, quenchers and haptens such as fluorescein, R-phycoerythrin, and biotin. Conjugation can occur either during peptide synthesis or after the peptide has been synthesized and purified.
[0552] Biotin is a small (244 kilodaltons) vitamin that binds with high affinity to avidin and streptavidin proteins and can be conjugated to most peptides without altering their biological activities. Biotin-labeled peptides are easily purified from unlabeled peptides using immobilized streptavidin and avidin affinity gels, and streptavidin or avidin-conjugated probes can be used to detect biotinylated peptides in, for example, ELISA, dot blot or Western blot applications.
[0553] N-hydroxysuccinimide esters of biotin are the most commonly used type of biotinylation agent. N-hydroxysuccinimide-activated biotins react efficiently with primary amino groups in physiological buffers to form stable amide bonds. Peptides have primary amines at the N-terminus and can also have several primary amines in the side chain of lysine residues that are available as targets for labeling with N-hydroxysuccinimide-activated biotin reagents. Several different N-hydroxysuccinimide esters of biotin are available, with varying properties and spacer arm length (Pierce, Rockford, Ill.). The sulfo-N-hydroxysuccinimide ester reagents are water soluble, enabling reactions to be performed in the absence of organic solvents.
[0554] Alternatively, peptides can be conjugated with R-Phycoerythrin, a red fluorescent protein. R-Phycoerythrin is a phycobiliprotein isolated from marine algae. There are several properties that make R-Phycoerythrin ideal for labeling peptides, including an absorbance spectra that includes a wide range of potential excitation wavelengths, solubility in aqueous buffers and low nonspecific binding. R-Phycoerythrin also has a high fluorescence quantum yield (0.82 at 578 nanometers) that is temperature and pH independent over a broad range. Conjugating peptides with R-Phycoerythrin can be accomplished using art-recognized techniques described in, for example, Glazer, A N and Stryer L. (1984). Phycofluor probes. Trends Biochem. Sci. 9:423-7; Kronick, M N and Grossman, P D (1983) Immunoassay techniques with fluorescent phycobiliprotein conjugates. Clin. Chem. 29:1582-6; Lanier, L L and Loken, M R (1984) Human lymphocyte subpopulations identified by using three-color immunofluorescence and flow cytometry analysis: Correlation of Leu-2, Leu-3, Leu-7, and Leu-11 cell surface antigen expression. J. Immunol., 132:151-156; Parks, D R et al. (1984) Three-color immunofluorescence analysis of mouse B-lymphocyte subpopulations. Cytometry 5:159-68; Hardy, R R et al. (1983) demonstration of B-cell maturation in X-linked immunodeficient mice by simultaneous three-color immunofluorescence. Nature 306:270-2; Hardy R R et al. (1984) J. Exp. Med. 159:1169-88; and Kronick, M N (1986) The use of phycobiliproteins as fluorescent labels in immunoassay. J. Immuno. Meth. 92:1-13.
[0555] A number of cross-linkers can be used to produce phycobiliprotein conjugates including, but not limited to, N-Succinimidyl 3-[2-pyridyldithio]-propionamido, (Succinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate, or (Sulfosuccinimidyl 6-(3-[pyridyldithio]-propianamido)hexanoate. Such cross-linkers react with surface-exposed primary amines of the phycobiliprotein and create pyridyldisulfide group(s) that can be reacted with peptides that contain either free sulfhydryl groups or primary amines.
[0556] Another option is to label peptides with fluorescein isothiocyanate (molecular weight 389). The isothiocyanate group on the fluorescein will cross-link with amino, sulfhydryl, imidazoyl, tyrosyl or carbonyl groups on peptides, but generally only derivatives of primary and secondary amines yield stable products. Fluorescein isothiocyanate has an excitation and emission wavelengths at 494 and 520 nanometers respectively and a molar extinction coefficient of 72,0000 M-1 cm-1 in an aqueous buffer at pH 8 (Der-Balian G, Kameda, N. and Rowley, G. (1988) Fluorescein labeling of Fab while preserving single thiol. Anal. Biochem. 173:59-63).
[0557] 4. Whole Cell Activity Assays
[0558] Many proteins, including enzymes, intrabodies and receptors can be directly assayed within a living cell, or when surface displayed on the surface. Typically for successful FACS based screening a fluorescent or fluorogenic membrane permeant substrate is required, many such reagents are commercially available, for example from Molecular Probes (Invitrogen, CA). An increase in enzyme activity typically results in increased production of a fluorescent product that is trapped within the cell resulting in cells with more fluorescence which can be separated from less fluorescent cells, for example by FACS. Additionally many high throughput microplate screens exist for screening of protein libraries that exploit virtually any existing assay of enzymatic activity, see generally, Geddie, et al., Meth. Enzymol. 388 134-145 (2004).
[0559] 5. Cell Growth Assays
[0560] The expression, or activity of a variety of proteins such as, for example, growth factors, enzymes, receptors and antibodies can influence the rate of growth of a host cell which be exploited either as an assay, or as a means of separating improved proteins.
[0561] Thus in one assay format, cells can be diluted to a limiting dilution and cells which grow more rapidly detected and selected. In one aspect such growth based assays can involve the ability to grow in the presence of a new substrate for which an improved enzymatic pathway of metabolism is required, for example a new carbon source. In another embodiment, growth assays can involve selection in the presence of a toxin, where a de-activation mechanism for the toxin is required. In another case, growth can be desired in response to the presence of a specific ligand, where high affinity binding of the ligand is required.
B. Selection and Enrichment Strategies
[0562] 1. Flow Cytometry and FACS
[0563] Flow cytometry and the related flow sorting (also known as fluorescence activated cell sorting, or FACS) are methods by which individual cells can be quantitatively assayed for the presence of a specific component or component variant based upon staining with a fluorescent reporter. Flow cytometry provides quantitative, real time analysis of living cells, and can achieve efficient cell sorting rates of 50,000 cells/second, and is capable of selecting individual cells or defined populations. Many commercial FACS systems are available, for example BD Biosciences (CA), Cytopeia (Seattle, Wash.) Dako Cytomation (Australia).
[0564] A FACS can be equipped with a variety of lasers, which can produce a wide range of available wavelengths for multiple parameter analysis, and for use with different fluorophores. Classically the water cooled ion lasers using argon, krypton, or a mix of both can produce several specific lines; 408 nm, 568 nm, and 647 nm for example are major emission lines for Krypton; 488 nm, 457 nm, and others are argon lines. These lasers require high voltage multiphase power and cooling water, but can produce high power outputs. Additionally tunable and non tunable diode lasers exist, for example a 408 nm line can be stably created via a light emitting diode (LED) and this can be easily added to a sorter. Additionally dye lasers can be used to further extend the range of available wavelengths available for FACS analysis.
[0565] During FACS analysis, cells are stained with the specific reporter and then hydrodynamically focused into a single cell steam for interrogation with a laser which excites the fluorescent moiety. Fluorescent emission is detected through a wavelength restricted optical pathway and converted to numeric data correlated to an individual cell. In the case of flow sorting, predefined subsets of emission criteria can be met and the cells of interest diverted into a collection receptacle for further use by electrostatic repulsion or mechanical action (Herzenberg L A, Sweet R G, Herzenberg L A: Fluorescence activated cell sorting, Sci Amer 234(3):108, March 1976).
[0566] FACS based approaches are compatible with signal transduction based assays, activity based assays, and binding assays, and with a wide variety of proteins of interest, including for example, antibodies, receptors, enzymes and any surface displayed protein. FACS can be efficiently applied to most mammalian, yeast and bacterial cells, as well as fluorescently tagged beads.
[0567] In one embodiment, FACS can be used to screen a library of cells expressing surface displayed proteins (e.g., surface displayed antibodies) that are undergoing, or have undergone, SHM mediated diversity. In this approach, a cell surface displayed library is used and the displayed proteins are first incubated with fluorescently tagged antigen in solution. The FACS instrument is able to separate the high affinity protein members of the library, which have greater fluorescence intensity, from the lower affinity members. The use of optimized binding protocols in conjunction with FACS based selection has been shown to be capable of evolving antibodies with up to femtomolar affinities, See, e.g., Boder et al. PNAS, (2000) 97: 10701-10705; Boder et al., (2000) Meth. Enzymol. (2000) 328: 430-444; VanAntwerp et al., Biotechnol. Prog. (2000) 16: 31-37).
[0568] In order to effectively select and rapidly evolve, the antibodies and binding proteins which have high affinity to an antigen of interest, protocols can be established that can facilitate the isolation of antibodies with a broad range of affinities to the antigens of interest, and yet eliminate proteins that bind to labeling or coupling reagents. These protocols involve both a progression in the stringency of the cell population selected, and a decrease in the concentration and density of the target antigen presented to the cells.
[0569] With respect to the stringency or fraction of the total cell population collected during each round of selection, initial screens will generally use relatively low discrimination factors in order to capture as many proteins as possible that possess small incremental improvements in binding characteristics. For example, a typical initial sort may capture the top 10%, top 5% or top 2% of all cells that bind a target. Large improvements in affinity may be the result of combinations of mutations, each of which contribute small additive effects to overall affinity. (Hawkins et al., (1993) J. Mol. Biol. 234: 958-964). Therefore, recovery of all library clones with even marginally improved affinities (2-3 fold) is desirable during the early stages of library screening, and sorting gates can be optimized to recover as many clones as possible with minimum sacrifice in enrichment.
[0570] These selected cells can subsequently be allowed to recover and grown using standard culture conditions for a number of days until the population has reached a reasonable number to allow for a subsequent round of FACS sorting, analysis, mutagenesis, cell banking, or to determine sequence information. As discussed below, subsequent rounds of selection to identify higher affinity binders can be achieved by progressively decreasing the density and concentration of labeled binding peptide used in the preincubation steps prior to FACS analysis.
[0571] Following a successful first round of sorting, the collected cells can be re-grown to amplify the population and then resorted. At this, and subsequent stages of sorting, greater enrichments are possible since more copies of each desirable clone are present within the examined cell population. For example only about the top 1%, top 0.5%, top 0.2%, or top 0.1% of the cells in the population may be selected in order to identify significantly improved clones. With respect to establishing optimal binding and selection strategies, first generation hits, including germline antibodies, typically have low affinities and relatively rapid off rates. For example, Sagawa et al. (Mol. Immunology, 39: 801-808 (2003)) observed that the apparent affinity for germline Abs is typically in the range of 2×104 to 5×106M-1, but that this affinity increases to around 109M-1 during affinity maturation (i.e., an effect that is mediated primarily by decreasing the off rate (Koff)).
[0572] The binding characteristics of weak binding antibodies may slow the screening of early generation, non-optimized libraries because specific, but low affinity binding antibodies typically have rapid off rates and tend therefore tend to be lost during wash steps. Loss of these specific binders may result in the isolation of antibodies that bind non-specifically to components used in the selection process (Cumbers et al., Nat. Biotechnol. 2002 November; 20(11): 1129-113).
[0573] To maximize the selection of proteins with relatively low affinities (i.e., having a Kd greater than about 500 nM), binding interactions are stabilized to prevent the dissociation of binding peptides during the screening process, and include appropriate blocking reagents to eliminate binding to coupling reagents and support matrices. To achieve this goal, initial screens should use fluorescently tagged beads loaded with a high density of antigens to exploit avidity effects, based on the use of multiple binding interactions to increase the binding strength of low affinity interactions, while also including pre-incubations with coupling and labeling reagents such as streptavidin, avidin, and naked beads etc., to eliminate non-specific binding (see generally, Aggarwal et al., (2006) Bioconjugate Chem. 17 335-340; Wrighton et al., (1996) Science 273 458-64; Terskikh et al. (1997) PNAS 94 1663-8; Cwirla et al., (1997) Science 276 1696-9; and Wang et al. (2004) J. Immunological methods 294 23-35).
[0574] By careful control of bead loading density, washing and pre-incubation conditions it has been demonstrated that even such low affinity binding interactions can be reproducibly monitored, (Werthen et al., (1993) BBA-326-332). Importantly these improvements to binding efficiency have been demonstrated to occur without any significant increase in non-specific reactivity (Giordano et al., (2001) Nat. Med. 7 1249-53). As discussed above, selections generally will also be based on using a relatively low stringency cut off during FACS to ensure that all of these weak binding library members are selected.
[0575] To further eliminate non-specific members of the library (i.e., those that bind to the beads, or coupling reagents, rather than the binding peptides), the resultant cell populations are screened directly with either polymeric binding peptide or intact polymeric antigen using distinct coupling reagents (e.g., via the use of biotinylated antigen coupled to streptavidin-fluorophore conjugate to form an antigen-streptavidin fluorescent complex). Coupling or labeling of the binding peptide to biotin or fluorophores can be achieved using standard, art-recognized protocols, as described herein and in the Examples.
[0576] Streptavidin binds biotin with femtomolar affinity and forms tetramers in physiological conditions, thereby generating a tetravalent complex when preincubated with singly biotinylated antigen (which is subsequently termed a streptavidin microaggregate as described below). Streptavidin pre-loading can increase the effective antigen concentration up to 500-fold, and is useful for isolating weak antigen binders that bind specifically to the antigen. Employment of streptavidin microaggregates is useful for isolating antibodies ranging in affinity from very weak to moderate (Kd greater than about 200 nM) affinities. Furthermore, biotinylated epitopes can be pre-reacted with streptavidin-fluorophore at room temperature for 10 to 15 minutes in order to create microaggregates prior to contacting cell populations. The microaggregates are subsequently allowed to contact cells simultaneously for 15 to 30 minutes prior to addition of secondary reagents, such as anti-human IgG-fluorophore conjugates. In one experimental approach, cells are centrifuged at 1500×g for 5 minutes and resuspended in a small volume (typically 500 μL to 1 mL) of DAPI (PBS, 1% BSA, 2 μg/mL DAPI). In a second approach termed "homogeneous assay conditions," cells are resuspended directly in DAPI into which antigen-streptavidin microaggregate and goat-anti-human IgG-fluorophore are added. This second approach is particularly desirable for more weakly interacting antibodies (Kd greater than about 200 nM), where minimizing dissociation time may be more relevant.
[0577] At higher affinities (with Kd>10 nM, but less than about 100 nM), libraries are more easily screened directly for improved affinity by incubating the library with monomeric binding peptide or full length target protein under equilibrium binding conditions at a concentration of binding peptide that is ideally less than the Kd of the starting (wild type) interaction (apparent Kds can be readily determined by a series of analytical FACS experiments conducted with a range of antigen concentrations, ahead of a sort). Under these conditions, cells that possess antibodies and binding proteins with higher affinities will possess significantly more fluorescently labeled binding peptide than weaker binders, allowing the most fluorescent cells in the population to be easily selected for further optimization. Typically, FACS sorting gates can be established that select about the top 0.5% to about 0.1% of cells. In one non-limiting method, about the top 0.2% of cells are selected.
[0578] As recognized by Boder and Wittrup (Biotechnol. Prog. (1998) 14 55-62), the screening of very high affinity protein-ligand interactions (Kd<10 nM) can be accomplished by screening for decreased off-rate rather than directly for affinity. In this approach, cells are labeled to saturation with fluorescent binding peptide, followed by addition of an excess of non-fluorescent ligand. Cell associated fluorescence decays exponentially with time approaching a background level and the dissociation reaction is stopped after a fixed duration, usually by extensive dilution with cold buffer. The duration of the competition reaction determines the difference in observed fluorescence for different library clones and, thus, determines the range of kinetic improvements likely to be selected from the library. For a competitive dissociation reaction, the presence of excess non-fluorescent ligand can yield an effective forward reaction rate of zero. Mean fluorescence intensity at a given time after the initiation of the competition reaction is a function of the off-rate (Koff). (VanAntwerp & Wittrup (2000) Biotechnol. Prog. 16 31-37; Boder et al. (2000) PNAS 97 10701-10705; and Foote and Eisen (2000) PNAS 97 10679-10681). Cells in the population that express antibodies with improved affinities and more stable binding can be systematically identified by progressively increasing the length of time for the competition reaction, and then selecting the most fluorescent cells remaining in the population for further optimization.
[0579] Under these conditions, cells that possess surface displayed antibodies and binding proteins with higher affinities will exhibit significantly more bead or streptavidin-biotinylated antigen microaggregate binding compared to cells that express proteins with little or no binding. The most fluorescently labeled cells (displaying proteins with the highest affinity) can then be separated from the rest of the cells in the population using standard FACS sorting protocols, as described, for example, in Example 9.
[0580] Once a selected cell population has been created that expresses a protein that exhibits reproducible binding to a binding peptide, it can be characterized with two or more intact proteins to confirm that the antibodies or binding proteins exhibit the desired pattern of cross-reactivity and/or specificity (e.g., to both mouse and human variants of the protein of interest), or to two different members of a related gene family, but not to an unrelated, or more distantly related, protein.
[0581] In one embodiment, this can be accomplished using multi-parameter FACS using two or more proteins species labeled with two differently colored detectable tags (e.g., FITC and phycoerythrin) which can be simultaneously analyzed in a flow cytometer. Using this approach, it is possible to identify cells that display binding to only one protein, or are capable of binding to both proteins. The population of cells that exhibits the required dual specific binding can be selected by the FACS operator based upon the number of cells sorted and the percentage of cells identified that exhibit polyspecificity. As described previously, these selected cells can subsequently be allowed to recover and grown using standard culture conditions for a number of days until the population has reached a reasonable number to enable either a subsequent round of FACS sorting, analysis, cell banking, or to determine sequence information.
[0582] Selected binders from the library can be further characterized as described herein, and the sequence of the antibody or binding protein determined after PCR of cellular DNA, RT-PCR of RNA isolated from the selected cell population, or episome rescue.
[0583] Candidate antibodies and binding proteins can be iteratively subjected to rounds of hypermutation and selection in order to evolve populations of cells expressing antibodies or binding proteins with enhanced binding properties as described herein. Cells that preferentially and/or selectively bind to the binding peptide with a higher affinity are selected and allowed to expand. If needed, another round of mutagenesis is repeated and, again, cells that exhibit improved, selective, and high affinity binding, are retained for further propagation and growth. The new improved variants obtained can be further characterized as described herein, and the sequence of the heavy and light chains determined after RT-PCR or episome rescue.
[0584] Mutations that are identified in the first one, two or three rounds of hypermutation/selection can be recombined combinatorially into a set of new templates within the original parental backbone context, and all, or a subset of the resulting templates, can be subsequently transfected into cells which are then selected by FACS sorting. The best combination(s) of mutations are thus isolated and identified, and either used in a subsequent round of hypermutation/selection, or if the newly identified template(s) demonstrate sufficiently potent affinity, are used instead in experiments for further functional characterization.
[0585] In another embodiment, FACS can be used to screen a library of cells expressing intracellular proteins that are undergoing, or have undergone, SHM mediated diversity creation. In this approach, a membrane permeable fluorogenic, or florescent reagent is used and first pre-incubated with the library of cells to allow uptake and conversion of the reagent. The FACS instrument is able to separate the high activity protein members of the library, which are able to convert a greater percentage of the reagent and are more fluorescent than cells comprising lower activity members. (See, e.g., Farinas, Comb. Chem. High Throughput Screen. (2006) 9: (4) 321-328).
[0586] Fluorescent moieties to be detected include, but are not limited to, compounds such as fluorescein (commonly called FITC), phycobiliproteins such as phycoerythrin (PE) and allophycocyanin (APC) (Kronick, M. N. J. Imm. Meth. 92:1-13 (1986)), fluorescent semiconductor nanocrystals such as Quantum dot (QDot) bioconjugates for ultrasensitive nonisotopic detection (Chan W C, Nie S. Science 281: 2016-8 (1998)), and coumarin derivatives such as Fluorescent Acylating Agents derived from 7-Hydroxycoumarin.
[0587] Fluorescence can also reported from fluorescent proteins such as Teal Fluorescent Protein (TFP), from chemical stains of cellular components such as DAPI bound to DNA, from fluorescent moieties covalently conjugated to antibodies that recognize cellular products, from fluorescent moieties covalently conjugated to ligands of cellular receptors, and from fluorescent moieties covalently conjugated to substrates of cellular enzymes.
[0588] Cells stained with membrane impermeant reporters, such as antibodies, can be sorted for subsequent processing to recover components such as genes, episomes, or proteins of interest. Cells stained for surface expression components or stained with cell membrane permeant reporters can also be sorted intact for propagation.
[0589] 2. Affinity Separation
[0590] Affinity separation based on the use microparticles enables the separation of surface displayed proteins based on affinity to a specific compound or sequence of interest. This approach is rapid, can easily be scaled up, and can be used iteratively with living cells.
[0591] Paramagnetic polystyrene microparticles are commercially available (Spherotech, Inc., Libertyville, Ill.; Invitrogen, Carlsbad, Calif.) that couple compounds or peptides to microparticle surfaces that have been modified with functional groups or coated with various antibodies or ligands such as, for example, avidin, streptavidin or biotin.
[0592] In one aspect paramagnetic beads can be used in which the paramagnetic property of microparticles allows them to be separated from solution using a magnet. The microparticles can be easily re-suspended when removed from the magnet thereby enabling the selective separation of cells that find to the attached probe.
[0593] In one embodiment, peptides can be coupled to paramagnetic polystyrene microparticles coated with a polyurethane layer in a tube. The hydroxyl groups on the microparticle surface are activated by reaction with p-toluensulphonyl chloride (Nilsson K and Mosbach K. "p-Toluenesulfonyl chloride as an activating agent of agarose for the preparation of immobilized affinity ligands and proteins." Eur. J. Biochem. 1980:112: 397-402). The resulting sulphonyl ester can subsequently react covalently with peptide amino or sulfhydryl groups. The peptides are quickly absorbed onto the surface of the activated microparticles followed by the formation of covalent amine bonds with further incubation. The microparticles (2'' microparticles/milliliter) are washed two times by placing the tube containing 1 milliliter (ml) of microparticles on a magnet, allowing the microparticles to migrate to the magnet side of the tube, removing the supernatant, and re-suspending the microparticles in 1 ml of 100 millimolar (mM) borate buffer, pH 9.5. After washing, the microparticles are re-suspended in 100 mM borate buffer, pH 9.5 at a concentration of 109 microparticles/ml. Eleven nanomoles of peptide are added to the microparticles and the microparticle/peptide mixture is vortexed for 1 minute to mix. The microparticles are incubated with peptides at room temperature for at least 48 hours with slow tilt rotation. To ensure an optimal orientation of the peptide on the microparticles, bovine serum albumin (BSA) is added to the microparticle/peptide mixture to a final concentration of 0.1% (weight/volume) after incubation has proceeded for 10 minutes. After incubation, the tube containing the microparticle/peptide mixture is placed on the magnet until the microparticles migrate to the magnet side of the tube. The supernatant is removed and the microparticles are washed four times with 1 ml phosphate buffered saline solution (PBS), pH 7.2 containing 1% (weight/volume) BSA. Finally, the microparticles are re-suspended in 1 ml PBS solution, pH 7.2 containing 1% (weight/volume) BSA.
[0594] Alternatively, paramagnetic polystyrene microparticles containing surface carboxylic acid can be activated with a carbodiimide followed by coupling to a peptide, resulting in a stable amide bond between a primary amino group of the peptide and the carboxylic acid groups on the surface of the microparticles (Nakajima N and Ikade Y, Mechanism of amide formation by carbodiimide for bioconjugation in aqueous media, Bioconjugate Chem. 1995, 6(1), 123-130; Gilles M A, Hudson A Q and Borders C L Jr, Stability of water-soluble carbodiimides in aqueous solution, Anal Biochem. 1990 Feb. 1; 184(2):244-248; Sehgal D and Vijay 11C, a method for the high efficiency of water-soluble carbodiimide-mediated amidation, Anal Biochem. 1994 April; 218(1):87-91; Szajani B et al, Effects of carbodiimide structure on the immobilization of enzymes, Appl Biochem Biotechnol. 1991 August; 30(2):225-231). The microparticles (2 microparticles/milliliter) are washed twice with 1 ml of 25 mM 2-[N-morpholino]ethane sulfonic acid, pH 5 for 10 minutes with slow tilt rotation at room temperature. The washed microparticles are re-suspended in 700 microliters (μL) 25 mM 2-[N-morpholino]ethane sulfonic acid, pH 5 followed by the addition of 21 nanomoles of peptide re-suspended in 25 mM 2-[N-morpholino]ethane sulfonic acid, pH 5 to the microparticle solution. The microparticle/peptide mixture is mixed by vortexing and incubated with slow tilt rotation for 30 minutes at room temperature. After this first incubation, 300 μL of ice-cold 100 milligram (mg)/mL 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide hydrochloride re-suspended in 25 mM 2-[N-morpholino]ethane sulfonic acid, pH 5 is added to the peptide/microparticle mixture and incubated overnight at 4° Celsius with slow tilt rotation. The peptide-coupled microparticles are washed four times with 1 ml 50 mM Tris pH 7.4/0.1% BSA for 15 minutes at room temperature with slow tilt rotation. After washing, the peptide-coupled microparticles are re-suspended at a concentration of 19 microparticles/ml in PBS solution, pH 7.2 containing 1% (weight/volume) BSA.
[0595] Another option is to couple biotinylated peptides to paramagnetic polystyrene microparticles whose surfaces have been covalently linked with a monolayer of streptavidin. Briefly, one ml of the streptavidin microparticles are transferred to a microcentrifuge tube and washed four times by placing the tube on a magnet and allowing the microparticles to collect on the magnet side of the tube. The solution is then removed and the microparticles are gently re-suspended in 1 ml of PBS solution, pH 7.2 containing 1% (weight/volume) BSA. After the final wash, the microparticles are re-suspended in 1 ml of PBS solution, pH 7.2 containing 1% (weight/volume) BSA; and 33 picomoles of biotinylated peptide are added to the microparticle solution. The microparticle/peptide solution is incubated for 30 minutes at room temperature with slow tilt rotation. After coupling, the unbound biotinylated peptide is removed from the microparticles by washing four times with PBS solution, pH 7.2 containing 1% (weight/volume) BSA. After the final wash, the microparticle/peptide mixture is re-suspended to a final bead concentration of 19 microparticles/ml. (Argarana C E, Kuntz I D, Birken S, Axel R, Cantor C R. Molecular cloning and nucleotide sequence of the streptavidin gene. Nucleic Acids Res. 1986; 14(4):1871-82; Pahler A, Hendrickson W A, Gawinowicz Kolks M A, Aragana C E, Cantor C R. Characterization and crystallization of core streptavidin. Biol Chem 1987:262(29):13933-7)
[0596] The identification, selection and use of specific peptide sequences for use in the present inventions is disclosed in commonly owned priority application No. 60/995,970 (Attorney docket no. 33547-708.101), filed Sep. 28, 2007.
XII. Databases
[0597] The invention includes methods of producing computer-readable databases comprising the sequence and identified mutations of certain proteins, including, but not limited to, sequences of binding domains, or active sites, as well as their binding characteristics, activity, stability characteristics and three-dimensional molecular structure. Specifically included in the present invention is the use of such a database to aid in the design and optimization of a protein of interest, based on a database of mutations created from the protein of interest, or related proteins or portions thereof.
[0598] In other embodiments, the databases of the present invention can comprise mutations of a protein or proteins that have been identified by screening to bind to a specific target, or other representations of such proteins such as, for example, a graphic representation or a name.
[0599] By "database" is meant a collection of retrievable data. The invention encompasses machine readable media embedded with or containing information regarding the amino acid and nucleic structure of a protein or proteins, such as, for example, its sequence, structure, and the activity or binding activity, as described herein. Such information can pertain to subunits, domains, and/or portions thereof such as, for example, portions comprising active sites, accessory binding sites, and/or binding pockets in either liganded (bound) or unliganded (unbound) forms.
[0600] Alternatively, the information can be that of identifiers which represent specific structures found in a protein. As used herein, "machine readable medium" refers to any medium that can be read and accessed directly by a computer or scanner. Such media can take many forms, including but not limited to, non-volatile, volatile and transmission media. Non-volatile media, i.e., media that can retain information in the absence of power, includes a ROM. Volatile media, i.e., media that cannot retain information in the absence of power, includes a main memory.
[0601] Transmission media includes coaxial cables, copper wire and fiber optics, including the wires that comprise the bus. Transmission media can also take the form of carrier waves; i.e., electromagnetic waves that can be modulated, as in frequency, amplitude or phase, to transmit information signals. Additionally, transmission media can take the form of acoustic or light waves, such as those generated during radio wave and infrared data communications.
[0602] Such media also include, but are not limited to: magnetic storage media, such as floppy discs, flexible discs, hard disc storage medium and magnetic tape; optical storage media such as optical discs or CD-ROM; electrical storage media such as RAM or ROM, PROM (i.e., programmable read only memory), EPROM (i.e., erasable programmable read only memory), including FLASH-EPROM, any other memory chip or cartridge, carrier waves, or any other medium from which a processor can retrieve information, and hybrids of these categories such as magnetic/optical storage media. Such media further include paper on which is recorded a representation of the amino acid or polynucleotide sequence, that can be read by a scanning device and converted into a format readily accessed by a computer or by any of the software programs described herein by, for example, optical character recognition (OCR) software. Such media also include physical media with patterns of holes, such as, for example, punch cards and paper tape.
[0603] Specifically included in the present invention is the transmission of data from the data base via transmission media to third party site to aid in the design and optimization of a protein of interest.
[0604] A variety of data storage structures are available for creating a computer readable medium having recorded thereon the amino acid or polynucleotide sequences of the invention or portions thereof and/or activity data. The choice of the data storage structure can be based on the means chosen to access the stored information. All format representations of the amino acid or polynucleotide sequences described herein, or portions thereof, are contemplated by the present invention. By providing computer readable medium having stored thereon the sequences of the invention, one can routinely access the SHM mediated changes in amino acid or polynucleotide sequence and related information for use in modeling and design programs, to create improved proteins.
[0605] A computer can be used to display the sequence of the protein or peptide structures, or portions thereof, such as, for example, portions comprising active sites, accessory binding sites, and/or binding pockets, in either liganded or unliganded form, of the present invention. The term "computer" includes, but is not limited to, mainframe computers, personal computers, portable laptop computers, and personal data assistants ("PDAs") which can store data and independently run one or more applications, i.e., programs. The computer can include, for example, a machine readable storage medium of the present invention, a working memory for storing instructions for processing the machine-readable data encoded in the machine readable storage medium, a central processing unit operably coupled to the working memory and to the machine readable storage medium for processing the machine readable information, and a display operably coupled to the central processing unit for displaying the structure coordinates or the three-dimensional representation.
[0606] The computers of the present invention can also include, for example, a central processing unit, a working memory which can be, for example, random-access memory (RAM) or "core memory," mass storage memory (for example, one or more disk drives or CD-ROM drives), one or more cathode-ray tube ("CRT") display terminals or one or more LCD displays, one or more keyboards, one or more input lines, and one or more output lines, all of which are interconnected by a conventional bi-directional system bus. Machine-readable data of the present invention can be inputted and/or outputted through a modem or modems connected by a telephone line or a dedicated data line (either of which can include, for example, wireless modes of communication). The input hardware can also (or instead) comprise CD-ROM drives or disk drives. Other examples of input devices are a keyboard, a mouse, a trackball, a finger pad, or cursor direction keys. Output hardware can also be implemented by conventional devices. For example, output hardware can include a CRT, or any other display terminal, a printer, or a disk drive. The CPU coordinates the use of the various input and output devices, coordinates data accesses from mass storage and accesses to and from working memory, and determines the order of data processing steps. The computer can use various software programs to process the data of the present invention. Examples of many of these types of software are discussed throughout the present application.
EXAMPLES
[0607] Elements of the present application are illustrated by the following examples, which should not be construed as limiting in any way.
Example 1
Creation of Synthetic Polynucleotides Encoding Blasticidin
[0608] By decreasing the likelihood of somatic hypermutation in a vector element, such as a selectable marker, an enzyme involved in SHM, or a reporter gene, the vector and system for exerting and tracking SHM becomes more stable, thereby enabling somatic hypermutation to be more effectively targeted to a polynucleotide of interest.
[0609] A. Polynucleotide Design
[0610] In general, sequences are engineered for SHM using the teaching described herein, and as elaborated in sections III and IV. In the following examples, the sequence optimization is based on the hot spot and cold spot motifs listed in Table 7, and using the computer program SHMredesign.pl as described above.
[0611] Using this program, every position within the sequence is annotated with either a `+`, `-`, or `.` symbol to designate whether it is desired to obtain a hotter, colder, or neutral changes in SHM susceptibility at that specific position. Where `+` designates a hot spot, `-` cold spot, and `.` a neutral position. For example, the following input sequence for blasticidin is used to identify SHM resistant versions at every position of the blasticidin gene.
TABLE-US-00012 (SEQ ID NO: 26) >ATGGCCAAGCCTTTGTCTCAAGAAGAATCCACCCTCATTGAAAGAGCAA CGGCTACAATCAACAGCATCCCCATCTCTGAAGACTACAGCGTCGCCAGC GCAGCTCTCTCTAGCGACGGCCGCATCTTCACTGGTGTCAATGTATATCA TTTTACTGGGGGACCTTGCGCAGAACTCGTGGTGCTGGGCACTGCTGCTG CTGCGGCAGCTGGCAACCTGACTTGTATCGTCGCGATCGGAAATGAGAAC AGGGGCATCTTGAGCCCCTGCGGACGGTGCCGACAGGTTCTTCTCGATCT GCATCCTGGGATCAAAGCCATAGTGAAGGACAGTGATGGACAGCCGACGG CAGTTGGGATTCGTGAATTGCTGCCCTCTGGTTATGTGTG GGAGGGCTAA <------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- --------------------------------------------------
[0612] By comparison, the following input file, is used to identify hotter versions of the blasticidin gene that are more susceptible to SHM at every position of the gene.
TABLE-US-00013 (SEQ ID NO: 26) >ATGGCCAAGCCTTTGTCTCAAGAAGAATCCACCCTCATTGAAAGAGCAA CGGCTACAATCAACAGCATCCCCATCTCTGAAGACTACAGCGTCGCCAGC GCAGCTCTCTCTAGCGACGGCCGCATCTTCACTGGTGTCAATGTATATCA TTTTACTGGGGGACCTTGCGCAGAACTCGTGGTGCTGGGCACTGCTGCT GCTGCGGCAGCTGGCAACCTGACTTGTATCGTCGCGATCGGAAATGAGAA CAGGGGCATCTTGAGCCCCTGCGGACGGTGCCGACAGGTTCTTCTCGATC TGCATCCTGGGATCAAAGCCATAGTGAAGGACAGTGATGGACAGCCGACG GCAGTTGGGATTCGTGAATTGCTGCCCTCTGGTTATGTGTGGGAGGGC TAA <++++++++++++++++++++++++++++++++++++++++++++ ++++++++++++++++++++++++++++++++++++++++++++++ ++++++++++++++++++++++++++++++++++++++++++++++ ++++++++++++++++++++++++++++++++++++++++++++++ ++++++++++++++++++++++++++++++++++++++++++++++++ +++++++++++++++++++++++++++++++++++++++++++++++++ ++++++++++++++++++++++++++++++++++++++++++++++++ ++++++++++++++++++++++++++++++++++++++++++++++++++ ++++++++++++++++++++++
[0613] As described previously, during this process, all nucleotide sequences over a 9 base region consistent with the wild type protein's amino acid sequence are enumerated and scored for the number of hot spot motifs, cold spot motifs, CpG motifs, codon usage, and stretches of the same nucleotide. The program then determines whether it is possible to replace any random sequence with either a hotter, colder, or neutral polynucleotide tile.
[0614] As shown in FIG. 7, this approach, as applied to canine AID quickly, (within a few hundred tile substitutions), converges to identify a cold optimized canine AID new sequence, which differs from the original sequence through the substitution 15-20% of the nucleotide sequence. The majority of changes occur early in the iterative cycle and are usually complete after about 500 iterations. As one might expect, larger genes require a larger number of iterations to reach a fully optimized sequence. Routinely the use of 2000 to 3000 iterations is more than sufficient for the majority of genes.
[0615] Analysis of a number of unmodified genes at random demonstrates that most mammalian genes use codons that create on average about 9 to 15 cold spots per 100 nucleotides, and with a median density of about 13.8 cold spots/100 nucleotides, and have a hot spot density of between about 7 to 13 hot spots per 100 nucleotides, with a median density of about 8.3 hot spots per 100 nucleotides.
[0616] The initial starting sequence, as well as the frequency of hot spots, cold spots and CpGs for the unmodified, blasticidin gene are shown in FIG. 8.
1. Cold Blasticidin
[0617] An optimized sequence for a SHM resistant (cold) version of blasticidin created using this approach is shown in FIG. 9, together with the resulting changes in frequency of hot spots and cold spots. Optimization of the blasticidin sequence to make the sequence more resistant to somatic hypermutation resulted in an increase of 188% in number of cold spots (an increase of 73), and reduced the number of hot spots by 57% (a decrease of 15). Overall the frequency of cold spots increased to an average density of about 28 cold spots per 100 nucleotides from an initial density of about 15 cold spots per 100 nucleotides, and the overall frequency of hot spots decreased from about 9 hot spots per 100 nucleotides, in the unmodified gene to about 5 hot spots per 100 nucleotides in the SHM resistant form.
2. Hot Blasticidin
[0618] An optimized sequence for a SHM susceptible version of blasticidin created using this approach is shown in FIG. 10, together with the resulting changes in frequency of hot spots and cold spots. Optimization of the blasticidin sequence to make the sequence more susceptible to somatic hypermutation resulted in an increase of about 197% in number of hot spots (an increase of 34), and reduced the number of cold spots by about 56% (a decrease of 26). Overall the frequency of hot spots increased to an average density of about 17 hot spots per 100 nucleotides from an initial density of about 9 hot spots per 100 nucleotides, and the overall frequency of cold spots decreased from about 15 cold spots per 100 nucleotides in the unmodified gene to about 9 cold spots per 100 nucleotides in the SHM susceptible form.
[0619] B. Cloning and Analysis
[0620] After final review to ensure that the synthetic polynucleotide sequence is free of extraneous restriction sites, the complete polynucleotide sequence is synthesized (DNA 2.0, Menlo Park, Calif.), cloned into one of DNA2.0's cloning vectors (see Table 11 below), and sequenced to confirm correct synthesis.
TABLE-US-00014 TABLE 11 DNA2.0 source restriction sites Vector that insert Construct plasmid (5', 3') is cloned into cold TFP pJ15 Sac1, BsrG1 AB136 hot TFP pJ15 Sac1, BsrG1 AB102 GFP* stop pJ31 Sac1, BsrG1 AB105 (Y82stop) cold hygromycin pJ2 NgoMIV, Xba1 AB179, AB163 unmodified pJ51 NgoMIV, Xba1 AB150, AB161 puromycin cold blasticidin pJ13 NgoMIV, Xba1 AB102, AB153 cold AID pJ45 Sac1, BsrG1 AB135, AB174 Human AID Kappa enhancers PCR amplification of genomic DNA
[0621] Other elements, for example E-box motifs or Ig enhancer elements are created by either oligo synthesis or PCR amplification as described in Example 5 below.
[0622] To test functionality of the new synthetic inserts, coding regions are excised from DNA2.0 source vectors using restriction enzymes as listed in Table 11 above, and inserted into expression vectors (Table 11) using standard recombinant molecular biological techniques. Insertion of selection markers (i.e., cold blasticidin, cold hygromycin, and unmodified puromycin) into the AB series of vectors places them down stream of the EMCV IRES sequence (AB150, AB102, AB179; see FIG. 33A) or downstream of the pSV promoter (AB161, AB153, AB163; see FIG. 33B).
[0623] To test functional activity of the optimized synthetic genes, Hek 293 cells are plated at 4×105/well, in 6-well microliter dish. After 24 hours, transfections are performed using Fugene6 reagent from Roche Applied Sciences (Indianapolis, Ind.) at a reagent-to-DNA ratio of 3 μL:1 μg DNA per well. This ratio is also maintained for transfections with multiple plasmids. Transfections are carried out in accordance with manufacturer's protocol.
[0624] To determine the relative stability/susceptibility of each construct to somatic hypermutation, stable cell lines of each transfected cell population are created, and tested to determine the relative speed by which they accumulate SHM mediated mutations. Because the majority of these mutations result in a loss of function, relative mutagenesis load are conveniently measured as a loss of fluorescence via FACS (see below and Example 4).
[0625] FACS Analysis. Prior to FACS analysis, cells are harvested by trypsinization, washed twice in PBS containing 1% w/v BSA, and re-suspended in 200 μl PBS/1% BSA containing 2 ng/ml DAPI. Cells are analyzed in the Cytopeia Influx with 200 mW 488 nm and 50 mW 403 nm laser excitation. Up to one million cells per sample are acquired. DAPI fluorescence is measured through a 460/50 bandpass filter. GFP fluorescence is measured through a 528/38 bandpass filter. Percent GFP expression is reported as percentage of DAPI excluding live cells with no detectable GFP fluorescence above cellular background.
[0626] Reversion assays to test for function of the canine AID gene. GFP* (GFP with a stop codon introduced by site directed mutagenesis at position 82 [Y82stop]) is co-transfected with AB174 (cold canine AID), and cells are analyzed by flow cytometry 3 days post transfection, placed under antibiotic selection and analyzed further by flow cytometry every other day for 13-15 days.
[0627] Antibiotic selections. Antibiotic concentrations used in the selection of Hek 293 cells are determined empirically by performing a kill curve (i.e., determining the minimal concentration of antibiotic that kills all un-transfected--and thus antibiotic sensitive--cells). At 3 days post transfection, cells are plated at 4×105/well and selected at the following concentrations: 1.5 μg/ml puromycin (Clontech, Mountain View, Calif.); 16 μg/mL blasticidin (Invitrogen, Carlsbad, Calif.); and 360 μg/mL hygromycin (Invitrogen, Carlsbad, Calif.).
[0628] Resistance marker genes are tested to determine functionality by transfection of the appropriate expression plasmid (i.e. AB102 for blasticidin, AB179 for hygromycin) in Hek 293 cells based on their ability to promote drug resistance cell growth in the presence of 16 μg/mL blasticidin (Invitrogen, Carlsbad, Calif.); and 360 μg/mL hygromycin (Invitrogen, Carlsbad, Calif.) for two weeks.
[0629] Transfection of the AB102 containing cold blasticidin resulted in the creation of drug resistant colonies of transfected hek 293 cells at comparable rates as the wild type gene.
Example 2
Creation of Synthetic Polynucleotides Encoding Hygromycin
[0630] A. Polynucleotide Design
[0631] The starting sequence for unmodified hygromycin is shown in FIG. 11, together with the initial analysis of hot spot and cold spot frequency.
[0632] As described for Example 1, sequence optimization is completed using the computer program SHMredesign, based on the hot spot and cold spot motifs listed in Table 7.
1. Cold Hygromycin
[0633] From iteration 1 to iteration 2000, an additional 71 cold spots are inserted into the gene, 12 existing hot spots are removed, and 61 CpG sites are removed making the gene sequence less susceptible to somatic hypermutation. No further beneficial changes are observed upon further iterations.
[0634] An optimized sequence for a SHM resistant version of hygromycin created using this approach is shown in FIG. 12, together with the resulting changes in frequency of hot spots and cold spots. Optimization of the hygromycin sequence to make the sequence more resistant to somatic hypermutation resulted in an increase of 144 in number of cold spots (an increase of 71), and reduced the number of hot spots by about 17% (a decrease of 12). Overall the frequency of cold spots increased to an average density of about 22 cold spots per 100 nucleotides from an initial density of about 15 cold spots per 100 nucleotides, and the overall frequency of hot spots decreased from about 7 hot spots per 100 nucleotides, in the unmodified gene to about 5 hot spots per 100 nucleotides in the SHM resistant form.
[0635] Transfection of the AB179 containing cold hygromycin resulted in the creation of drug resistant colonies of transfected Hek 293 cells at comparable rates as the wild type gene.
2. Hot Hygromycin
[0636] Conversely, by increasing the probability of somatic hypermutation in a vector element such as a selectable marker, one is able to "reclaim" a marker for future use.
[0637] In the case of the hot hygromycin construct, the designed nucleotide sequence is maximized for hot spots, minimized for cold spots, minimized for CpG repeats and is rendered consistent with known mammalian optimized codon usage.
[0638] Optimization of the hygromycin sequence to make the sequence more susceptible to somatic hypermutation resulted in an increase of about 183% in number of hot spots (an increase of 61), and reduced the number of cold spots by about 42% (a decrease of 35) (FIG. 13). Overall the frequency of hot spots increased to an average density of about 13 hot spots per 100 nucleotides from an initial density of about 7 hot spots per 100 nucleotides, and the overall frequency of cold spots decreased from about 15 cold spots per 100 nucleotides in the unmodified gene to about 12 cold spots per 100 nucleotides in the SHM susceptible form.
[0639] B. Cloning and Analysis
[0640] After final review to ensure that a synthetic polynucleotide sequence is free of extraneous restriction sites, the complete polynucleotide sequence is synthesized (DNA 2.0, Menlo Park, Calif.), cloned into one of DNA2.0's cloning vectors (see Table 11; Example 1), sequenced to confirm correct synthesis and tested for activity as described above for Example 1.
[0641] To determine the relative stability/susceptibility of each of the constructs, to somatic hypermutation, stable cell lines of each transfected cell population re created, and tested to determine the relative speed by which they accumulate SHM mediated mutations. Because the majority of these mutations result in a loss of function, relative mutagenesis load are conveniently measured as a loss of fluorescence via FACS (see Example 4).
Example 3
Creation of Synthetic Polynucleotides Encoding Reporter Genes
[0642] A. Polynucleotide Design
[0643] The starting sequence for unmodified Teal Fluorescent Protein (TFP) is shown in FIG. 14, together with the initial analysis of hot spot and cold spot frequency.
1. Hot TFP
[0644] As described for Example 1, sequence optimization is completed using the computer program SHMredesign, based on the hot spot and cold spot motifs listed in Table 7; the resulting hot and cold versions of TFP are shown in FIGS. 15 and 16, respectively.
[0645] Optimization of the TFP sequence to make the sequence more susceptible to somatic hypermutation resulted in an increase of about 170% in number of hot spots (an increase of 28), and reduced the number of cold spots by about 26% (a decrease of 27). Overall the frequency of hot spots increased to an average density of about 10 hot spots per 100 nucleotides from an initial density of about 6 hot spots per 100 nucleotides, and the overall frequency of cold spots decreased from about 15 cold spots per 100 nucleotides in the unmodified gene to about 11 cold spots per 100 nucleotides in the SHM susceptible form.
2. Cold TFP
[0646] Optimization of the TFP sequence to make the sequence more resistant to somatic hypermutation resulted in an increase of 120% in number of cold spots (an increase of 21), and reduced the number of hot spots by about 10% (a decrease of 4). Overall the frequency of cold spots increased to an average density of about 18 cold spots per 100 nucleotides from an initial density of about 15 cold spots per 100 nucleotides, and the overall frequency of hot spots decreased from about 6 hot spots per 100 nucleotides, in the unmodified gene to about 5 hot spots per 100 nucleotides in the SHM resistant form.
[0647] B. Cloning and Analysis
[0648] After final review to ensure that the synthetic polynucleotide sequence is free of extraneous restriction sites, the complete polynucleotide sequence is synthesized (DNA 2.0, Menlo Park, Calif.), cloned into one of DNA2.0's cloning vectors (see Table 11; Example 1), sequenced to confirm correct synthesis and tested for activity as described below.
[0649] Hek 293 cells are transfected with the expression vectors (AB102 and 136 as described above in Example 1) containing either hot or cold versions of TFP driven for expression by an identical CMV promoter. Selection for stable expression began 3 days post transfection. Prior to FACS analysis, cells are harvested by trypsinization, ished twice in PBS containing 1% w/v BSA, and re-suspended in 200 μl PBS/1% BSA containing 2 ng/ml DAPI. Cells are analyzed in the Cytopeia Influx with 200 mW 488 nm and 50 mW 403 nm laser excitation. Up to one million cells per sample are acquired. DAPI fluorescence is measured through a 460/50 bandpass filter. GFP fluorescence is measured through a 528/38 bandpass filter. Percent GFP expression is reported in Table 12A as percentage of DAPI excluding live cells with no detectable GFP fluorescence above cellular background.
TABLE-US-00015 TABLE 12A Expression analysis of "hot" and "cold" versions of TFP % TFP Fold Expressing TFP Control over Construct cells Fluorescence Fluorescence control Hot TFP 63.74 189.33 20.61 9 (SHM susceptible) Cold TFP 66.92 429.72 19.93 22 (SHM resistant) Hot TFP 48.39 183.21 20.09 9 (SHM susceptible) Cold TFP 51.20 656.06 20.26 32 (SHM resistant)
[0650] These results show good expression above background of both hot and cold versions of TFP. In this case, making the sequence "cold" produced the surprising result that relative expression of the protein is improved. Such improved expression provides an additional benefit to the SHM resistant synthetic genes.
[0651] To determine the relative stability/susceptibility of each construct to somatic hypermutation, stable cell lines of each transfected cell population are created, and tested to determine the relative speed by which they accumulate SHM mediated mutations. Because the majority of these mutations result in a loss of function, relative mutagenesis load are conveniently measured as a loss of fluorescence via FACS (see Example 4).
[0652] Episomal expression constructs carrying either a SHM optimized coding sequence for hot TFP or cold TFP were individually stably co-transfected with AID into HEK 293 cells and allowed to expand and grow for 3 weeks (the cold canine AID used in these experiments contains the NES-inactivating L198A mutation; SEQ ID NO: 22). Cell stocks were then frozen, and one vial each of hot TFP and cold TPF were thawed, grown in culture for 4 days, and then pulsed with supplemental AID by transiently transfecting the 4 day post-thaw culturing with an additional aliquot of the original AID expression construct (termed "AID pulsing"). Cells were harvested by trypsinization nine days following the AID pulse, pelleted at 1150×g for 5 min., and frozen for later use.
[0653] Cell pellets were subsequently thawed and TFP ORFs were recovered by PCR using oligonucleotide (oligo) primers GTGGGAGGTCTATATAAGCAGAGC (SEQ ID NO: 339) and GATCGTCTCACGCGGATTGTAC (SEQ ID NO: 377). The former oligo amplifies from near the 3' end of the CMV promoter used for driving expression of TFP mRNA, which lies 142 nt 5' to the TFP start codon, and the latter oligo matches sequences ending 1 nt 3' to the TFP stop codon.
[0654] Each PCR reaction (total volume of 50 μL) was run 35 cycles under the following conditions: 95° C. for 5 min, 35 cycles of (95° C. for 30 sec, 55° C. for 30 sec, 68° C. for 45 sec), followed by 1 min at 68° C. before cooling to 4° C. PCR amplified products were cloned into the TOPO® TA cloning vector (Invitrogen, Carlsbad, Calif.), and inserts were sequenced. A total of 166 hot and 111 cold TFP ORFs were rescued, sequenced and compared the resulting spectrum of mutations. Global statistics for the mutations observed in the two sets of sequences are shown in Table 12B.
TABLE-US-00016 TABLE 12B Mutation metrics for cold- and hot-TFP # ORFs # total # nt kb per templates per template sequenced mutations sequenced mutation mutation coldTFP 111 18 61050 3391 6.1 hotTFP 166 100 88500 885 1.6
[0655] The mutation frequency is approximately 3.8-fold greater in the TFP template version with maximized hotspots vs. the cold TFP sequence with minimized hotspots. The data demonstrates that SHM optimization of polynucleotide sequences can be used to either increase or decrease the frequency of mutations experienced by a polynucleotide encoding a protein of interest.
[0656] FIG. 16D shows the mutations for a representative segment of the hot and cold TFP constructs. The central row shows the amino acid sequence of TFP (residues 59 thru 87) in single letter format, and the "hot" and "cold" starting nucleic acid sequences encoding the two constructs are shown above (hot) and below (cold) the amino acid sequence. Mutations observed in the hot sequence are aligned and stacked top of the gene sequences, while mutations in the cold TFP sequence are shown below. The results illustrate how "silent" changes to the coding sequences generate dramatic changes in observed AID-mediated SHM rates, demonstrating that engineered sequences can be effectively optimized to create fast or slow rates of SHM.
[0657] FIG. 16E shows that the spectrum of mutations generated by AID in the present in vitro tissue culture system mirror those observed in other studies and those seen during in vivo affinity maturation. FIG. 16E shows the mutations generated in the present study (Box (i) upper left, n=118), and compares them with mutations observed by Zan et al. (box (ii) upper right, n=702), Wilson et al. (lower left, n=25000; box (iii)), and a larger analysis of IGHV chains that have undergone affinity maturation (lower right, n=101,926; box (iv)). The Y-axis in each chart indicates the starting nucleotide, the X-axis indicates the end nucleotide, and the number in each square indicates the percentage (%) of time that nucleotide transition is observed. In the present study, the frequency of mutation transitions and transversions was similar to those seen in other data sets. Mutations of C to T and G to A are the direct result of AID activity on cytidines and account for 48% of all mutation events. In addition, mutations at bases A and T account for ˜30% of mutation events (i.e., slightly less than frequencies observed in other datasets).
[0658] FIG. 16F shows that mutation events are distributed throughout the SHM optimized nucleotide sequence of the hot TFP gene, with a maximum instantaneous rate of about 0.08 events per 1000 nucleotides per generation centered around 300 nucleotides from the beginning of the open reading frame. Stable transfection and selection of a gene with AID (for 30 days) produces a maximum rate of mutation of 1 event per 480 nucleotides. As a result, genes may contain zero, one, two or more mutations per gene. The distribution of SHM-mediated events observed in hot TFP sequenced genes can be seen in FIG. 16G, compared to the significantly reduced pattern of mutations seen in cold TFP (FIG. 16H).
[0659] Thus the present study demonstrates that the creation of non-synonymous versions of genes such as Teal-fluorescent protein (TFP) that do not normally undergo somatic hypermutation can be used to target such genes for high rates of somatic hypermutation. Additionally, the creation of SHM resistant genes (while encoding for the same amino acids) can lead to proteins that have a reduced number of somatic hypermutation hot-spots and, thus, experience a dramatically reduced level of AID mediated hypermutation. In each instance of SHM optimization, mammalian codon usage and other factors effecting gene expression levels were considered in generating the engineered sequences, leading to proteins that also exhibit reasonable levels of translation and expression. The results, therefore, demonstrate that the present methods of SHM optimization (i) can be successfully used to target the activity of AID to specific regions of an expressed gene; (ii) can be used to speed or slow the rate of SHM, (iii) demonstrate that the spectrum of mutations generated by AID using this methodology is equivalent to that observed in vivo; (iv) and demonstrate that SHM optimization can be successfully performed on a gene of interest to either positively or negatively impact its rate of AID-mediated SHM without significantly negatively impacting its expression.
Example 4
Creation of Synthetic Polynucleotides Encoding Enzymes Involved in SHM
[0660] The systems and methods described herein can be applied to enzymes such as, for example, AID, Pol eta, Pol theta and UDG.
[0661] A. Activation Induced Cytidine Deaminase (AID)
[0662] Analysis of sequence variations in cytidine deaminase (AID) between mammalian species (e.g., rat, chimpanzee, mouse, human, dog, cow, rabbit, chicken, frog, zebra fish, fugu and tetraodon (puffer fish)) as compared to humans demonstrates that organisms as distantly related as human and frog display a surprisingly high (70%) sequence identity, and >80% sequence similarity. In addition, it has been shown that AID from other organisms can be substituted for human AID in somatic hypermutation (SHM), and that all mammalian species of AID are functionally equivalent.
[0663] Shown in FIG. 17 is a comparison of human AID with other terrestrial AIDs in order to identify a promising beginning construct for SHM in vivo. The figure provides a sequence alignment of AID from human (H_sap/1-198), mouse (M_musc/1-198), canine (C_fam/1-198), rat (R_norv/1-199), and chimpanzee (P_trog/1-199). FIG. 21 illustrates the sequence identity between human, canine and mouse AID proteins.
[0664] Canine AID has overall 94% amino acid identity to human and mouse AID and, thus, is selected as the starting point for codon optimization. To optimize codon usage, the canine amino acid sequences are reverse translated and then iteratively optimized.
[0665] AID is known to contain a nuclear export signal, which is contained within the C-terminal 10 amino acids (McBride et al., J Exp Med. 2004 Can 3; 199(9):1235-44; Ito et al., PNAS 2004 Feb. 17; 101(7):1975-80). For purposes of the experiments described below, the canine AID contains a leucine to alanine mutation at position 198, while the human AID construct retains the unmutated, intact nuclear export signal.
[0666] As described in Example 1, SHM sequence optimization is completed using the computer program SHMredesign, based on the hot spot and cold spot motifs listed in Table 7; the resulting hot and cold versions of canine AID are shown in FIGS. 19 and 20, respectively. The starting sequence for canine AID is shown in FIG. 18, together with the initial analysis of hot spot and cold spot frequency.
1. Hot AID
[0667] Optimization of the AID sequence to make the sequence more susceptible to somatic hypermutation resulted in an increase of about 200% in number of hot spots (an increase of 43), and reduced the number of cold spots by about 30% (a decrease of 23). Overall the frequency of hot spots increased to an average density of about 14 hot spots per 100 nucleotides from an initial density of about 7 hot spots per 100 nucleotides, and the overall frequency of cold spots decreased from about 13 cold spots per 100 nucleotides in the unmodified gene to about 9 cold spots per 100 nucleotides in the SHM susceptible form.
2. Cold AID
[0668] Optimization of the canine AID sequence to make the sequence more resistant to somatic hypermutation resulted in an increase of 186% in number of cold spots (an increase of 68), and reduced the number of hot spots by about 35% (a decrease of 14). Overall the frequency of cold spots increased to an average density of about 25 cold spots per 100 nucleotides from an initial density of about 13 cold spots per 100 nucleotides, and the overall frequency of hot spots decreased from about 7 hot spots per 100 nucleotides, in the unmodified gene to about 5 hot spots per 100 nucleotides in the SHM resistant form.
[0669] After final review to ensure that the synthetic polynucleotide sequence is free of extraneous restriction sites, the complete polynucleotide sequence is synthesized (DNA 2.0, Menlo Park, Calif.), cloned into one of DNA2.0's cloning vectors (see Table 11; Example 1), sequenced to confirm correct synthesis and tested for activity as described below and in Example 1.
[0670] To determine canine AID activity, the cold or wild type versions of canine AID are co-transfected with expression vectors expressing the GFP* construct that contains a stop codon within it's coding region (as described in Example 1) either in the presence or absence of Ig enhancer elements within the target vector sequence. Mutation of the stop codon by AID results in the creation of a functional fluorescent protein that is a direct indicator of AID activity.
[0671] In this experiment, cells are harvested by trypsinization, washed twice in PBS containing 1% w/v BSA, and re-suspended in 200 μl PBS/1% BSA containing 2 ng/ml DAPI. Cells are analyzed in the Cytopeia Influx with 200 mW 488 nm and 50 mW 403 nm laser excitation. Up to one million cells per sample are acquired and revertants are determined as percentage of DAPI excluding live cells with detectable GFP fluorescence above cellular background.
[0672] FIG. 22A shows the predicted effect of AID activity on protein function, in this type of assay. Of note is the observation that mutagenesis can produce mutations that both initially restore or improve function and later reduce or eliminate function. The balance in these two rates generates early and rare mutation events that restore function, followed by secondary and ternary mutation events that destroy function in these proteins. The net effect of these competing rates on the observation of gain-of-function events in a population can be seen in FIG. 22B. Given three different assumptions regarding number of inactivating mutations needed to silence GFP, one would expect to observe three very different profiles of reversion events as a function of time, dependent on the rate of enzymatic activity of the AID.
[0673] Thus although initial reversion rates can provide an accurate assessment of AID activity, long term studies of activity require an analysis of the rate of extinction of activity, rather than reversion of fluorescence.
[0674] To test this possibility, a cell line that is stably expressing a fluorescent protein is transfected with 2 concentrations of expression vector containing cold canine AID. Cells are stably maintained in culture and sample assayed for total fluorescence after the indicated periods of time.
[0675] Prior to FACS analysis, cells are harvested by trypsinization, washed twice in PBS containing 1% w/v BSA, and re-suspended in 200 μl PBS/1% BSA containing 2 ng/ml DAPI. Cells are analyzed in the Cytopeia Influx with 200 mW 488 nm and 50 mW 403 nm laser excitation. DAPI fluorescence is measured through a 460/50 bandpass filter. GFP fluorescence is measured through a 528/38 bandpass filter. Percent GFP expression is reported as percentage of DAPI excluding live cells with no detectable GFP fluorescence above cellular background.
[0676] The results, shown in FIG. 22C, show a steady and sustained progressive, dose dependent decrease in GFP expression (shown as increasing GFP extinction) with time when co-expressed with increasing amounts of cold AID. The data are consistent with the hypothesis that cold AID is able to introduce multiple mutations into a target gene, and is both functional and stable when expressed in a "cold form" for many days.
[0677] To directly compare the ability of cold canine AID to exert mutagenesis, initial reversion assays are set up comparing cold canine AID with wild type human AID. Hek 293 cells are transfected with the expression vectors (as described above in Example 1) containing either the GFP* as described above, or GFP* with the Kappa E3 and intronic enhances inserted 5' to the CMV promoter, together with either human or cold canine AID. Selection for stable expression began 3 days post transfection. Prior to FACS analysis, cells are harvested by trypsinization, washed twice in PBS containing 1% w/v BSA, and re-suspended in 200 μl PBS/1% BSA containing 2 ng/ml DAPI. Cells are analyzed in the Cytopeia Influx with 200 mW 488 nm and 50 mW 403 nm laser excitation. Up to one million cells per sample are acquired. DAPI fluorescence is measured through a 460/50 bandpass filter. GFP fluorescence is measured through a 528/38 bandpass filter. Percent GFP expression is reported as percentage of DAPI excluding live cells with no detectable GFP fluorescence above cellular background.
[0678] The results show (FIG. 22C) that canine AID exhibited significantly enhanced reversion activity compared to human AID. Also in this experiment is shown the effect of the kappa 3'E and intronic enhancers on the rate of reversion experienced by the target gene when these are included in the expression vector. As shown inclusion of the enhancer elements further enhanced reversion frequency.
[0679] B. Pol Eta
[0680] The starting unmodified sequence for Pol eta is shown in FIG. 23, together with the initial analysis of hot spot and cold spot frequency.
[0681] As described above, sequence optimization is completed using the computer program SHMredesign, based on the hot spot and cold spot motifs listed in Table 7; the resulting cold and hot versions of Pol eta are shown in FIGS. 24 and 25, respectively. Changes in hot and cold spot density are summarized below in Table 13:
TABLE-US-00017 TABLE 13 Summary of hot spot and cold spot changes No. Hot No. Cold Hot Spot Cold Spot Gene Spots Spots Density Density Native 177 307 8 9 Cold 98 606 5 28 Hot 359 185 17 8
[0682] In Table 13, "Hot Spot Density" or "Cold Spot Density," refers to the total number of hot or cold spot motifs in the ORF, divided by the number of nucleotides in the ORF, multiplied by 100, rounded to the nearest whole number.
[0683] C. Pol Theta
[0684] The starting amino acid and nucleic acid sequences for Pol theta are shown in FIG. 26 and in FIG. 27, respectively, together with the initial analysis of hot spot and cold spot frequency.
[0685] As described above, sequence optimization is completed using the computer program SHMredesign, based on the hot spot and cold spot motifs listed in Table 7; the resulting cold and hot versions of Pol theta are shown in FIG. 28 and in FIG. 29, respectively. Changes in hot and cold spot density (per 100 nucleotides) are summarized below in Table 14:
TABLE-US-00018 TABLE 14 Summary of hot spot and cold spot changes Hot Cold Hot Spot Cold Spot Gene Spots # Spots # Density Density Native 597 1054 8 14 Cold 349 1847 4 24 Hot 1053 700 13 9
[0686] In Table 14, "Hot Spot Density" or "Cold Spot Density" refers to the total number of hot or cold spots in the ORF, divided by the number of nucleotides in the ORF, multiplied by 100, rounded to the nearest whole number.
[0687] D. UDG
[0688] The starting amino acid and nucleic acid sequences for UDG are shown in FIGS. 30A and 30B, respectively, together with the initial analysis of hot spot and cold spot frequency (FIG. 30C).
[0689] As described above, sequence optimization is completed using the computer program SHMredesign, based on the hot spot and cold spot motifs listed in Table 7; the resulting cold and hot versions of UDG are shown in FIGS. 31A and 31C, respectively, together with the initial analysis of hot spot and cold spot frequency (FIGS. 31B and 31D), respectively. Changes in hot and cold spot density (per 100 nucleotides) are summarized below in Table 15:
TABLE-US-00019 TABLE 15 Summary of hot spot and cold spot changes Hot Cold Hot Spot Cold Spot Gene Spots # Spots # Density Density Native 70 140 8 15 Cold 44 269 5 29 Hot 145 115 16 13
[0690] In Table 15, "Hot Spot Density" or "Cold Spot Density," refers to the total number of hot or cold spots in the ORF, divided by the number of nucleotides in the ORF, multiplied by 100, rounded to the nearest whole number.
Example 5
Creation of Vectors for Somatic Hypermutation
[0691] Vectors are constructed from sub-fragments that are each synthesized by DNA2.0 (Menlo Park, Calif.). Vectors are able to simultaneously express multiple open reading frames and are capable of stable, episomal replication in mammalian cells that are naturally permissive or rendered to be permissive (i.e., via co-expression of human EBP2 (Habel et al., 2004; Kapoor et al., 2001) for replication of Epstein Barr Virus (EBV) origin of replication (oriP) containing vectors.
[0692] Plasmids are rendered highly modular through the strategic placement of one or more restriction endonuclease recognition sequences (restriction sites) between discreet fragments throughout the vector.
[0693] A. Vectors Formats.
[0694] In the first format (FIG. 32A); vectors contained an internal ribosome entry site (IRES) from the encephalomyocarditis virus (EMCV). Elements contained within the vectors are operably linked together as shown in FIG. 32A and, in some cases, included the following functional elements (numbers refer to corresponding sequence information found further below in this section): 1) CMV promoter; 2) Multicloning sites; 3) Gene of interest; 4) IRES; 5) Eukaryotic selectable marker such as blasticidin S deaminase (bsd), hygromycin phosphotransferase (hyg) or puromycin-N-acetyl-transferase; 6) Terminator sequences, (3' untranslated region, small intron and polyA signals from SV40 ("IVS pA")); 7) Epstein Barr Virus (EBV) origin of replication (oriP) (preceded by optional intergenic spacer region); 8) Prokaryotic origin of replication ColE1; 9) Prokaryotic selectable marker such as beta lactamase (bla) gene or kanamycin (kan); 10) gene fragment for copy number determination (such as beta actin or glucose-6-phosphate dehydrogenase (G6PDH), and Ig enhancers.
[0695] In a second format, (FIG. 32B), the expression vectors are made without an IRES, but contained instead an independent expression cassette for expressing a selectable marker gene. This expression cassette included, 11) the SV40 immediate early promoter (pSV) and eukaryotic selectable marker, and IVS pA as described above. Elements contained within the vectors are operably linked together as shown in FIG. 32 and, in some cases, included the following functional elements: CMV promoter, multicloning sites, gene of interest, IVS pA, Epstein Barr Virus, (EBV) origin of replication (oriP), pSV, selectable marker, IVS pA, prokaryotic origin of replication ColE1, prokaryotic selectable marker such as beta lactamase (bla) gene, or kanamycin (kan), gene fragment for copy number determination, Ig enhancers, and multicloning sites.
[0696] In a third format, (FIG. 33A) vectors contained a bidirectional promoter that drives expression of 2 different genes oriented in opposite directions. This vector also contained IRES sequences to generate 1 or 2 bi- or tri-cistronic messages Elements contained within the vectors are operably linked together as shown in FIG. 33 using the same functional elements as described previously.
[0697] In a fourth format, (FIG. 33B) vectors contain a bidirectional promoter, one or more IRES sequences that express bi- or tri-cistronic messages, and an independent, cis-linked cassette from which a eukaryotic selectable marker is expressed.
[0698] Any of the vectors can be interchanged with each other to form hybrids. In addition, any of the strong constitutive eukaryotic promoters contained on the episomal vector can be substituted with an inducible promoter (i.e., the reverse tetracycline transactivator promoter system [prtTA]) to achieve conditional expression of a desired gene. In this case, one of the other genes of interest should encode the transactivating protein, which can be expressed in cis on the same episome (as shown in FIG. 34), or supplied in trans on a second, transfected episomal vector.
[0699] The orientations for the prokaryotic selectable marker and colEI origin of replication provided in sections 8 and 9 below (SEQ ID NOS: 9-11), and in FIGS. 33-35 are not absolute and can be reversed with respect to the remainder of the vector. Similarly, the orientation of the independent expression cassette (pSV--selectable marker (or other gene of interest)--IVS pA) can also be reversed with respect to the remainder of the vector (i.e. transcribing toward the oriP instead of the current portrayal of transcription away from the oriP). Additionally Enhancer elements, such as Ig enhancers can be placed either 5' or 3' to the gene of interest, or can excluded.
[0700] B. Representative Sequences of Functional Elements
[0701] 1. A strong transcriptional promoter that works in eukaryotic cells. In FIGS. 32-33, the CMV promoter is used and the sequence is provided as SEQ ID NO: 1 (the TATA box sequence is shown underlined). The CMV promoter is altered to remove SacI and BsrGI sites.
TABLE-US-00020 (SEQ ID NO: 1) AGCTTGGCCCATTGCATACGTTGTATCCATATCATAATATCTACATTTAT ATTGGCTCATGTCCAACATTACCGCCATGTTGACATTGATTATTGACTAG TTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCATATATGG AGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCC AACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAAC GCCAATAGGGACTTTCCATTGACGTCAATGGGTGGAGTATTTACGGTAAA CTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCCT ATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTACA TGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATC GCTATTACCATGGTGATGCGGTTTTGGCAGTACATCAATGGGCGTGGAT AGCGGTTTGACTCACGGGGATTTCCAAGTCTCCACCCCATTGACGTCAA TGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCAAAATGTCG TAACAACTCCGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGG TGGGAGGTCTATATAAGCAGAGCTGGTTTAGTGAACCGTCAGATC GCCTA.
[0702] 2. A region encoding multiple restriction sites termed a multicloning site (mcs) region:
TABLE-US-00021 (SEQ ID NO: 2) TTCCCTGCAGGATTGTTTAAACACCAGATCTGCTTGAATCCGCGGATAAG AGGACTAGTATTCGTCTCACTAGGGAGAGCTCCTA.
[0703] 3. A gene of interest can be, for example, specific binding member, antibody or fragment thereof, antibody heavy or light chain, enzyme, receptor, peptide growth hormone or transcription factor.
[0704] 4. An internal ribosome entry site (IRES), in FIG. 32-34 from the encephalomyocarditis virus (EMCV)--permits the concomitant bicistronic expression of two open reading frames (ORF's): one 5' to itself, and a second 3' to itself. A region containing 2 restriction sites (BsrGI and AscI) is shown 5' to the IRES (lower case letters). The 3' end of the IRES includes an NgoMIV site.
TABLE-US-00022 (SEQ ID NO: 3) tgtacaatccgcgtgagacgatcggcgcgccCGCCCCTCTCCCTCCCCCC CCCCTAACGTTACTGGCCGAAGCCGCTTGGAATAAGGCCGGTGTGCGTTT GTCTATATGTTATTTTCCACCATATTGCCGTCTTTTGGCAATGTGAGGGC CCGGAAACCTGGCCCTGTCTTCTTGACGAGCATTCCTAGGGGTCTTTCCC CTCTCGCCAAAGGAATGCAAGGTCTGTTGAATGTCGTGAAGGAAGCAGTT CCTCTGGAAGCTTCTTGAAGACAAACAACGTCTGTAGCGACCCTTTGCAG GCAGCGGAACCCCCCACCTGGCGACAGGTGCCTCTGCGGCCAAAAGCCAC GTGTATAAGATACACCTGCAAAGGCGGCACAACCCCAGTGCCACGTTGTG AGTTGGATAGTTGTGGAAAGAGTCAAATGGCTCTCCTCAAGCGTATTCAA CAAGGGGCTGAAGGATGCCCAGAAGGTACCCCATTGTATGGGATCTGAT CTGGGGCCTCGGTGCACATGCTTTACATGTGTTTAGTCGAGGTTAAAAAA ACGTCTAGGCCCCCCGAACCACGGGGACGTGGTTTTCCTTTGAAAAACA CGATGATAATATGGCCGGC.
[0705] 5. The open reading frame (ORF) for a mammalian selectable marker gene, such as, for example, blasticidin S deaminase (bsd) (SEQ ID NO: 4), hygromycin phosphotransferase (hyg) (SEQ ID NO: 5), or puromycin-N-acetyl-transferase (SEQ ID NO: 6). Start and stop codons are underlined. 3' to each ORF is an XbaI site (TCTAGA) used in the cloning step.
[0706] Blasticidin S deaminase (bsd; cold spot optimized)
TABLE-US-00023 (SEQ ID NO: 4) ATGGCCAAGCCTTTGTCTCAAGAAGAATCCACCCTCATTGAAAGGGCCAC TGCTACAATCAACAGCATCCCCATCTCTGAAGACTACTCTGTCGCCAGCG CAGCTCTCTCCTCTGACGGGAGAATCTTCACTGGTGTCAATGTATATCAT TTTACTGGGGGACCTTGCGCAGAGCTTGTGGTCCTGGGGACTGCTGCTGC TGCTGCAGCCGGAAACCTGACTTGTATCGTCGCCATAGGGAATGAGAACA GAGGCATCTTGAGCCCCTGTGGGAGATGCAGACAAGTCCTCCTGGACCTC CATCCTGGGATCAAAGCCATAGTGAAGGACAGTGATGGACAGCCCACAGC CGTTGGGATCAGGGAGTTGCTGCCATCTGGTTATGTGTGGGAGGGCTAA TCTAGA.
[0707] Hygromycin phosphotransferase (hyg; cold spot optimized)
TABLE-US-00024 (SEQ ID NO: 5) ATGAAAAAGCCTGAACTGACTGCCACCTCTGTTGAGAAGTTTTTAATAGAGAAGTTTGACTCT GTGTCAGACCTCATGCAGCTTTCTGAGGGAGAGGAGTCTAGAGCCTTTAGCTTTGATGTGGGGGGGAG AGGCTATGTCCTGAGAGTCAATAGCTGTGCAGATGGTTTCTACAAAGATAGGTATGTCTATAGACATT TTGCATCCGCCGCCCTCCCCATTCCAGAGGTCCTTGACATTGGGGAATTCTCAGAGAGCCTGACCTATT GCATTTCCCGGAGAGCCCAGGGTGTGACTCTTCAAGACCTGCCTGAGACAGAACTCCCTGCAGTGCTC CAGCCCGTCGCCGAGGCCATGGATGCAATCGCCGCCGCAGACCTCAGCCAGACCTCGGGGTTTGGGCC CTTTGGCCCCCAGGGGATAGGCCAATACACTACATGGAGAGATTTCATATGCGCTATTGCTGACCCCC ATGTGTATCACTGGCAAACTGTGATGGACGACACAGTCTCAGCCTCTGTCGCACAAGCCCTGGACGAG CTGATGCTTTGGGCCGAGGACTGCCCAGAGGTCAGACATCTCGTCCATGCCGACTTTGGGTCAAACAA TGTCCTGACGGACAATGGGAGAATCACTGCTGTCATTGACTGGAGCGAGGCCATGTTTGGGGACTCCC AATACGAGGTCGCCAACATCTTCTTCTGGAGACCCTGGTTGGCTTGTATGGAGCAGCAGACCCGTTAC TTTGAGAGGAGGCATCCAGAGCTCGCTGGGAGCCCTAGATTGAGGGCCTATATGCTCAGGATAGGGCT TGACCAACTCTATCAGAGCTTGGTTGACGGCAATTTTGATGACGCAGCTTGGGCTCAGGGGAGATGCG ACGCCATAGTGAGGAGTGGGGCCGGGACTGTCGGGAGAACTCAGATCGCCAGGAGGTCAGCTGCCGT CTGGACTGACGGCTGTGTAGAAGTCTTAGCCGACTCTGGGAACAGGAGACCCAGCACTCGTCCAGAGG CCAAGGAATGATCTAGA.
[0708] Puromycin-N-acetyl-transferase (Pur; wild type sequence).
[0709] Contains a Kozak consensus sequence immediately 5' to the start codon (underlined). Stop codon is also underlined.
TABLE-US-00025 (SEQ ID NO: 6) CACCATGACCGAGTACAAGCCCACGGTGCGCCTCGCCACCCGCGACGACG TCCCCCGGGCCGTTCGCACCCTCGCCGCCGCGTTCGCCGACTACCCCGCC ACGCGCCACACCGTGGACCCGGACAGGCACATCGAGCGGGTCACCGAGC TGCAAGAACTCTTCCTCACGCGCGTCGGGCTCGACATCGGCAAGGTGTGG GTCGCGGACGACGGCGCCGCTGTGGCGGTCTGGACCACGCCGGAGAGCGT CGAAGCGGGGGCGGTGTTCGCCGAGATCGGCCCGCGCATGGCCGAGTTGA GCGGTTCCCGGCTGGCCGCGCAGCAACAGATGGAAGGCCTCCTGGCGCCG CACCGGCCCAAGGAGCCCGCGTGGTTCCTGGCTACCGTCGGAGTCTCGCC CGACCACCAGGGCAAGGGTCTGGGCAGCGCCGTCGTGCTCCCCGGAGTGG AGGCTGCCGAGCGTGCCGGGGTGCCCGCCTTCCTCGAGACCTCCGCGCCC CGCAACCTCCCCTTCTACGAGCGGCTCGGCTTCACCGTCACCGCCGACGT CGAGGTGCCCGAAGGACCGCGCACCTGGTGCATGACCCGCAAGCCCGGTG CCTGATCTAGA.
[0710] 6. Terminator sequences, IVS-pA (shown with 3' BamH I).
TABLE-US-00026 (SEQ ID NO: 7) GGATCTTTGTGAAGGAACCTTACTTCTGTGGTGTGACATAATTGGACAAA CTACCTACAGAGATTTAAAGCTCTAAGGTAAATATAAAATTTTTAAGTGT ATAATGTGTTAAACTACTGATTCTAATTGTTGTGGTATTTTAGATTCCAA CCTATGGAACTTATGAATGGGAGCAGTGGTGGAATGCCTTTAATGAGGAA AACCTGTTTTGCTCAGAAGAAATGCCATCTAGTGATGATGAGGCTACTGC TGACTCTCAACATTCTACTCCTCCAAAAAAGAAGAGAAAGGTAGAAGACC CCAAGGACTTTCCTTCAGAATTGGTAAGTTTTTTGAGTCATGCTGTGTTT AGTAATAGAACTCTTGCTTGCTTTGCTATTTACACCACAAAGGAAAAAGC TGCACTGCTATACAAGAAAATTATGGAAAAATATTTGATGTATAGTGCCT TGACTAGAGATCATAATCAGCCATACCACATTTGTAGAGGTTTTACTTGC TTTAAAAAACCTCCCACACCTCCCCCTGAACCTGAAACATAAAATGAAT GCAATTGTTGTTGTTAACTTGTTTATTGCAGCTTATAATGGTTACAAATA AAGCAATAGCATCACAAATTTCACAAATAAAGCATTTTTATCACTGCATT CTAGTTGTGGTTTGTCCAAACTCATCAATGTATCTTATCATGTCTGGA TCC.
[0711] 7. Sequence of EBV oriP. This element permits episomal replication in EBV oriP permissive cells that express Epstein Barr Nuclear Antigen 1 (EBNA1). The oriP sequence is preceded by an optional intergenic spacer region (small letters):
TABLE-US-00027 (SEQ ID NO: 8) actgtcttctttatcatgcaactcgtaggacaggtgccctggccgggtccGCAGGAAAAGGACAAGCAGCGAAA- ATTCACGC CCCCTTGGGAGGTGGCGGCATATGCAAAGGATAGCACTCCCACTCTACTACTGGGTATCATATGCTGA CTGTATATGCATGAGGATAGCATATGCTACCCGGATACAGATTAGGATAGCATATACTACCCAGATAT AGATTAGGATAGCATATGCTACCCAGATATAGATTAGGATAGCCTATGCTACCCAGATATAAATTAGG ATAGCATATACTACCCAGATATAGATTAGGATAGCATATGCTACCCAGATATAGATTAGGATAGCCTA TGCTACCCAGATATAGATTAGGATAGCATATGCTACCCAGATATAGATTAGGATAGCATATGCTATCC AGATATTTGGGTAGTATATGCTACCCAGATATAAATTAGGATAGCATATACTACCCTAATCTCTATTAG GATAGCATATGCTACCCGGATACAGATTAGGATAGCATATACTACCCAGATATAGATTAGGATAGCAT ATGCTACCCAGATATAGATTAGGATAGCCTATGCTACCCAGATATAAATTAGGATAGCATATACTACC CAGATATAGATTAGGATAGCATATGCTACCCAGATATAGATTAGGATAGCCTATGCTACCCAGATATA GATTAGGATAGCATATGCTATCCAGATATTTGGGTAGTATATGCTACCCATGGCAACATTAGCCCACC GTGCTCTCAGCGACCTCGTGAATATGAGGACCAACAACCCTGTGCTTGGCGCTCAGGCGCAAGTGTGT GTAATTTGTCCTCCAGATCGCAGCAATCGCGCCCCTATCTTGGCCCGCCCACCTACTTATGCAGGTATT CCCCGGGGTGCCATTAGTGGTTTTGTGGGCAAGTGGTTTGACCGCAGTGGTTAGCGGGGTTACAATCA GCCAAGTTATTACACCCTTATTTTACAGTCCAAAACCGCAGGGCGGCGTGTGGGGGCTGACGCGTGCC ATCACTCCACAATTTCAAGAGAAAGAGTGGCCACTTGTCTTTGTTTATGGGCCCCATTGGCGTGGAGCC CCGTTTAATTTTCGGGGGTGTTAGAGACAACCAGTGGAGTCCGCTGCTGTCGGCGTCCACTCTCTTTCC CCTTGTTACAAATAGAGTGTAACAACATGGTTCACCTGTCTTGGTCCCTGCCTGGGACACATCTTAATA ACCCCAGTATCATATTGCACTAGGATTATGTGTTGCCCATAGCCATAAATTCGTGTGAGATGGACATCC AGTCTTTACGGCTTGTCCCCACCCCATGGATTTCTATTGTTAAAGATATTCAGAATGTTTCATTCCTACA CTAGGATTTATTGCCCAAGGGGTTTGTGAGGGTTATATTGGTGTCATAGCACAATGCCACCACTGAAC CCATCGTCCAAATTTTATTCTGGATGCGTCACCTGAAACCTTGTTTTCGAGCACCTCACATACACCTTA CTGTTCACAACTCAGCAGTTATTCTATTAGCTAAACGAAGGAGAATGAAGAAGCAGGCGAAGATTCAG GAGAGTTCACTGCCCGCTCCTTGATCTTCAGCCACTGCCCTTGTGACTAAAATGGTTCACTACCCTCGT GGAATCCTGACCCCATGTAAATAAAACCGTGACAGCTCATGGGGTGGGAGATATCGCTGTTCCTTAGG ACCCTTTTACTAACCCTAATTCGATAGCATATGCTTCCCGTTGGGTAACATATGCTATTGAATTAGGGT TAGTCTGGATAGTATATACTACTACCCGGGAAGCATATGCTACCCGTTTAGGGTTAACAAGGGGGCCT TATAAACACTATTGCTAATGCCCTCTTGAGGGTCCGCTTATCGGTAGCTACACAGGCCCCTCTGATTGA CGTTGGTGTAGCCTCCCGTAGTCTTCCTGGGCCCCTGGGAGGTACATGTCCCCCAGCATTGGTGTAAGA GCTTCAGCCAAGAGTTACACATAAAGG.
[0712] 8. Sequence of Escherichia coli origin of replication colEI, derived from vector pJ15 and pJ31 from DNA2.0 (Menlo Park, Calif.): colE1
TABLE-US-00028 (SEQ ID NO: 9) AAAAGGGGCCCGAGCTTAAGACTGGCCGTCGTTTTACAACACAGAAAGAGTTTGTAGAAACG CAAAAAGGCCATCCGTCAGGGGCCTTCTGCTTAGTTTGATGCCTGGCAGTTCCCTACTCTCGCCTTCCG CTTCCTCGCTCACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTCAAAGG CGGTAATACGGTTATCCACAGAATCAGGGGATAACGCAGGAAAGAACATGTGAGCAAAAGGCCAGCA AAAGGCCAGGAACCGTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGC ATCACAAAAATCGACGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTT TCCCCCTGGAAGCTCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTT CTCCCTTCGGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTT CGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTAT CGTCTTGAGTCCAACCCGGTAAGACACGACTTATCGCCACTGGCAGCAGCCACTGGTAACAGGATTAG CAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAAGTGGTGGGCTAACTACGGCTACACTAGAA GAACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGAT CCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATTACGCGCAGAAAA AAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTCAGTGGAACGACGCGCGCGT AACTCACGTTAAGGGATTTTGGTCATGAGCTTGCGCCGTCCCGTCAAGTCAGCGTAATGCTCTG.
[0713] 9A. Sequence of beta lactamase (bla) gene for resistance. The open reading frame (ORF) is shown in reverse orientation.
TABLE-US-00029 (SEQ ID NO: 10) CTTACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATCTGTCTATTTCGTTCATCCATAGT TGCCTGACTCCCCGTCGTGTAGATAACTACGATACGGGAGGGCTTACCATCTGGCCCCAGCGCTGCGA TGATACCGCGAGAACCACGCTCACCGGCTCCGGATTTATCAGCAATAAACCAGCCAGCCGGAAGGGC CGAGCGCAGAAGTGGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTAATTGTTGCCGGGAAGCTAG AGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGCCATCGCTACAGGCATCGTGGTGTCACG CTCGTCGTTTGGTATGGCTTCATTCAGCTCCGGTTCCCAACGATCAAGGCGAGTTACATGATCCCCCAT GTTGTGCAAAAAAGCGGTTAGCTCCTTCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTT ATCACTCATGGTTATGGCAGCACTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTGT GACTGGTGAGTACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGG CGTCAATACGGGATAATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTGGAAAACGTTCT TCGGGGCGAAAACTCTCAAGGATCTTACCGCTGTTGAGATCCAGTTCGATGTAACCCACTCGTGCACC CAACTGATCTTCAGCATCTTTTACTTTCACCAGCGTTTCTGGGTGAGCAAAAACAGGAAGGCAAAATG CCGCAAAAAAGGGAATAAGGGCGACACGGAAATGTTGAATACTCATATTCTTCCTTTTTCAATATTAT TGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATAAACA AATAGGGGTCAGTGTTACAACCAATTAACCAATTCTGAACATTATCGCGAGCCCATTTATACCTGAAT ATGGCTCATAACACCCCTTGCAGTGCGACTAACGGCATGAAGCTCGTCGGGGCGTACG.
[0714] 9B. Sequence of kanamycin (kan), derived from vector pJ31 from DNA2.0 (Menlo Park, Calif.). The open reading frame (ORF) is shown in reverse orientation.
TABLE-US-00030 (SEQ ID NO: 11) CTTAGAAAAACTCATCGAGCATCAAATGAAACTGCAATTTATTCATATCAGGATTATCAATAC CATATTTTTGAAAAAGCCGTTTCTGTAATGAAGGAGAAAACTCACCGAGGCAGTTCCATAGGATGGCA AGATCCTGGTATCGGTCTGCGATTCCGACTCGTCCAACATCAATACAACCTATTAATTTCCCCTCGTCA AAAATAAGGTTATCAAGTGAGAAATCACCATGAGTGACGACTGAATCCGGTGAGAATGGCAAAAGTT TATGCATTTCTTTCCAGACTTGTTCAACAGGCCAGCCATTACGCTCGTCATCAAAATCACTCGCATCAA CCAAACCGTTATTCATTCGTGATTGCGCCTGAGCGAGGCGAAATACGCGATCGCTGTTAAAAGGACAA TTACAAACAGGAATCGAGTGCAACCGGCGCAGGAACACTGCCAGCGCATCAACAATATTTTCACCTGA ATCAGGATATTCTTCTAATACCTGGAACGCTGTTTTTCCGGGGATCGCAGTGGTGAGTAACCATGCATC ATCAGGAGTACGGATAAAATGCTTGATGGTCGGAAGTGGCATAAATTCCGTCAGCCAGTTTAGTCTGA CCATCTCATCTGTAACATCATTGGCAACGCTACCTTTGCCATGTTTCAGAAACAACTCTGGCGCATCGG GCTTCCCATACAAGCGATAGATTGTCGCACCTGATTGCCCGACATTATCGCGAGCCCATTTATACCCAT ATAAATCAGCATCCATGTTGGAATTTAATCGCGGCCTCGACGTTTCCCGTTGAATATGGCTCATATTCT TCCTTTTTCAATATTATTGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTAT TTAGAAAAATAAACAAATAGGGGTCAGTGTTACAACCAATTAACCAATTCTGAACATTATCGCGAGCC CATTTATACCTGAATATGGCTCATAACACCCCTTGCAGTGCGACTAACGGCATGAAGCTCGTCGGGGA AATAATGATTTTATTTTGACTGATAGTGACCTGTTCGTTGCAACAAATTGATAAGCAATGCTTTCTTAT AATGCCAACTTTGTACAAGAAAGCTGGGTTTTTTTTTTAGCCTGCTTTTTTGTACAAAGTTGGCATTATA AAAAAGCATTGCTCATCAATTTGTTGCAACGAACAGGTCACTATCAGTCAAAATAAAATCATTATTT.
[0715] 10. A moiety used for determination of episomal copy number per cell. Ideally, the moiety contains a sequence that exists uniquely in the genome. Shown below are 2 fragments, beta actin and G6PDH that can be used in vectors known in the art or described herein. Each fragment is bounded by a BsiWI and a Cla I site.
[0716] beta actin moiety
TABLE-US-00031 (SEQ ID NO: 12) CGTACGTACTCCTGCTTGCTGATCCACATCTGCTGGAAGGTGGACAGCGA GGCCAGGATGGAGCCGCCGATCCACACGGAGTACTTGCGCTCAGGAGGAG CAATGAAGCTTATCTGAGGAGGGAAGGGGACAGGCAGTGAGGACCCTGGA TGTGACAGCTCCAAGCTTCCACACACCACAGGACCCCACAGCCGACCTG CCCAGGTCAGCTCAGGCAGGAAAGACACCCACCTTGATCTTCATTGTGC TGGGTGCCAGGGCAGTGATCTCCTTCTGCATCCTGTCATCGAT.
[0717] Human glucose-6-phosphate dehydrogenase (hG6PDH) moiety
TABLE-US-00032 (SEQ ID NO: 13) CGTACGAGGTGAGGCTGCAGTTCCATGATGTGTCCGGCGACATCTTCCAC CAGCAGTGCAAGCGCAACGAGCTGGTGATCCGCGTGCAGCCCAACGAGG CCGTGTACCAGAGAAGGAGCAGTGTGGAGGGTGGGCGGCCTGGGCCCG GGGGACTCCACATGGTGGCAGGCAGTGGCATCAGCAAGACACTCTCTC CCTCACAGAACGTGAAGCTCCCTGACGCCTACGAGCGCCTCATCCTGGA CGTCTTCTGCGGGAGCCAGATGCACTTCGTGCGCAGGAATCGAT.
[0718] 11. pSV, immediate early promoter from SV40. The sequence is preceded by a BstBI site and followed by an NgoMIV site.
TABLE-US-00033 (SEQ ID NO: 14) TTCGAAGCTGTGGAATGTGTGTCAGTTAGGGTGTGGAAAGTCCCCAGGCTCCCCAGCAGGCAG AAGTATGCAAAGCATGCATCTCAATTAGTCAGCAACCAGGTGTGGAAAGTCCCCAGGCTCCCCAGCAG GCAGAAGTATGCAAAGCATGCATCTCAATTAGTCAGCAACCATAGTCCCGCCCCTAACTCCGCCCATC CCGCCCCTAACTCCGCCCAGTTCCGCCCATTCTCCGCCCCATGGCTGACTAATTTTTTTTATTTATGCAG AGGCCGAGGCCGCCTCGGCCTCTGAGCTATTCCAGAAGTAGTGAGGAGGCTTTTTTGGAGGCCTAGGC TTTTGCAAAAAGCTCTGACCCCTCACAAGGAGCCGGC.
[0719] Ig Enhancers. Representative Ig enhancer sequences include the heavy or light chain enhancers. The Kappa 3' enhancer region (Ek3') (See Meyer, K. B. and Neuberger, M. S., EMBO J. 8 (7), 1959-1964 (1989)), and Kappa intronic enhancer region, Eki LOCUS L80040 7466 bp ROD 2 Sep. 2003 are shown below by way of example. At least 1 major active element within the enhancer regions is the E box sequence:
CAGGTG(N)13CAGGTG [core sequence: CANNTG] Storb et al., Immunity 19:235-242, 2003). The Ek3' and Eki enhancer elements are obtained from Dr. Neuberger (MRC, UK). The Ek3' sequence is amplified by PCR from Neuberger plasmid identification #1352, using the following primers, which contain an XhoI and EcoRI site, respectively, that are used for cloning: GACTACCTCGAGccagcttaggctacacagag (SEQ ID NO: 276) and GTAGTCGAATTCCCACATGTCTTACATGGTATATG (SEQ ID NO: 277).
[0720] The Eki enhancer sequence is amplified from Dr. Neuberger's vector (identification #Me123) using oligonucleotides GACTACGAATTCtcctgaggacacagtgatag (SEQ ID NO: 278) and GTAGTCGCGGCCGCCTAGTTCCTAGCTACTTCTTTA (SEQ ID NO: 279), which encode an EcoRI and NotI restriction site, respectively. Resulting fragments are digested with the appropriate restriction enzyme, and cloned sequentially into mcs2 (described in below): Ek3' is cloned into the XhoI and EcoRI sites of mcs2, and the resulting plasmid is then digested with EcoRI plus Nod into which the Eki fragment is subsequently ligated to generate vector AB156.
[0721] As described above, E boxes are known to be present in the kappa enhancer region. Consequently, a synthetic cassette consisting of 3 tandemly arrayed E boxes is synthesized using the complementary oligonucleotides AATTCaggtgctggggtagggagcaggtgctacactgcagaccaggtgctGC (SEQ ID NO: 280) and ggccgcagcacctggtctgcagtgtagcacctgctccctaccccagcacctg (SEQ ID NO: 281), which when annealed contain EcoRI and NotI overhangs. The annealed oligo product is thus cloned into the EcoRI and NotI sites of mcs2 to generate vector AB157.
[0722] A representative Ig-kappa locus 3' enhancer element is listed below. (Accession number X15878)
TABLE-US-00034 (SEQ ID NO: 282) CCAGCTTAGGCTACACAGAGAAACTATCTAAAAAATAATTACTAACTACTTAATAGGAGATTG GATGTTAAGATCTGGTCACTAAGAGGCAGAATTGAGATTCGAAGCCAGTATTTTCTACCTGGTATGTTT TAAATTGCAGTAAGGATCTAAGTGTAGATATATAATAATAAGATTCTATTGATCTCTGCAACAACAGA GAGTGTTAGATTTGTTTGGAAAAAAATATTATCAGCCAACATCTTCTACCATTICAGTATAGCACAGAG TACCCACCCATATCTCCCCACCCATCCCCCATACCAGACTGGTTATTGATTTTCATGGTGACTGGCCTG AGAAGATTAAAAAAAGTAATGCTACCTTATTGGGAGTGTCCCATGGACCAAGATAGCAACTGTCATAG CTACCGTCACACTGCTTTGATCAAGAAGACCCTTTGAGGAACTGAAAACAGAACCTTAGGCACATCTG TTGCTTTCGCTCCCATCCTCCTCCAACAGCCTGGGTGGTGCACTCCACACCCTTTCAAGTTTCCAAAGC CTCATACACCTGCTCCCTACCCCAGCACCTGGCCAAGGCTGTATCCAGCACTGGGATGAAAATGATAC CCCACCTCCATCTTGTTTGATATTACTCTATCTCAAGCCCCAGGTTAGTCCCCAGTCCCAATGCTTTTGC ACAGTCAAAACTCAACTTGGAATAATCAGTATCCTTGAAGAGTTCTGATATGGTCACTGGGCCCATAT ACCATGTAAGACATGTGG.
[0723] A representative Kappa intronic enhancer region, Eki is presented below:
TABLE-US-00035 (SEQ ID NO: 283) TCCTGAGGACACAGTGATAGGAACAGAGCCACTAATCTGAAGAGAACAGAGATGTGACAGAC TACACTAATGTGAGAAAAACAAGGAAAGGGTGACTTATTGGAGATTTCAGAAATAAAATGCATTTATT ATTATATTCCCTTATTTTAATTTTCTATTAGGGAATTAGAAAGGGCATAAACTGCTTTATCCAGTGTTAT ATTAAAAGCTTAATGTATATAATCTTTTAGAGGTAAAATCTACAGCCAGCAAAAGTCATGGTAAATAT TCTTTGACTGAACTCTCACTAAACTCCTCTAAATTATATGTCATATTAACTGGTTAAATTAATATAAATT TGTGACATGACCTTAACTGGTTAGGTAGGATATTTTTCTTCATGCAAAAATATGACTAATAATAATTTA GCACAAAAATATTTCCCAATACTTTAATTCTGTGATAGAAAAATGTTTAACTCAGCTACTATAATCCCA TAATTTTGAAAACTATTTATTAGCTTTTGTGTTTGACCCTTCCCTAGCCAAAGGCAACTATTTAAGGAC CCTTTAAAACTCTTGAAACTACTTTAGAGTCATTAAGTTATTTAACCACTTTTAATTACTTTAAAATGAT GTCAATTCCCTTTTAACTATTAATTTATTTTAAGGGGGGAAAGGCTGCTCATAATTCTATTGTTTTTCTT GGTAAAGAACTCTCAGTTTTCGTTTTTACTACCTCTGTCACCCAAGAGTTGGCATCTCAACAGAGGGGA CTTTCCGAGAGGCCATCTGGCAGTTGCTTAAGATCAGAAGTGAAGTCTGCCAGTTCCTCCCAGGCAGG TGGCCCAGATTACAGTTGACCTGTTCTGGTGTGGCTAAAAATTGTCCCATGTGGTTACAAACCATTAGA CCAGGGTCTGATGAATTGCTCAGAATATTTCTGGACACCCAAATACAGACCCTGGCTTAAGGCCCTGT CCATACAGTAGGTTTAGCTTGCTACACCAAAGGAAGCCATACAGAGGCTAATACCAGAGTATTCTTG GAAGAGACAGGAGAAAATGAAAGCCAGTTTCTGCTCTTACCTTATGTGCTTGTGTTCAGACTCCCAAA CATCAGGAGTGICAGATAAACTGGTCTGAATCTCTGTCTGAAGCATGGAACTGAAAAGAATGTAGTTT CAGGGAAGAAAGGCAATAGAAGGAAGCCTGAGAATATCTTCAAAGGGTCAGACTCAATTTACTTTCTT AAAGAAGTAGCTAGGAACTAG.
[0724] C. Vector Construction
[0725] Vector Format 1. The functional elements described below are ordered as 7 synthetic DNA fragments, each cloned into vector pJ2 or pJ15 from DNA2.0 (Menlo Park, Calif.). Both pJ vectors contain a colE1 E. coli origin of replication and a selectable marker (amp for pJ15, kan for pJ2); the sequences of each have been altered by DNA2.0 to minimize restriction sites. The pJ vector inserts are designed to contain one or more of the genetic elements listed below for the final vector construct bounded by restriction sites that allowed for the correct assembly of fragments in the desired order.
[0726] Vector F1, a covalently closed circular plasmid, contains (in order): DNA2.0 vector pJ15 (which contains the colE1 on and amp resistance marker), restriction sites BsiWI, SacI, BsrGI, NgoMIV, XbaI, BamHI, MluI, approximately 800 bp of the EBV oriP, and AflII (see FIG. 35A).
[0727] Insert F2 contains approximately 880 bp of the oriP, including a highly repetitive portion, from the natively encoded restriction sites Mlu I to Nsi I. This fragment is recovered from a clone purchased from the American Type Culture Collection (catalog number ATCC 59562) using restriction sites Mlu I to Nsi I.
[0728] Insert F3 is reclaimed from pJ2 and encodes the SV40 3' untranslated region and poly adenylation signals (3'ut/pA), a BamHI restriction site, and the remaining portion of the oriP. The fragment is bounded by NsiI and XbaI sites.
[0729] Insert F4 is reclaimed from pJ2 and contains the eukaryotic antibiotic resistance marker puromycin-N-acetyl-transferase (pur) bounded by restriction sites NgoMIV and XbaI.
[0730] Insert F5 is reclaimed from pJ15 and contains the EMCV IRES sequence bounded by restriction sites NgoMIV and BsrGI.
[0731] Insert F6 is reclaimed from pJ15 and contains a synthetic version of the teal fluorescent protein open reading frame (hotTFP) that has been altered to render it more susceptible to somatic hypermutation (SHM), and thus the appellation "hot." The fragment is delineated by BsrGI and SacI restriction sites.
[0732] Vector F7, a covalently closed circular plasmid, contains (in order): DNA2.0 vector pJ15 (which contains the amp resistance marker and colE1 ori), restriction sites AflII, BamHI, XbaI, NgoMIV, BsrGI, SacI, multicloning site region 1 (mcs1), CMV immediate early promoter, multicloning site region 2 (mcs2), beta actin (3 actin) moiety for determination of episomal copy number per cell, BsiWI (see FIG. 35B).
[0733] The Mcs1 contains the following restriction sites: (5') SbfI, PmeI, BglII, SacII, SpeI, BsmBI, and SacI (3'). Mcs2 contains (5') ClaI, XhoI, BclI, EcoRI, AgeI, NotI, and NheI (3').
[0734] The prototypic vector AB102 is assembled as described below using standard molecular biological manipulations: All final constructs are confirmed by sequence analysis.
[0735] 1. A triple ligation is performed to incorporate inserts F5 (reclaimed with BsrG I and NgoM IV) and F6 (reclaimed with Sac I and BsrG I) into vector F7 to make vector ANA113.
[0736] 2. A second triple ligation is performed to integrate inserts F2 (Mlu I Nsi I) and F3 (Nsi I to Xba I) into vector F1 to generate vector ANA110.
[0737] 3. A double ligation is performed to include insert F4 (from Xba I to NgoMIV) in vector ANA110, thus generating vector ANA 119.
[0738] 4, Finally, a double ligation is performed to assimilate the insert from ANA113 above (BsiW I to NgoM IV) into the BsiW I and NgoM IV cut vector ANA119 to generate AB102.
[0739] The judicious placement of restriction sites renders AB102 highly modular (see FIGS. 36A and 36B). Consequently, most subsequent vector formats (i.e. vector formats 2-4) are, in some cases, generated by simple fragment exchange. For example, the open reading frames for blasticidin S deaminase (cold bsd) and hygromycin phosphotransferase (cold hyg) are synthesized at DNA2.0 using codons that are SHM resistant, as described herein (thus the designation "cold"). Both of these markers are bounded by restriction sites NgoMIV and XbaI and are therefore easily cloned in place of pur (also delineated by NgoMIV and XbaI) to generate versions of the vectors that confer resistance to bsd and hyg, respectively.
[0740] Similarly, other genes of interest are synthesized so as to be bordered on the 5' side by one of the unique restriction sites in mcs1 plus BsrGI or AscI at the 3' end. Such genes cloned into the position initially occupied by TFP (FIGS. 36A and 36B) included other fluorescent proteins (GFP, and "GFP*" [a GFP that contains an in frame stop codon in lieu of tyr82]), immunoglobulins such as antibody heavy or light chains, activation induced cytidine deaminase (AID, also known as AICDA), and the reverse tetracycline transactivatable protein (rtTA).
[0741] There are several versions of beta actin and G6PDH, differing by length, that permit the simultaneous identification and quantification of more than one episomal vector. Each version is cloned into the same location using the BsiWI and ClaI sites,
[0742] Different varieties of the CMV immediate early promoter (i.e. versions in which the SacI, and BsrGI restriction sites have been eliminated, and versions that include more or fewer nucleotides at the 5' end of the enhancer region are swapped in and out of AB vector series constructs by using NheI and SbfI, which are unique restriction sites found in mcs2 (5') and mcs1(3'), respectively.
[0743] Vector Format 5. AB184, a derivative of AB102, is an archetypical example of a vector in which expression of a gene of interest can be induced by addition of doxycycline (dox) (FIG. 37A). AB184 differs from AB102 in the following ways:
[0744] The TFP open reading frame is replaced with a cold codon version of the rtTA coding region (see, e.g., Gossen and Bujard, Proc Natl Acad Sci USA. (1992) 89(12):5547-51; Gossen et al., Science (1995) 268 (5218):1766-9). The rtTA gene is synthesized at DNA2.0 in vector pJ2 and is reclaimed by PCR amplification such that BglII is included as a cloning site on the 5' (sense) primer and AscI included on the 3' (antisense) primer. The PCR fragment is cloned into the BglII (found in mcs1) and AscI sites of AB102 (FIG. 38).
[0745] The hyg open reading frame is synthesized with cold codon usage, and with 5' NgoMIV and 3' XbaI sites in pJ2 bp DNA2.0) to make vector ANA112. The hyg insert from this vector replaced pur as the selectable marker (FIG. 38) in AB184.
[0746] ANA112 is also used to supply the prokaryotic resistance marker kan. A BsiWI site is added 5' to the kan marker by site directed mutagenesis (SDM) to generate ANA136. The contiguous kan and colE1 fragment is reclaimed from ANA136 using BsiWI and AflII and replaced the homologous amp-colE1 fragment in AB102 to generate the kan resistant precursor to AB184.
[0747] A BstBI site is added next to the unique AflII site (order of elements: kan-colE1-AflII-BstBI . . . )
[0748] Finally, a dox-inducible cold canine AID expression cassette is created and added to the vector at the AflII site found between the oriP and colE1 ori. The steps to do this are described below.
[0749] Vector F10 is synthesized at DNA2.0 and contains the following elements (in order): i. colE1 on and kan marker from pJ2; ii. SacI site; iii. the human growth hormone (hGH) minimal promoter (sequence ACAGTGGGAGAGAAGGGGCCAGGGTATAAAAAGGGCCCACAAGAGACCAGCTCAAGGATTCCAAGG C; SEQ ID NO: 284); iv. SpeI site; v. canine AID with cold codon usage, and a single mutation (L198A) that disables the nuclear export signal; and vi. AgeI site.
[0750] Vector F10 contained an unwanted AflII site 3' to the AgeI site (FIG. 37B). This site is removed by site directed mutagenesis. An AflII site is added by site directed mutagenesis 5' to the SacI site to generate ANA165.
[0751] A 7-fold repeat of the tet operator elements, including the minimal hGH promoter sequence listed in (a) above is synthesized at DNA2.0 in plasmid pJ51 to generate vector 7xprtTA. The insert order is (5') AflII-7× prtTA operator elements-SacI-hGH promoter- and SpeI (3'). The 7× repeat is reclaimed from pJ51 with AflII and SpeI and cloned into the cognate sites of ANA165 to generate ANA209 (FIG. 38).
[0752] To complete the expression cassette, a triple ligation is performed that included (1) AflII-cut and CIP (calf intestinal phosphatase) treated vector pJ15; plus (2) Insert 7xprtTA-coldCanine AIDnes(-) from Age I to Afl II; plus (3) PCR amplified 3' ut/pA fragment (originally synthesized as insert F3, in which Age I (5') and Afl II (3') restriction sites are incorporated into the PCR primers. This created vector ANA285.
[0753] Finally, the entire inducible expression cassette (which contained in order the following genetic markers: AflII-7xprtTA-canine AID-3' ut/pA-AflII) is reclaimed from ANA285 by PCR using oligos that include BstBI sites and span the AflII site on the 5' side. The reclaimed insert thus had the following genetic elements: AflII-BstBI-7xprtTA-canine AID-3' ut/pA-AflII-BstBI. This PCR amplified product is digested with BstBI and is cloned into the unique BstBI site in the AB184 precursor described in step (3) above to generate AB184 (FIG. 37A). (Note: the AflII site at the 3' end of the cassette is part of the cloning vector and is not carried into the final construct by the PCR amplified insert).
Example 6
Application of SHM to Generation of Novel Lantibiotic Synthesis
[0754] The evolution of bacteria with resistance to existing therapeutic regimens has sparked interest in the discovery and development of novel antibiotics. Ideal candidates for further research are those that act via multiple modes of action, making resistance significantly more difficult to attain. One such antibiotic is Nisin.
[0755] Nisin is a natural product of Lactococcus lactic, a lantibiotic with a broad spectrum of activity against Gram-positive bacteria, commonly used in food preservation against such pathogens as Listeria monocytogenes and Clostridium botulinum. (BAVIN et al., Lancet. 1952 Jan. 19; 1(3):127-9) Nisin is a ribosomally translated and post-translated peptide, which despite decades of use by the food industry, has not seen the induction of common resistance mechanisms. This finding is likely a result of two facts: one, the mode of action of Nisin biocidal activity comes from its'binding to Lipid II and secondary induction of pore formation, (Breukink et al., Nat Rev Drug Discov. 2006 April; 5(4):321-32). Lipid II is a bacterial cell-wall component that is not easily modified by Gram-positive bacteria and whose use forms a rate-limiting step in the generation of the bacterial cell wall. Nisin also acts to inhibit spore formation.
[0756] Nisin is currently in preclinical development for the treatment of several bacterial pathogens. It displays a spectrum of activity towards several pathogens, including multi drug-resistant Streptococcus pneumoniae, vancomycin-resistant Enterococcus faecium, and Strepococcus pyogenes, all areas where new therapeutics are desperately needed (Goldstein et al., J. Antimicrob. Chemother. 1998 August; 42(2):277-8). In one study, Nisin was shown to be 8-16 times more potent in the treatment of S. pneumoniae (in mice) than vancomycin (Brumfitt et al., J Antimicrob Chemother. 2002 November; 50(5):731-4).
[0757] Despite these promising features, Nisin and other lantibotics suffer from several important limitations. Bacteria, even closely related (isogenic) species, display a significant variation in their sensitivity to Nisin and other lantibiotics. Secondly, Nisin is cleared quickly from mammalian circulatory system. For Nisin to become a truly efficacious therapeutic, it will need to have improved pharmacodynamic properties with a broad spectrum of biocidal activity. Here we discuss application of SHM to engineer a Nisin with improved qualities.
[0758] Biosynthesis of bioactive Nisin has been to shown to be dependent on only five L. lactis proteins, NisA, NisB, NisC, NisP, and NisT (Kuipers et al., J Biol. Chem. 2004 Can 21; 279(21):22176-82; Rink et al., Biochemistry. 2005 Jun. 21; 44(24):8873-82). NisA encodes for a precursor peptide which is dehydrated at several serine and threonine positions by NisB, leading to a modified peptide that is cyclized at five positions by NisC. Finally the pro-antibiotic has its leader peptide cleaved by protease NisP, and is excreted to the media by transporter NisT (see FIG. 47A). The five thioester rings, each catalyzed by NisC, are termed lanthionines, and define the lantibiotic family of modified peptide antibiotics.
[0759] The modular nature of this pathway, easy assay for bioactivity, broad specificity and activity of the dehydratase and cyclase NisB and NisC, make this an ideal target for SHM driven co-evolution to produce novel antibiotic constructs. In one approach such a strategy could be based on making certain genes, or portions of genes more susceptible to SHM, while making other genes, or portions of those genes, resistant to SHM.
[0760] The amino acid sequences of the 5 genes involved in Nisin biosynthesis are shown below: In these sequences, bold residues indicate those positions to be made hot to SHM, while underlined residues are those to be made cold to SHM.
[0761] NisA, Native Gene >NisA|gi|530218|gb|AAA26948.1| nisin [Lactococcus lactis]
TABLE-US-00036 (SEQ ID NO: 285) MSTKDFNLDLVSVSKKDSGASPRITSISLCTPGCKTGALMGCNMKTAT CHCSIHVSK
[0762] NisC, Native Gene >NisC|gi|44045|emb|CAA48383.1| nisC [Lactococcus lactis]
TABLE-US-00037 (SEQ ID NO: 286) MRIMMNKKNIKRNVEKIIAQWDERTRKNKENFDFGELTLSTGLPGIILMLAELKNKDNSKIYQKKI DNYIEYIVSKLSTYGLLTGSLYSGAAGIALSILHLREDDEKYKNLLDSLNRYIEYFVREKIEGFNLENITPPDY DVIEGLSGILSYLLLINDEQYDDLKILIINFLSNLTKENNGLISLYIKSENQMSQSESEMYPLGCLNMGLAHGL AGVGCILAYAHIKGYSNEASLSALQKIIFIYEKFELERKKQFLWKDGLVADELKKEKVIREASFIRDAWCYG GPGISLLYLYGGLALDNDYFVDKAEKILESAMQRKLGIDSYMICHGYSGLIEKSLFKRLLNTKKFDSYMEE FNVNSEQILEEYGDESGTGFLEGISGCILVLSKFEYSINFTYWRQALLLFDDFLKGGKRK
[0763] NisB, Native Gene >gi|473018|emb|CAA79468.1| NisB protein [Lactococcus lactis]
TABLE-US-00038 (SEQ ID NO: 287) MIKSSFICAQPFLVRNTILSPNDKRSFTEYTQVIETVSKNKVFLEQLLLANPKLYNVMQKYNAGLLK KKRVKKLFESIYKYYKRSYLRSTPFGLFSETSIGVFSKSSQYKLMGKITKGIRLDTQWLIRLVHKMEVDFSK KLSFTRNNANYICFGDRVFQVYTINSSELEEVNIKYTNVYQIISEFCENDYQKYEDICETVTLCYGDEYRELS EQYLGSLIVNHYLISNLQKDLLSDFSWDTFLTKVEAMEDKKYIIPLKKVQKFIQEYSEIEIGEGIEKLKEIYQE MSQILENDNYIQEDLISDSEINFDVKQKQQLEHLAEFLGNTTKSVRRTYLDDYKDKFIEKYGVDQEVQITELF DSTFGIGAPYNYNHPRNDFYESEPSTLYYSEEEREKYLSMYVEAVKNHNVINLDDLESHYQKMDLEKKSEL QGLELFLNLAKEYEKDIFILGDIVGNNNLGGASGRFSALSPELTSYHRTIVDSVERENENKEITSCEIVFLPEN- I RHANVMHTSIMRRKVLPFFTSTSHNEVQLTNIYIGIDEKEKFYARDISTQEVLKFYITSMYNKTLFSNELRFL YEISLDDKFGNLPWELIYRDFDYIPRLVFDEIVISPAKWKIWGRDVNNMTIRELIQSKEIPKEFYIVNGDNK VYLSQENPLDMEILESAIKKSSKRKDFIELQEYFEDENIINKGQKGRVADVVVPFIRTRALGNEGRAFIREKR VSVERREKLPFNEWLYLKLYISINRQNEFLLSYLPDIQKIVANLGGKLFFLRYTDPKPHIRLRIKCSDLFLAYG SILEILKRSQKNRIMSTFDISIYDQEVERYGGFDTLELSEAIFCADSKIIPNLLTLIKDTNNDWKVDDVSILVN- Y LYLKCFFQNDNKKILNFLNLVSPKKVKENVNEKIEHYLKLLKVDNLGDQIFYDKNFKELKHAIKNLFLKMI AQDFELQKVYSIIDSIIHVHNNRLIGIERDKEKLIYYTLQRLFVSEEYMK
[0764] NisP, Native Gene>gi|730155|sp|Q07596|NISP_LACLA Nisin leader peptide-processing serine protease nisP precursor
TABLE-US-00039 (SEQ ID NO: 288) MKKILGFLFIVCSLGLSATVHGETTNSQQLLSNNINTELINHNSNAILSSTEGSTTDSINLGAQSPAV KSTTRTELDVTGAAKTLLQTSAVQKEMKVSLQETQVSSEFSKRDSVTNKEAVPVSKDELLEQSEVVVSTSSI QKNKILDNKKKRANFVTSSPLIKEKPSNSKDASGVIDNSASPLSYRKAKEVVSLRQPLKNQKVEAQPLLISN SSEKKASVYTNSHDFWDYQWDMKYVTNNGESYALYQPSKKISVGIIDSGIMEEHPDLSNSLGNYFKNLVP KGGFDNEEPDETGNPSDIVDKMGHGTEVAGQITANGNILGVAPGITVNIYRVFGENLSKSEWVARAIRRAA DDGNKVINISAGQYLMISGSYDDGTNDYQEYLNYKSAINYATAKGSIVVAALGNDSLNIQDNQTMINFLKR FRSIKVPGKVVDAPSVFEDVIAVGGIDGYGNISDFSNIGADAIYAPAGTTANFKKYGQDKGVSQGYYLKDW LFTTANTGWYQYVYGNSFATPKVSGALALVVDKYGIKNPNQLKRFLLMNSPEVNGNRVLNIVDLLNGKN KAFSLDTDKGQDDAINHKSMENLKESRDTMKQEQDKEIQRNTNNNFSIKNDFNISDEVISVDYNINQKMA NNRNSRGAVSVRSQEILPVTGDGEDFLPALGIVCISILGILKRKTKN
[0765] NisT, Native Gene>gi/44044|emb|CAA48382.1| nisT [Lactococcus lactis]
TABLE-US-00040 (SEQ ID NO: 289) MDEVKEFTSKQFFYTLLTLPSTLKLIFQLEKRYAIYLIVLNAITAFVPLASLFIYQDLINSVLGSGRHL INIIIIYFIVQVITTVLGQLESYVSGKFDMRLSYSINMRLMRTTSSLELSDYEQADMYNIIEDVTQDSTYKPFQ LFNAIIVELSSFISLLSSLFFIGTWNIGVAILLLIVPVLSLVLFLRVGQLEFLIQWQRASSERETWYIVYLLTH- DF SFKEIKLNNISNYFIHKFGKLKKGFINQDLAIARKKTYFNIFLDFILNLINILTIFAMILSVRAGKLLIGNLVS- LI QAISKINTYSQTMIQNIYIIYNTSLFMEQLFEFLKRESVVHKKIEDTEICNQHIGTVKVINLSYVYPNSNAFAL KNINLSFEKGELTAIVGKNGSGKSTLVKIISGLYQPTMGIIQYDKMRSSLMPEEFYQKNISVLFQDFVKYELT IRENIGLSDLSSQWEDEKIIKVLDNLGLDFLKTNNQYVLDTQLGNWFQEGHQLSGGQWQKIALARTFFKKA SIYILDEPSAALDPVAEKEIFDYFVALSENNISIFISHSLNAARKANKIVVMKDGQVEDVGSHDVLLRRCQYY QELYYSEQYEDNDE
[0766] NisB, N is P and NisT
[0767] As described above, the creation of SHM resistant (cold) versions of the essential genes NisP and NisT means that these genes will tend to mutate at a lower rate than SHM-susceptible genes that are targeted for diversity generation. Both NisP and NisT currently have broad specificity for the Nisin and do not add to the potential diversity of the post-translationally modified peptide. In this initial example, NisB is also made SHM-resistant; however, it could also be selectively mutated following the same guidelines outlined below for NisA. Native and SHM-resistant polynucleotides of NisB are provided in FIGS. 39A and 40A, respectively, together with the initial analysis of hot spot and cold spot frequency (FIGS. 39B and 40B), respectively. Native and SHM-resistant polynucleotides of NisP are provided in FIGS. 41A and 42A, respectively, together with the initial analysis of hot spot and cold spot frequency (FIGS. 41B and 42B), respectively.
[0768] NisA Peptide
[0769] As shown above, the majority of the leader peptide region of the NisA peptide can be made resistant to AID-mediated mutagenesis because this sequence is absolutely necessary for substrate recognition by NisBCPT. The bulk of the remainder of the NisA peptide sequence can be made susceptible to AID-mediated mutagenesis, or alternatively, as shown above key residues involved in the generation of the lanthionines can be made SHM-resistant thereby reducing the rate of their mutagenesis.
[0770] Corresponding unmodified and SHM-resistant (cold) polynucleotide versions of the NisA polynucleotide sequence are shown in FIGS. 44A and 44D, respectively. The initial analysis of the unmodified hot spot and cold spot frequency (FIGS. 44B and 44C), respectively, are compared to the SHM-resistant hot spot and cold spot frequency (FIGS. 44E and 44F), respectively. Codon optimization of NisA results in the creation of 20 cold spots and elimination of all but one hot spot in the leader sequence, and the creation of 17 hot spots, compared to 8 hot spots in the wild type sequence, in the rest of the molecule.
[0771] NisC Protein
[0772] Regions of NisC involved in substrate recognition and cyclization, such as those outlined above as bold residues, and as shown in FIG. 47B, can be made hot (susceptible) to AID-mediated mutation, so that they have a greater probability of generating mutants with alternate activities and specificities thereby creating mature Nisin molecules with altered modifications and bioactivity. Structural areas that govern only stability of the protein can be made cold. Corresponding unmodified and SHM-resistant (cold) polynucleotide versions of the NisC polynucleotide sequence are shown in FIGS. 45A and 46A, respectively. The initial analysis of the unmodified hot spot and cold spot frequency (FIGS. 45B and 45C), respectively, are compared to the SHM-resistant hot spot and cold spot frequency (FIGS. 46B and 46C), respectively.
[0773] A specific example of the creation of a targeted hot spot in this gene is shown below:
[0774] In this example, using SHMredesign, an additional hot spot has been inserted into the region of interest (LSTG) and a cold spot has been removed. Additionally the flanking sequence has been made significantly more SHM resistant.
TABLE-US-00041 (SEQ ID NO: 290) ..N..F..D..F..G..E..L..T..L..S..T..G..L..P..G amino acid sequence Native polynucleotide sequence: HhhhhhhhhhhhhhhhHhhhhhhhhhhhhHhhhhhhhhhhhhHhh hot spots cccccccCcccccCCcCccccCcCcCcCccccccCCccccccccc cold spots Optimized polynucleotide sequence: HhhhhhhhhhhhhhhhHhhhhhhhhhhHhHhhhhhhhhhhhhhh hot spots ccccccCcccccCCcCccCcccCcccCcccccccCcCcCCccCc cold spots
[0775] After final review to ensure that the synthetic polynucleotide sequence is free of extraneous restriction sites, the complete synthetic polynucleotide sequences can be synthesized (DNA 2.0, Menlo Park, Calif.), and cloned appropriate cloning vectors and sequenced to confirm correct synthesis.
[0776] Synthetic genes can then be introduced into expression vectors and transformed into an appropriate bacterial strain, for example a Lactococcus lactis strains as previously described (Mota-Meira et al., FEBS Lett. 1997 Jun. 30; 410(2-3):275-9) together with AID, (Besmer et al., Mol Cell Biol. 2006 June; 26(11):4378-85) or an AID homolog such as an Apobec-1 enzyme.
[0777] Screening can be accomplished by allowing the SHM mediated generated diversity to evolve L. lactis co-cultured with Gram positive bacterial targets that are currently poorly targeted by Nisin. Eventually strains of L. lactis will evolve that comprise mutated Nisin genes with enhanced activity against the chosen bacterial target.
[0778] Mass spectroscopy of the supernatant of evolved cell-cultures can be used to assess the progress of the process (i.e., identified novel lantibiotics with improved activity to a pathogen).
Example 7
Application of SHM to the Generation of Improved Receptors
[0779] Receptors bind ligands and encompass a broad genus of polypeptides including, but not limited to, cell-bound receptors such as antibodies (B cell receptors), T cell receptors, Fc receptors, G-coupled protein receptors, cytokine receptors, etc.
[0780] Fc receptors (FcR) are a family of related receptors that are specific for the Fc portion of immunoglobulin (Ig) molecules. Receptors have been defined for each of the immunoglobulin classes and, as such are defined by the class of Ig of which they bind: Fc gamma receptors (FcγR) bind gamma immunoglobulin (IgG), Fc epsilon receptors (FcεR) bind epsilon immunoglobulin (IgE), Fc alpha receptors (FcαR) bind alpha immunoglobulin (IgA).
[0781] Fcγ receptors are expressed on most hematopoietic cells and, via binding of IgG, play an important role in homeostasis of the immune system and unmodified host protection against infection. Three subfamily members of FcγR receptors have been identified: (1) FcγRI, which is a high affinity receptor for IgG; (2) FcγRII, which is a low affinity receptor for IgG that avidly binds to aggregates of immune complexes; and (3) FcγRIII, which is a low affinity receptor that binds to immune complexes. In spite of being structurally related, the receptors perform different functions.
[0782] Three subclasses of FcγR have been identified: FcγRI (CD64), FcγRII (CD32) and FcγRIII (CD16). Because each FcγR subclass is encoded by two or three genes, and alternative RNA spicing leads to multiple transcripts, a broad diversity in FcγR isoforms exists. The three genes encoding the FcγRI subclass (FcγRIA, FcγRIB and FcγRIC) are clustered in region 1q21.1 of the long arm of chromosome 1; the genes encoding FcγRII isoforms (FcγRIIA, FcγSHM and FcγRIIC) and the two genes encoding FcγRIII (FcγRIIIA and FcγRIIIB) are all clustered in region 1q22. These different FcR subtypes are expressed on different cell types (reviewed in Ravetch and Kinet, Annu. Rev. Immunol. 9:457-492 (1991)). For example, in humans, FcγRIIIB is found only on neutrophils, whereas FcγRIIIA is found on macrophages, monocytes, natural killer (NK) cells, and a subpopulation of T-cells. Notably, FcγRIIIA is the only FcR present on NK cells, one of the cell types implicated in ADCC.
[0783] FcγRI, FcγRII and FcγRIII are immunoglobulin superfamily (IgSF) receptors; FcγRI has three IgSF domains in its extracellular domain, while FcγRII and FcγRIII have only two IgSF domains in their extracellular domains.
[0784] Another type of Fc receptor is the neonatal Fc receptor (FcRn). FcRn is structurally similar to major histocompatibility complex (MEC) and consists of an α-chain non-covalently bound to β2-microglobulin.
[0785] The binding site on human and murine antibodies for FcγR have been previously mapped to the so-called "lower hinge region" consisting of residues 233-239 (EU index numbering as in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)). Woof et al. Molec. Immunol. 23:319-330 (1986); Duncan et al. Nature 332:563 (1988); Canfield and Morrison, J. Exp. Med. 173:1483-1491 (1991); Chappel et al., Proc. Natl. Acad. Sci USA 88:9036-9040 (1991).
[0786] Other amino acid residues considered to be involved in binding to FcγR include: G316-K338 (human IgG) for human FcγRI (Woof et al. Molec. Immunol. 23:319-330 (1986)); K274*R301 (human IgG1) for human FcγRIII (based on peptides) (Sarcan et al. Molec. Immunol. 21:43-51 (1984)); Y407-R416 (human IgG) for human FcγRIII (based on peptides) (Gergely et al. Biochem. Soc. Trans. 12:739-743 (1984)); as well as N297 and E318 (murine IgG2b) for murine FcγRII (Lund et al., Molec. Immunol., 29:53-59 (1992)). In one case, Pro331 in IgG3 is mutated to Ser, and the affinity of this modified IgG3 to target cells analyzed: the affinity is found to be six fold lower than that of unmutated IgG3, indicating the involvement of Pro331 in FcγRI binding. Morrison et al., Immunologist, 2:119-124 (1994); and Canfield and Morrison, J. Exp. Med. 173:1483-91 (1991).
[0787] Compounds that interfere with the dimerization interface between two FcγRII proteins can affect cellular signal transduction through one or both of the FcR proteins. Specifically, amino acid residues 117-131 and 150-164 of FcγRII are thought to be the interfacial area of the FcγIIa dimer, and compounds which can mimic or bind to these regions are considered to be good binding modulators (see U.S. Pat. No. 6,835,753).
[0788] In one aspect, synthetic polynucleotides encoding at least a portion of the Fc regions of a plurality of IgG molecules can be modified to increase susceptibility of that portion to somatic hypermutation using the methods described herein to create modified IgG molecules exhibiting increased binding affinity for this region of FcγRIIa.
[0789] In another aspect, polypeptides encoded by such SHM-modified polynucleotides are considered herein. In one embodiment, the SHM-modified IgG includes a synthetic polynucleotide encoding the hexapeptide sequence Phe121 to Ser126 or shorter segments spanning a region with significant hydrogen bonding interactions, in which the polynucleotide has been optimized for SHM. Such Ig molecules are suitable modulators of dimerization between two FcγRIIa molecules.
[0790] The upper portion of the FG loop of FcR has been shown to be involved in Ig binding as demonstrated by mutagenesis studies. The FG peptide strand contains an extended β-sheet which projects the amino acid side chains in the FG loop in a defined orientation such described in U.S. Pat. No. 6,675,105, entitled "3 Dimensional Structure, and Models of Fc Receptors and Uses Thereof." Molecules which can act as β-turn mimics and which present their side chains at the top of the FG loop in the same way as those in the receptor have also been found to be effective in modulating the FcR receptor activities.
[0791] In one aspect, polynucleotides encoding a PF peptide strand containing an extended β-sheet which projects the amino acid side chains in the FG loop in a defined orientation can be modified to increase susceptibility to somatic hypermutation using the methods described herein to create modified polypeptides exhibiting increased binding affinity for this region of FcR. In another aspect, polypeptides encoded by such SHM-modified polynucleotides are considered herein.
[0792] Fc receptors play roles in normal immunity and resistance to infection and provide the humoral immune system with a cellular effector arm. Binding of an Ig gamma (IgG) to FcγR can lead to disease indications that are associated with regulation by FcγR. For example, the autoimmune disease thrombocytopenia purpura involves tissue (platelet) damage resulting from FcγR-dependent IgG immune complex activation of platelets or their destruction by FcγR+ phagocytes. In addition, various inflammatory diseases are known to involve IgG immune complexes (e.g., rheumatoid arthritis and systemic lupus erythematosus), including type II and type III hypersensitivity reactions. Type II and type III hypersensitivity reactions are mediated by IgG, which can activate either complement-mediated or phagocytic effector mechanisms, leading to tissue damage.
[0793] Due to the role of FcRs in a variety of biological mechanisms, there is a need for compounds which affect the binding of immunoglobulins to FcR and which can be used to treat a variety of illnesses associated with regulation by FcRs.
[0794] Fc receptor modulators (modulators of Fc receptor binding of immunoglobulins) can modulate FcαR, FcεR and FcγR polypeptides. Polynucleotides encoding Fc receptor modulators of FcαR, FcεR and FcγR polypeptides can be modified to increase and/or decrease susceptibility of one or more portions of the polypeptide to somatic hypermutation using the methods described herein. Modified Fc receptor modulators made using such methods can be assayed to identify modulators exhibiting modified binding and activity. In one aspect, the FcR modulator interacts with a FcγRI, a FcγRII and/or a FcγRIII. In a further aspect, the FcR modulator interacts with a FcγRIIa, a FcγRIIb and/or a FcγRIIc. Fc receptor modulators provided herein can be used in a variety of applications including treatment or diagnosis of any disease where aggregates of antibodies are produced and where immune complexes are produced by contact of antibody with intrinsic or extrinsic antigen. Non-limiting treatments and diagnosis applicable by the Fc receptor modulators include immune complex diseases; autoimmune diseases including but not limited to rheumatoid arthritis, systemic lupus erythematosus, immune thrombocytopenia, neutropenia, hemolytic anemias; vasculitities including but not limited to polyarteritis nodosa, systemic vasculitis; xenograft rejection; and infectious diseases where FcR uptake of virus enhances infection including but not limited to flavivirus infections such as Dengue virus-dengue hemorrhagic fever and measles virus infection. The Fc receptor modulators can also be used to reduce IgG-mediated tissue damage and to reduce inflammation.
[0795] The SHM-modified Fc receptor modulators presented herein can also enhance leukocyte function by enhancing FcR function such as antibody dependent cell mediated cytotoxicity, phagocytosis and release of inflammatory cytokines. Treatments and diagnosis for enhanced FcR function include any infection where normal antibodies are produced to remove the pathogen; and any disease requiring FcR function where unmodified or recombinant antibodies can be used in treatment such as cancer and infections. For example, an immunoglobulin (e.g., normal Ig or SHM-modified Ig) can be administered in combination with a Fc receptor modulator (e.g., a SHM modified modulator) to enhance the effect of the immunoglobulin treatment.
[0796] In another aspect, FcR are involved in the complement pathway via C1q Binding. C1q and two serine proteases (C1r and C1s) form the complex C1, the first component of the Complement Dependent Cytotoxicity (CDC) pathway. To activate the complement cascade, it is necessary for C1q to bind to at least two molecules of IgG1, IgG2, or IgG3, but only one molecule of IgM, attached to an antigenic target (Ward and Ghetie, Therapeutic Immunology 2:77-94 (1995) at page 80). Based upon the results of chemical modifications and crystallographic studies, Burton et al. (Nature, 288:338-344 (1980)) proposed that the binding site for the complement subcomponent C1q on IgG involves the last two (C-terminal) β-strands of the CH2 domain. Burton later proposed (Molec. Immunol., 22(3):161-206 (1985)) that the region including amino acid residues 318 to 337 might be involved in complement fixation. In one aspect provided herein are SHM-modified Ig molecules (e.g., IgG1, IgG2, or IgG3 or IgM) that have been modified such that they exhibit increased affinity for the antigenic target, increased binding to C1q, or both. Such modified Ig molecules can be tested in one or more art-recognized assays to evaluate changes in binding and/or biological activity compared to the starting Ig.
[0797] Assays for testing a SHM-modified Fc receptor modulator include those known in the art for testing compounds that modulate Fc receptor activity such as, for example, binding assays, platelet aggregation inhibition assays, assessment of ADCC activity, assessment of C1q binding, as well as other assays to test binding and function as described below. Binding and activity of SHM-modified Fc receptor modulators can be compared to control Ig molecules.
[0798] Binding Assay
[0799] In one example, the interaction between recombinant soluble FcγRIIa and human immunoglobulin in the presence of SHM-modified Fc receptor modulators are investigated using a BIAcore 2000 biosensor (Pharmacia Biotech, Uppsala, Sweden) at 22° C. in Hepes buffered saline [HBS: 10 mM Hepes (pH 7.4), 150 mM NaCl, 3.4 mM EDTA, 0.005% Surfactant P20 (Pharmacia)]. Monomeric human IgG1, IgG3, and IgE (50 μg/mL) (non-specific binding control) are covalently coupled to the carboxymethylated dextran surface of the CM-5 sensor-chip (BIAcore, Uppsala, Sweden) using the amine coupling protocol (BIAcore, Uppsala, Sweden). An additional channel is chemically treated using the coupling protocol. Recombinant soluble FcγRIIa is used at a concentration of 125 μg/mL, which is equivalent to 50% binding capacity. Recombinant soluble FcγRIIa is preincubated with each of the SHM-modified Fc receptor modulators at room temperature for 30 minutes before being injected over the sensor-chip surface for 1 minute at 10 μL/min followed by a 3 minute dissociation phase. All surfaces are regenerated with 50 mM diethylamine (about pH 11.5), 1 M NaCl between each of the compounds being analyzed. The maximum response for each interaction is measured. Non-specific binding responses (IgE channel) are subtracted from binding to IgG1 and IgG3. Measurements are corrected for differences in buffer composition between the SHM-modified Fc receptor modulators and receptor.
[0800] Platelet Aggregation Inhibition
[0801] Platelet aggregation inhibition can be tested using art-recognized assays such as described herein. Briefly, the procedure involves adding a test compound to a mixture of the platelets and HAGG compared to a control compound. This procedure illustrates the ability of the test compound to inhibit platelet aggregate formation as well as its ability to break apart the platelet aggregates which have formed prior to the addition of the compound compared to controls.
[0802] Platelets express a single class of gamma receptors, FcγRIIa. Following the cross-linking of FcγRIIa, platelets undergo a variety of biochemical and cellular modifications that culminate in aggregation. The capacity of the compounds to inhibit platelet activation is measured using an assay that specifically measures platelet aggregation.
[0803] Briefly, platelets are isolated as follows: 30 mL of fresh whole blood is collected into citrated collection vials and centrifuged at 1000 rpm for ten minutes. The platelet rich plasma is separated and centrifuged at 2000 rpm for five minutes in four tubes. The supernatants are removed and the platelets are gently re-suspended in 2 mL of Tyrodes buffer-per tube (137 mM NaCl, 2.7 mM KCl, 0.36 mM NaH2PO4, 0.1% dextrose, 30 mM sodium citrate, 1.0 mM MgCl2.6H2O, pH 6.5) and centrifuged again at 2000 rpm for five minutes. The supernatants are again removed and platelets are re-suspensed in 0.5 mL of Hepes containing Tyrodes buffer per tube (137 mM NaCl, 2.7 mM KCl, 0.36 mM NaH2PO4, 0.1% dextrose, 5 mM Hepes, 2 mM CaCl2 1.0 mM MgCl2.6H2O, pH 7.35). The platelet count is determined using a haematolog analyzer (Coulter) and adjusted to a concentration of approximately 100×105 platelets/mL using the Hepes containing Tyrodes buffer.
[0804] For each aggregation experiment, a mixture of 50 μL of a Fc receptor agonist, heat aggregated gamma globulin ("HAGG," 200 μg/mL) or collagen (2 μg/mL) is incubated with 50 μL of phosphate buffered saline ("PBS": 3.5 mM NaH2PO4, 150 mM NaCl) or BRI compound (5 mg/mL in PBS) for 60 minutes at room temperature. The assay is then performed using a two cell aggregometer at 37° C. as follows: glass cuvettes are placed in holders and pre-warmed to 37° C. and 400 μL of the platelet suspension added. After a stable baseline is reached, 100 μL of HAGG:PBS, HAGG:BRI compound or collagen:PBS, collagen:BRI compound are added to the platelet suspension. The subsequent aggregation of the platelets is monitored for 15 minutes or until aggregation is complete. The rate of aggregation is determined by measuring the gradient of the aggregation slope.
[0805] Assessment of ADCC Activity
[0806] To assess ADCC activity of a SHM-modified Fc receptor modulator, an in vitro ADCC assay can be performed using varying effector:target ratios. Useful "effector cells" for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the polypeptide variant can be assessed in vivo, e.g., in a animal model such as that disclosed by Clynes et al. PNAS (USA) 95:652-656 (1998).
[0807] For example, to prepare chromium 51-labeled target cells, tumor cell lines are grown in tissue culture plates and harvested using sterile 10 mM EDTA in PBS. SK-BR-3 cells, a 3+ HER2-overexpressing human breast cancer cell line, are used as targets in all assays. The detached cells are washed twice with cell culture medium. Cells (5×106) are labeled with 200 μCi of chromium51 (New England Nuclear/DuPont) at 37° C. for one hour with occasional mixing. Labeled cells are washed three times with cell culture medium, then are re-suspended to a concentration of 1×105 cells/mL. Cells are used either without opsonization, or are opsonized prior to the assay by Incubation with rhuMAb HER2 wild-type (HERCEPTINT®) or SHM-modified FcR modulators in PBMC assay or in NK assay.
[0808] Peripheral blood mononuclear cells are prepared by collecting blood on heparin from normal healthy donors and dilution with an equal volume of phosphate buffered saline (PBS). The blood is then layered over LYMPHOCYTE SEPARATION MEDIUM® (LSM: Organon Teknika) and centrifuged according to the manufacturer's instructions. Mononuclear cells are collected from the LSM-plasma interface and are washed three times with PBS. Effector cells are suspended in cell culture medium to a final concentration of 1×107 cells/mL.
[0809] After purification through LSM, natural killer (NK) cells are isolated from PBMCs by negative selection using an NK cell isolation kit and a magnetic column (Miltenyi Biotech) according to the manufacturer's instructions. Isolated NK cells are collected, washed and re-suspended in cell culture medium to a concentration of 2×106 cells/mL. The identity of the NK cells is confirmed by flow cytometric analysis.
[0810] Varying effector:target ratios are prepared by serially diluting the effector (either PBMC or NK) cells two-fold along the rows of a microliter plate (100 μL final volume) in cell culture medium. The concentration of effector cells ranges from 1.0×107/mL to 2.0×104/mL for PBMC and from 2.0×106/mL to 3.9×103/mL for NK. After titration of effector cells, 100 μL of chromium 51-labeled target cells (opsonized or non-oponsonized) at 1×105 cells/mL are added to each well of the plate. This results in an initial effector:target ratio of 100:1 for PBMC and 20:1 for NK cells. All assays are run in duplicate, and each plate contains controls for both spontaneous lysis (no effector cells) and total lysis (target cells plus 100 μL) 1% sodium dodecyl sulfate, 1 N sodium hydroxide). The plates are incubated at 37° C. for 18 hours, after which the cell culture supernatants are harvested using a supernatant collection system (Skatron Instrument, Inc.) and counted in a Minaxi auto-gamma 5000 series gamma counter (Packard) for one minute. Results are then expressed as percent cytotoxicity using the formula: % Cytotoxicity=(sample cpm-spontaneous lysis)/(total lysis-spontaneous lysis)×100 Four-parameter curve-fitting is then used to evaluate the data (KaleidaGraph 3.0.5).
[0811] C1q Binding
[0812] The ability of the variant to bind C1q and mediate complement dependent cytotoxicity (CDC) can be assessed. To determine C1q binding, a C1q binding ELISA can be performed. Briefly, assay plates are coated overnight at 4° C. with SHM modified Fc receptor modulator or control polypeptide in coating buffer. The plates are then be washed and blocked. Following washing, an aliquot of human C1q is added to each well and incubated for 2 hrs at room temperature. Following a further wash, 100 μl of a sheep anti-complement C1q peroxidase conjugated antibody is added to each well and incubated for 1 hour at room temperature. The plate is then washed with wash buffer and 100 μl of substrate buffer containing OPD (O-phenylenediamine dihydrochloride (Sigma)) is added to each well. The oxidation reaction, observed by the appearance of a yellow color, is allowed to proceed for 30 minutes and stopped by the addition of 100 μl of 4.5 NH2SO4. The absorbance is then read at (492-405) nm.
[0813] Binding and Biological Activity
[0814] The SHM modified Fc receptor modulator can then be subjected to one or more assays to evaluate any change in binding and biological activity compared to the starting polypeptide.
[0815] In one example, the SHM modified Fc receptor modulator essentially retains the ability to bind receptor compared to the non-modified polypeptide, i.e. the binding capability is no worse than about 20 fold, e.g. no worse than about 5 fold of that of the non-modified polypeptide. The binding capability of the SHM modified Fc receptor modulator is determined using techniques such as fluorescence activated cell sorting (FACS) analysis or radioimmunoprecipitation (RIA), for example.
[0816] To determine receptor binding, a polypeptide comprising at least the binding domain of the receptor of interest (e.g. the extracellular domain of an α subunit of an FcR) is coated on solid phase, such as an assay plate. The binding domain of the receptor alone or a receptor-fusion protein is coated on the plate using standard procedures. Examples of receptor-fusion proteins include receptor-glutathione S-transferase (GST) fusion protein, receptor-chitin binding domain fusion protein, receptor-hexaHis tag fusion protein (coated on glutathione, chitin, and nickel coated plates, respectively). Alternatively, a capture molecule is coated on the assay plate and used to bind the receptor-fusion protein via the non-receptor portion of the fusion protein. Examples include anti-hexaHis F(ab')2 coated on the assay plate used to capture receptor-hexaHis tail fusion or anti-GST antibody coated on the assay plate used to capture a receptor-GST fusion. In other embodiments, binding to cells expressing at least the binding domain of the receptor is evaluated. The cells can be naturally occurring hematopoietic cells that express the FcR of interest or can be transformed with nucleic acid encoding the FcR or a binding domain thereof such that the binding domain is expressed at the surface of the cell to be tested.
[0817] The immune complex described herein above is added to the receptor-coated plates and incubated for a sufficient period of time such that the polypeptide binds to the receptor. Plates are then washed to remove unbound complexes, and binding of the analyte is detected according to known methods. For example, binding is detected using a reagent (e.g. an antibody or fragment thereof which binds specifically to the analyte, and which is optionally conjugated with a detectable label--detectable labels and methods for conjugating them to polypeptides are described below in the section entitled "Non-Therapeutic Uses for the Polypeptide Variant").
[0818] Low Affinity Receptor Binding Assay
[0819] Binding of an IgG Fc region to recombinant FcγRIIA, FcγRIIB and FcγRIIIA α subunits expressed as His6-glutathione S transferase (GST)-tagged fusion proteins can be determined. Since the affinity of the Fc region of IgG1 for the FcγRI is in the nanomolar range, the binding of SHM-modified IgG1 Fc can be measured by titrating monomeric IgG and measuring bound IgG with a polyclonal anti-IgG in a standard ELISA format. The affinity of the other members of the FcγR family, i.e. FcγRIIA, FcγRIIB and FcγRIIIA for IgG, is however in the micromolar range and binding of monomeric IgG1 for these receptors can not be reliably measured in an ELISA format.
[0820] FcγR Binding ELISAs
[0821] FcγRI α subunit-GST fusion is coated onto Nunc F96 maxisorb plates (cat no. 439454) by adding 100 μl of receptor-GST fusion at 1 μg/ml in PBS and incubated for 48 hours at 4° C. Prior to assay, plates are washed 3× with 250 μl of wash buffer (PBS pH 7.4 containing 0.5% TWEEN 20) and blocked with 250 μl of assay buffer (50 mM Tris buffered saline, 0.05% TWEEN 20, 0.5% RIA grade bovine albumin (Sigma A7888), and 2 mM EDTA pH 7.4). Samples diluted to 10 μg/ml in 1 ml of assay buffer are added to FcγRI α subunit coated plates and incubated for 120 minutes at 25° C. on an orbital shaker. Plates are washed 5× with wash buffer to remove unbound complexes and IgG binding is detected by adding 100 μl horse radish peroxidase (HRP) conjugated goat anti-human IgG heavy chain specific (Boehringer Mannheim 1814249) at 1:10,000 in assay buffer and incubated for 90 min at 25° C. on an orbital shaker. Plates are washed 5× with wash buffer to remove unbound HRP goat anti-human IgG and bound anti-IgG is detected by adding 100 μl of substrate solution (0.4 mg/ml o-phenylenedaimine dihydrochloride, Sigma P6912, 6 mM H2O2 in PBS) and incubating for 8 min at 25° C. Enzymatic reaction is stopped by the addition of 100 μl 4.5N NH2SO4 and calorimetric product is measured at 490 nm on a 96 well plate densitometer (Molecular Devices). Binding of SHM-modified FcR modulators is expressed as a percent of the parent molecule (i.e., wild-type or previously modified).
[0822] FcRn Binding ELISA
[0823] For measuring FcRn binding activity of IgG variants, ELISA plates are coated with 2 μg/ml streptavidin (Zymed, South San Francisco) in 50 mM carbonate buffer, pH 9.6, at 4° C. overnight and blocked with PBS-0.5% BSA, pH 7.2 at room temperature for one hour. Biotinylated FcRn (prepared using biotin-X-NHS from Research Organics, Cleveland, Ohio and used at 1-2 μg/ml) in PBS-0.5% BSA, 0.05% polysorbate 20, pH 7.2, is added to the plate and incubated for one hour. Two fold serial dilutions of IgG standard (1.6-100 ng/ml) or variants in PBS-0.5% BSA, 0.05% polysorbate 20, pH 6.0, are added to the plate and incubated for two hours. Bound IgG is detected using peroxidase labeled goat F(ab')2 anti-human IgG F(ab')2 in the above pH 6.0 buffer (Jackson ImmunoResearch, West Grove, Pa.) followed by 3,3',5,5'-tetramethyl benzidine (Kirgaard & Perry Laboratories) as the substrate. Plates are washed between steps with PBS-0.05% polysorbate 20 at either pH 7.2 or 6.0. Absorbance is read at 450 nm in a Vmax plate reader (Molecular Devices, Menlo Park, Calif.). Titration curves are fit with a four-parameter nonlinear regression curve-fitting program (KaleidaGraph, Synergy software, Reading, Pa.). Concentrations of IgG variants corresponding to the mid-point-absorbance of the titration curve of the standard are calculated and then divided by the concentration of the standard corresponding to the mid-point absorbance of the standard titration curve.
Example 8
Use of AID for Enzymatic Pathway Optimization
[0824] Using the SHM systems described herein, polynucleotides encoding one or more enzymes can be simultaneously modified via somatic hypermutation to increase the speed or efficiency of metabolic conversions. Enzymes involved in pathways of interest include, for example, those associated with yeast fermentation, antibiotics and clean-up of oil spills (see, for example, Ho, .N. W. Y., Chen Z. and A. Brainard. 1998. Appl. and Environ. Microbiol. 64:1852-1859; and Sonderegger M. and U. Sauer. 2003. Appl. And Environ. Microbiol. 69:1990-1998).
[0825] In one aspect, to develop a commercially viable yeast fermentation system for converting plant-based cellulosic biomass to ethanol, Saccharomyces cerevisiae that have been genetically engineered to use xylose as a substrate can be further modified by step-wise induction of somatic hypermutation followed by selection for the ability to grow anaerobically using xylose as the sole carbon source present in the growth medium.
[0826] One advantage of ethanol is that it is a non-fossil biofuel that produces less pollution than gasoline. Another advantage is that ethanol can be produced from readily available, renewable cellulosic biomass from plant material. Cellulosic biomass is composed of pentose sugars (mainly glucose and xylose). A major obstacle to developing a commercial process for converting cellulosic biomass to ethanol, however, is that Saccharomyces species of yeast (the microorganisms currently used for large scale industrial production of ethanol from glucose) are currently unable to ferment ethanol from xylose with high yields and specific rates.
[0827] Metabolic engineering has been used successfully to develop strains of Saccharomyces cerevisiae that can ferment both xylose and arabinose to ethanol. However, none of the recombinant strains or any other naturally-occurring yeast strains have been able to grow anaerobically on xylose alone.
[0828] Provided herein is a method of somatic hypermutation of one or more of the genes of the xylose utilization pathway to create recombinant strains of anaerobic xylose-utilizing eukaryotes such as Saccharomyces cerevisiae that can grow anaerobically on xylose alone and ferment xylose and arabinose to ethanol.
[0829] In one aspect, step-wise somatic hypermutation can be used to develop a yeast strain that is capable of anaerobic growth on xylose alone. In one non-limiting embodiment, a strain of Saccharomyces cerevisiae that over-expresses the three enzymes from Pichia stipitis that act sequentially to convert xylose to xylulose 5-phosphate (a substrate that Saccharomyces species are able to ferment). The resulting xylose-utilizing yeast strain has utility for significantly improving ethanol fermentations and commercially viable ethanol production from plant-based cellulosic biomass.
[0830] Briefly, an inducible activation-induced cytidine deaminase (AID) SHM-resistant polynucleotide sequence is introduced into the starting yeast strain by stable chromosomal insertion and then step-wise somatic hypermutation by AID is induced with monitoring of culture growth and xylose utilization between steps. The growth rate of the culture is monitored by measuring optical density at 600 nanometers. Xylose utilization is monitored using a commercially available enzymatic kit (Medichem, Steinenbronn, Germany) to measure xylose in the culture medium.
[0831] The next step is initiated when the culture growth rate and xylose utilization increase, for example, about 2-fold. An aerobic chemostat culture containing 5 grams xylose per liter and 1 gram glucose per liter is prepared. AID expression is induced for about 10, about, 15, or about 20 generations (i.e., approximately 6-12 days). The number of generations for induction of AID expression can be determined based on reversion data, DT40 screening data (Cumbers et al. Nat. Biotechnol. 2002 November; 20(11): 1129-1134)) and the yeast growth rate of 1.73 generations/day. At the point where the culture growth rate increases and the xylose is consumed, a culture aliquot is withdrawn and a new aerobic chemostat culture containing 5 grams per liter xylose as the sole carbon source is inoculated. AID expression is induced in this culture for about 10, about, 15, or about 20 generations. Again, the culture is monitored for growth rate and xylose concentration. When a growing population that consumes the xylose is obtained, the aeration rate is dropped to less than 1 milliliter per minute and AID expression is again induced for about 10, about, 15, or about 20 generations. When the growth rate of the culture stabilizes, a culture aliquot is withdrawn and a new aerobic chemostat culture containing 5 grams per liter xylose as the sole carbon source is inoculated and grown in the absence of any aeration and with induction of AID expression for about 10, about, 15, or about 20 generations. The culture growth rate and xylose utilization are monitored.
[0832] When the growth rate of the culture starts to increase and the xylose concentration decreases, a culture aliquot is withdrawn and a strict anaerobic batch culture in a 17 milliliter Pyrex glass tube sealed with butyl rubber septa and plastic screw cap is inoculated with xylose as the sole carbon source. AID expression is induced for about 10, about, 15, or about 20 generations and the culture is monitored for growth rate and xylose utilization. When the culture growth rate increases and the xylose concentration decreases an aliquot of the population is plated on anaerobic minimal medium agar plates containing 20 grams per liter xylose as the sole carbon source. The plates are incubated at 30° Celsius in sealed jars using, for example, the GasPack Plus System (Becton Dickinson) to provide an anaerobic atmosphere. The anaerobic atmosphere is monitored using indicator strips (Becton Dickinson).
[0833] The fermentation performance of the parental strain along with the evolved populations, and 15 clones isolated from the anaerobic xylose plates are compared in anaerobic batch cultures with 50 grams per liter of glucose and 50 grains of xylose per liter. The growth rate, xylose and glucose utilization of the cultures are monitored. Glucose utilization is determined using a commercial kit (Beckman).
[0834] The last step of SHM is to take the clone that has the best growth and xylose utilization characteristics, induce AID expression, and grow in multiple serial batch cultures for about 15 generations. Twenty clones isolated from this culture are then grown on xylose as the sole carbon source in strictly anaerobic culture conditions. The performance of clones with the fastest growth rates are further evaluated in anaerobic xylose batch cultures.
Example 9
Application of SHM for Affinity Maturation of Antibodies
[0835] As described previously, antibodies provide an unmodified template through which SHM can be applied to create mutant proteins with enhanced properties. Such improved antibodies can be selected based upon affinity selection, for example via FACS or via binding to magnetic beads.
[0836] Antibodies directed towards hen egg lysozyme (HyHel) represent an extremely well characterized system that enables the testing and optimization of the mutation and selection systems of the present invention. Specifically the HyHel antibodies enable the testing of a number of highly related antibodies that exhibit a well defined range of affinities and have characterized sequences and binding properties. For example, the following antibodies, and sequence variants thereof (muteins) have fully defined sequences starting from the germline sequence to the fully affinity mature antibody, see, e.g., Pons et al., (1999) Protein Science 8:958-68; and Smith-Gill et al., (1984) J. Immunology 132:963.
TABLE-US-00042 TABLE 16 Hen Egg Lysozyme antibody constructs (HyHEL) Construct Published Light Chain Name Affinity Heavy Chain Identity Identity HyHEL10 0.03 nM Heavy Chain ("wild type") Light Chain ("wild type") Mutein 1 66 nM Heavy Chain ("wild type") Light Chain (Y50A) Mutein 2 167 nM Heavy Chain ("wild type") Light Chain (N32A) Mutein 3 460 nM Heavy Chain ("wild type") Light Chain (N31E) Mutein 4 800 nM Heavy Chain (Y33A) Light Chain ("wild type") Mutein 5 7,000 nM Heavy Chain (Y50A) Light Chain ("wild type") Germline unknown (Germline sequence) (Germline sequence)
[0837] To further optimize the system of the present invention, a range of high and low affinity HyHel constructs are made and cloned into the expression vectors of the present invention. These vectors are then transfected into mutator cells expressing AID and selected using magnetic beads. Wild type HyHEL constructs are used as positive controls to optimize binding conditions and validate assay methodology.
[0838] A. Synthesis and Cloning of ("Wild Type") HyHEL10 Heavy and Light Chain Constructs.
[0839] The prototypic HyHEL10 heavy chain and light chain expression vectors are created starting from the expression vector AB102, (as described previously), using standard molecular genetic manipulations as follows:
[0840] The puromycin resistance marker in AB102 is replaced with cold bsd or cold hyg using the NgoMIV and XbaI restriction sites, to generate the vectors AB187 and AB185, respectively.
[0841] A slightly longer, transcriptionally more robust version of the CMV promoter is exchanged for the original sequence found in AB102 using NheI (the mcs2 restriction site most proximal to the CMV promoter) and SbfI (the most CMV-proximal mcs1 site). The original AB102 CMV promoter included 553 bp of the unmodified CMV sequence upstream from the first T of the TATA box, while the AB187 version includes 645 bp upstream from the first T of the TATA box.
[0842] The nucleotide sequences for the "wild type" HyHEL heavy and light chains (as disclosed above) are synthesized at DNA 2.0, (Menlo Park, Calif.). For cloning purposes, the heavy chain is bordered by BglII and AscI, and the light chain is bounded by restriction sites SacI and AscI.
[0843] In order to express HyHEL10 IgG and its muteins on the cell surface, the heavy chain is created as a chimeric molecule with the following features:
[0844] Kozak consensus sequence; HyHEL10 heavy chain variable region; full-length murine IgG1 constant region; XhoI site; Murine H2kk (MHC type I) peri-transmembrane domain, transmembrane domain and cytoplasmic domain. The H2kk sequences is determined from accession number AK153419 at the National Center for Biotechnology Information (NCBI) nucleotide database.
[0845] The nucleotide sequence of the full length chimeric, cell-surface associated HyHEL10 heavy chain is as listed below:
[0846] In this sequence, the BglII site is underlined; Kozak sequence is underlined and italicized; stop codon is underlined and bolded; XhoI site is indicated by boxed nucleotides; Double underlined sequences are derived from H2kk. The AscI cloning site 3' to the TGA stop codon is indicated by italicized nucleotides.
TABLE-US-00043 (SEQ ID NO: 291) AGATCTGCTTGAATCCGCGGATAAGAGGACTAGTATTCGTCTCACTAGGGAGAGCTCACCACC ATGAACAAGTTGCTGTGCTGCGCGCTCGTGTTTCTGGACATCTCCATTAAGTGGACCACCCAGGACGTG CAGCTTCAGGAGTCAGGACCTAGCCTCGTGAAACCTTCTCAGACTCTGTCCCTCACCTGTTCTGTCACT GGCGACTCCATCACCAGTGATTACTGGAGCTGGATCCGGAAATTCCCAGGGAATAGACTTGAGTACAT GGGGTACGTAAGCTACAGTGGTAGCACTTACTACAATCCATCTCTCAAAAGTCGAATCTCCATCACCC GAGACACATCCAAGAACCAGTACTACCTGGATTTGAATTTCTGTGACTACTGAGGACACAGCCACATAT TACTGTGCAAACTGGGACGGTGATTACTGGGGCCAAGGGACTCTGGTCACTGTCTCTGCAGCCAAAAC GACACCCCCATCTGTCTATCCACTGGCCCCTGGATCTGCTGCCCAAACTAACTCCATGGTGACCCTGGG ATGCCTGGTCAAGGGCTATTTCCCTGAGCCAGTGACAGTGACCTGGAACTCTGGATCCCTGTCCAGCG GTGTGCACACCTTCCCAGCTGTCCTGCAGTCTGACCTCTACACTCTGAGCAGCTCAGTGACTGTCCCCT CCAGCCCTCGGCCCAGCGAGACCGTCACCTGCAACGTTGCCCACCCGGCCAGCAGCACCAAGGTGGAC AAGAAAATTGTGCCCAGGGATTGTGGTTGTAAGCCTTGCATATGTACAGTCCCAGAAGTATCATCTGT CTTCATCTTCCCCCCAAAGCCCAAGGATGTGCTCACCATTACTCTGACTCCTAAGGTCACGTGTGTTGT GGTAGACATCAGCAAGGATGATCCCGAGGTCCAGTTCAGCTGGTTTGTAGATGATGTGGAGGTGCACA CAGCTCAGACGCAACCCCGGGAGGAGCAGTTCAACAGCACTTTCCGCTCAGTCAGTGAACTTCCCATC ATGCACCAGGACTGGCTCAATGGCAAGGAGTTCAAATGCAGGGTCAACAGTGCAGGTTCCCCTGCCCC CATCGAGAAAACCATCTCCAAAACCAAAGGCAGACCGAAGGCTCCACAGGTGTACACCATTCCACCTC CCAAGGAGCAGATGGCCAAGGATAAAGTCAGTCTGACCTGCATGATAACAGACTTCTTCCCTGAAGAC ATTACTGTGGAGTGGCAGTGGAATGGGCAGCCAGCGGAGAACTACAAGAACACTCAGCCCATCATGA ACACGAATGGCTCTTACTTCGTCTACAGCAAGCTCAATGTGCAGAAGAGCAACTGGGAGGCAGGAAA TACTTTCACCTGCTCTGTGTTACATGAGGGCCTGCACAACCACCATACTGAGAAGAGCCTCTCCCACTC ##STR00001## TGGAGCTGCAATAGTCACTGGAGCTGTGGTGGCTTTTGTGATGAAGATGAGAAGGAGAAACACAGGT GGAAAAGGAGGGGACTATGCTCTGGCTCCAGGCTCCCAGACCTCTGATCTGTCTCTCCCAGATTGTAA AGTGATGGTTCATGACCCTCATTCTCTAGCGTGAGGCCGGCCAAGGCGCGCC.
[0847] The amino acid sequence of the chimeric, cell-surface associated HyHEL10 heavy chain is as listed below. The 2 amino acids (leu-glu) encoded by the synthetic XhoI site are marked by bold-and-underline; the bold-underline Glu also represents the most amino proximal amino acid of the H2kk domain; double underline indicates the putative transmembrane domain; asterisk indicates stop codon.
TABLE-US-00044 (SEQ ID NO: 292) MNKLLCCALVFLDISIKWTTQDVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGY VSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAAKTTPPS VYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSET VTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQF SWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAP QVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSN WEAGNTFTCSVLHEGLHNHHTEKSLSHSPGKLEPPPSTVSNMATVAVLVVLGAAIVTGAVVAFVMKMRR RNTGGKGGDYALAPGSQTSDLSLPDCKVMVHDPHSLA*.
[0848] The amino acid and nucleotide sequence of the ("wild type") HyHEL kappa light chain.
[0849] Amino acid sequence of the HyHEL kappa light chain. Asterisk indicates stop codon.
TABLE-US-00045 (SEQ ID NO: 338) MNKLLCCALVFLDISIKWTTQDIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRL LIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIFPP- S SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNS YTCEATHKTSTSPIVKSFNRNEC*.
[0850] The nucleotide sequence of the HyHEL kappa light chain. Start and stop codons are underlined. SacI and AscI cloning sites are bolded.
TABLE-US-00046 (SEQ ID NO: 293) GAGCTCACCACAATGAACAAGTTGCTGTGCTGCGCGCTCGTGTTTCTGGACATCTCCATTAAG TGGACCACCCAGGATATTGTGCTAACTCAGTCTCCAGCCACCCTGTCTGTGACTCCAGGAAATAGCGT CAGTCTITCCTGCAGGGCCAGCCAAAGTATTGGCAACAACCTACACTGGTATCAACAAAAATCACATG AGTCTCCAAGGCTTCTCATCAAGTATGCTTCCCAGTCCATCTCTGGGATCCCCTCCAGGTTCAGTGGCA GTGGATCAGGGACAGATTTCACTCTCAGTATCAACAGTGTGGAGACTGAAGATTTTGGAATGTATTTC TGTCAACAGAGTAACAGCTGGCCTTACACGTTCGGAGGGGGGACCAAGCTGGAAATAAAACGGGCTG ATGCTGCACCAACTGTATCCATCTTCCCACCATCCAGTGAGCAGTTAACATCTGGAGGTGCCTCAGTCG TGTGCTTCTTGAACAACTTCTACCCCAAAGACATCAATGTCAAGTGGAAGATTGATGGCAGTGAACGA CAAAATGGCGTCCTGAACAGTTGGACTGATCAGGACAGCAAAGACAGCACCTACAGCATGAGCAGCA CCCTCACGTTGACCAAGGACGAGTATGAACGACATAACAGCTATACCTGTGAGGCCACTCACAAGACA TCAACTTCACCCATTGTCAAGAGCTTCAACAGGAATGAGTGTTGAGGCGCGCC.
[0851] Muteins of the "wild type" heavy and light chains, as well as the germline sequence, as described below in Table 17, were created using site directed mutagenesis and their sequence confirmed by sequencing.
TABLE-US-00047 TABLE 17 Hen Egg Lysozyme antibody constructs with measured affinities Mutations DNA Sequence Kd koff kon wt LC/wt HC GGC30-AAC31-AAC32-CTA33 3.93E-11 8.6E-05 2.2E+06 Light chain variants LC G30(silent)N31A/ GGA30-GCT31-AAC32-CTA33 1.48E-09 8.29E-03 5.61E+06 wt HC N31G LC/wt HC GGC30-GGT31-AAC32-CTA33 2.78E-09 1.21E-02 4.33E+06 N31S LC/wt HC GGC30-AGC31-AAC32-CTA33 7.10E-10 9.70E-04 1.40E+06 N32S LC/wt HC GGC30-AAC31-AGC32-CTA33 1.00E-10 1.90E-04 1.90E+06 N32G LC/wt HC GGC30-AAC31-GGT32-CTA33 6.29E-10 2.85E-03 4.53E+06 N31SN32S/wt HC GGC30-AGC31-AGC32-CTA33 2.50E-09 6.10E-03 2.40E+06 LC L33(silent)/wt HC GGC30-AAC31-AAC32-TTA33 5.96E-11 9.33E-05 1.56E+06 N31D LC/wt HC GGC30-GAT31-AAC32-CTA33 1.1E-10 Heavy chain variants wt LC/Y50A HC GGG49-GCC50-GTA51 Not detectable wt LC/Y33A HC GAT32-GCC33-TGG34 2.0E-08 4.45E-02 2.13E+06 Mixed heavy and light chain variants LC N31G/Y33A HC see above 7.0E-06 LC N32G/Y33A HC see above 2.00E-08
[0852] Nucleotides in bold represent codons in which defined mutations were made to introduce SHM optimized codons to increase somatic hypermutation compared to the "wild type" (HyHEL10) sequence ("wt"), as defined below. LC=Light Chain; HC=Heavy Chain. Also shown are the measured affinities of each mutant, obtained via BIACORE analysis.
[0853] These positions have been previously shown to be important for binding and to have been naturally mutated from the corresponding germline sequence during somatic hypermutation. Specifically, the light chain sequence of HyHEL10 contains the residue Asn31 located within CDR1 that makes a thermodynamically important contact to the HEL antigen residue Lys96. The Gly31 mutant (codon GGT) of HyHEL10 has a measured dissociation constant of around 2.5 nM, whereas the Asp31 (codon GAT) mutant of HyHEL10 has a measured dissociation constant of around 110 pM, and the wild-type Asn31 (codon AAC) of HyHEL10 has a measured dissociation constant of around 30 pM.
[0854] B. Transfection of Cells
[0855] Hek 293 cells are plated at 4×105/well, in 6-well microtiter dish. After 24 hrs., transfections are performed using Fugene6 reagent from Roche Applied Sciences (Indianapolis, Ind.) at a reagent-to-DNA ratio of 3 μL:1 μg DNA per well with the expression vectors AB187 and AB185 that comprised the HyHEL heavy and light chains and conferred blasticidin and hygromycin resistance respectively. Transfections are carried out in accordance with manufacturer's protocol.
[0856] C. Selection of Peptides
[0857] An unlabeled and biotinylated monomeric peptide sequence that comprises the majority of the hen egg lysozyme (HEL) binding surface is synthesized. Two dimeric peptide sequences are also synthesized to compare whether presenting the peptide as a dimer would enhance antibody binding by increasing the avidity of the antibody-peptide interaction. A tandem dimer and a branched multiple antigenic peptide (MAP) dimer are also tested. Peptides as well as biotinylatd or unlabeled HEL protein are coupled to paramagnetic polystyrene microparticle surfaces that had been modified with functional groups or coated with streptavidin (Invitrogen, 1600 Faraday Ave., PO Box 6482, Carlsbad, Calif. 92008).
[0858] D. Coupling HEL Protein and Peptides to Tosylactivated Microparticles
[0859] The HEL protein and peptides are coupled to 2.8 micron Tosylactivated paramagnetic polystyrene microparticles in a 1.5 ml microcentrifuge tube (Nilsson K and Mosbach K. "p-Toluenesulfonyl chloride as an activating agent of agarose for the preparation of immobilized affinity ligands and proteins." Eur. J. Biochem. 1980:112: 397-402). The microparticles (2e09 microparticles/milliliter) are washed and re-suspended in 100 mM borate buffer, pH 9.5 at a concentration of 1e09 microparticles/ml. Eleven nanomoles of peptide or 6 ug/ml HEL are added to the microparticles and the microparticle/peptide mixture is incubated at room temperature for at least 48 hours with slow tilt rotation. After incubation, the supernatant is removed and the microparticles are washed with 1 ml phosphate buffered saline solution (PBS), pH 7.2 containing 1% (weight/volume) BSA. Finally, the microparticles are re-suspended in 1 ml PBS solution, pH 7.2 containing 1% (weight/volume) BSA.
[0860] E. Coupling Biotinylated HEL Protein and Peptides to Streptavidin-Conjugated Microparticles
[0861] Another option is to couple biotinylated peptides to paramagnetic polystyrene microparticles whose surfaces have been covalently linked with a monolayer of streptavidin. Briefly, the streptavidin microparticles are washed, re-suspended in 1 ml PBS solution, pH 7.2 containing 1% (weight/volume) BSA and 33 picomoles of biotinylated peptide or approximately 10 μg/ml biotinylated HEL are then added to the microparticle solution. The microparticle/peptide solution is incubated for 30 minutes at room temperature with slow tilt rotation. After coupling, the microparticles are washed and re-suspended to a final microparticle concentration of 1e09 microparticles/ml. (Argarana C E, Kuntz I D, Birken S, Axel R, Cantor C R. Molecular cloning and nucleotide sequence of the streptavidin gene. Nucleic Acids Res. 1986; 14(4):1871-82; Pahler A, Hendrickson W A, Gawinowicz Kolks M A, Aragana C E, Cantor C R. Characterization and crystallization of core streptavidin. J Biol Chem 1987:262(29):13933-7).
[0862] F. Cell Selection
[0863] Transfected HEK 293 cells expressing the 30 pM and 800 nM affinity HyHEL antibody heavy and light chains are screened in order to isolate cells that bind to the peptide-conjugated paramagnetic microparticles. A similar control cell line that did not express antibody is used as a negative control for the selections.
[0864] The cells are washed with an equal volume of PBS solution, pH 7.2 and re-suspended in PBS solution, pH 7.2 containing 1% (weight/volume) BSA to a final cell concentration of 1e07 cells/ml. The cells are pre-cleared by adding 1e06 naked microparticles to the cells and incubating on a rotator at 4° C. for 30 minutes. The unbound cells are gently transferred to a new tube. Peptide-conjugated or naked microparticles (1e07) are transferred into the tube with the cells and the cell:microparticle mixture is incubated on a rotator at 4° C. for 30 minutes. The unbound cells are then removed and the microparticle:cell mixture is washed with cold PBS/1% BSA. The microparticles and attached cells are re-suspended in 100 μl cell culture medium and grown initially in one well of a 96-well plate. The number of microparticle-bound cells is determined and the cells are expanded until the next round of selection. The number of microparticle-bound cells selected on the peptide-conjugated microparticles is compared with cells bound to the naked microparticles and to the cells that do not express antibody.
[0865] FIG. 48A shows cells expressing the 30 pM HyHEL antibody (dark gray) or no antibody (light gray) after selection by incubating with streptavidin microparticles conjugated to the mature HEL protein (Protein), HEL peptide monomer (Monomer), tandem HEL dimer (Tandem), HEL MAPS dimer (MAPS) or naked unconjugated streptavidin microparticles (Naked). The whole HEL protein- and HEL peptide monomer-conjugated microparticles are effective in isolating cells expressing the 30 pM HyHEL antibody in this experiment.
[0866] In FIG. 48B, cells expressing the 800 pM HyHEL antibody (dark gray) or no antibody (light gray) are selected by incubating with tosylactivated microparticles conjugated to either the mature HEL protein (Protein) or naked unconjugated tosylactivated microparticles (Naked). The whole HEL protein-conjugated microparticles are effective in isolating cells expressing the 800 pM HyHEL antibody in this experiment.
[0867] In FIG. 49A, cells expressing the 30 pM HyHEL antibody are selected by incubating with streptavidin microparticles conjugated to the mature HEL protein (Protein), HEL peptide monomer (Monomer), tandem HEL dimer (Tandem), HEL MAPS dimer (MAPS) or naked unconjugated streptavidin microparticles (Naked). The whole HEL protein- and HEL peptide monomer-conjugated microparticles are effective in isolating cells expressing the 30 pM HyHEL antibody in this experiment.
[0868] In FIG. 49B, cells expressing the 800 pM HyHEL antibody are selected by incubating with tosylactivated microparticles conjugated to either the mature HEL protein (Protein) or naked unconjugated tosylactivated microparticles (Naked). The whole HEL protein-conjugated microparticles are effective in isolating cells expressing the 800 pM HyHEL antibody in this experiment.
[0869] G. In Vitro Affinity Maturation
[0870] A clonal population of HyHEL 10 Gly31 (GGT) mutants (presented on the surface of HEK293 cells) was subjected to iterative rounds of FACS based selection against 50 pM FITC-HEL in the presence of SHM as described below to determine how effectively somatic hypermutation could restore the affinity of a relatively weakly binding mutant.
1. Transfection of Cells
[0871] A stable HEK-293 cell line expressing the [N31G LC/wt HC] anti-HEL immunoglobulin and AID activity was generated by seeding a T75 culture flask with 3×106 HEK-293 cells in 10 mL DMEM medium containing 10% FBS (Invitrogen Corporation, Carlsbad, Calif.). The following day, 500 μL OptiMEM (Invitrogen Corporation, Carlsbad, Calif.), 20 μL HD-Fugene (Roche Diagnostics Corporation, Indianapolis, Ind.), 1 μg of the optimized AID expression vector (Example 5), and 1.5 μg each of the heavy and light chain expression vectors were mixed and incubated for approximately 25-30 minutes at room temperature. After incubation, this mixture was added drop-wise to the cell culture medium.
[0872] Approximately three days post-transfection, the cell growth medium was exchanged with 10 mL DMEM medium containing 10% FBS, 50 μg/mL Geneticin, 10 μL/mL Antibiotic-Antimycotic Solution, 1.5 μg/mL puromycin, 15 μg/mL blasticidin, and 350 μg/mL hygromycin (Invitrogen Corporation, Carlsbad, Calif.) and the cells were incubated for approximately four weeks with periodic re-seeding and exchange of the cell culture medium. At the end of the selection period, the cell culture was expanded, archived and a T75 cell culture flask was seeded with 3×106 HEK-293 cells that expressed the [N31G LC/wt HC] anti-HEL immunoglobulin and AID activity in 10 mL DMEM medium containing 10% FBS (Invitrogen Corporation, Carlsbad, Calif.). The following day, 500 μL OptiMEM (Invitrogen Corporation, Carlsbad, Calif.), 20 μL HD-Fugene (Roche Diagnostics Corporation, Indianapolis, Ind.), and 3 μg of the AID expression vector DNA described above were mixed and incubated for approximately 25-30 minutes at room temperature. After incubation, this mixture was added drop-wise to the cell culture medium. After approximately one week of incubation, the original stable HEK-293 cell line expressing the [N31G LC/wt HC] anti-HEL immunoglobulin and AID as well as the culture that has been transiently transfected with additional AID expression vector were prepared for cell sorting.
2. Selection of Higher Affinity Mutants
[0873] The HEK-293 cell line expressing the [N31G LC/wt HC] anti-HEL immunoglobulin and AID activity and the culture that had been transiently transfected with additional AID expression vector were prepared for cell sorting by collecting the cells, washing with an equal volume of PBS solution, pH 7.2 and resuspending 1e07 cells from each culture in ice-cold PBS solution, pH 7.2 containing 1% (weight/volume) BSA and either 50 pM or 500 pM HEL-FITC at a final cell concentration of 2e05 cells/mL.
Round 1
[0874] Hen Egg lysozyme (Sigma Aldrich, MO) was labeled with fluorescein iosthiocyanate (FITC) using the EZ-Label® FITC protein labeling kit (Pierce, Rockford, Ill.) following the manufacturers directions.
[0875] Following incubation for 30 minutes at 4° C., the cells were pelleted by centrifugation and the volume was reduced to 200 μL. After transfer to sterile 3-mL tubes, a 1:500 dilution of PE-conjugated goat-anti-mouse immunoglobulin was added to the cells and cells were incubated at 4° C. for 30 minutes. The cells were then pelleted by centrifugation and resuspended in 1 mL of sterile ice-cold PBS solution, pH 7.2 containing 1% (weight/volume) BSA plus 2 nanograms/milliliter DAPI. Live IgG-positive cells that were positive for FITC (excitation with a 150 mW 488 nm laser, collection through a 528/38 filter) were isolated by fluorescence activated cell sorting (FACS) using a Cytopiea Influx Cell Sorter at a flow rate of approximately 10,000 events/second (FIG. 51). FACS windows were calibrated to ensure that higher affinity clones could be discriminated using this approach using HyHEL expressing cells.
[0876] The results show a small population of cells that, in all cases, is clearly separated from the main bulk of non-mutated cells. In cells that have been newly transfected with the AID expression (panels B and D of FIG. 51), this population of cells is consistently larger than in the populations of cells that did not receive additional AID expression vector (panels A and C of FIG. 51). These cells were cultured as described below.
[0877] Sorted cells were placed in 3 mL DMEM medium containing 10% FBS, 50 μg/mL Geneticin, 10 μL/mL Antibiotic-Antimycotic solution, 1.5 puromycin, 15 μg/mL blasticidin, and 350 μg/mL hygromycin (Invitrogen Corporation, Carlsbad, Calif.) in one well of a 6-well plate. The cells were cultured until confluent and then archived and re-seeded in one well of a 6-well plate at a cell density of 4×105 cells/mL. The next day, 100 μL OptiMEM (Invitrogen Corporation, Carlsbad, Calif.), 4 μL Fugene6 (Roche Diagnostics Corporation, Indianapolis, Ind.), and 1 μg of the AID expression vector plasmid DNA were mixed and incubated for approximately 25-30 minutes at room temperature. After incubation, this mixture was added drop-wise to the cell culture medium and the cells were cultured and expanded for approximately 7 days. Samples of cells were also taken for sequence analysis.
Round 2
[0878] Cells selected using FITC-HEL in the first round, as described above, were then subjected to the same selection conditions (i.e., incubation with either 50 or 500 pM FITC-labeled HEL) in a second round of FACS sorting. Fifty milliliters (1e07 cells) of the cells selected from the first round were incubated in an ice-cold PBS solution, pH 7.2 containing 1% (weight/volume) BSA and either approximately 50 pM or 500 pM HEL-FITC for 30 minutes at 4° C. The cell mixture was pelleted, the volume was reduced to 200 μL and the cells were transferred to sterile 3 ml tubes. A 1:500 dilution of PE-conjugated goat-anti-mouse Ig was added to the cells and the cells were incubated at 4° C. for 30 minutes. The cells were then pelleted and resuspended 1 mL of an ice-cold PBS solution, pH 7.2 containing 1% (weight/volume) BSA plus 2 nanograms/milliliter DAPI. Live IgG-positive cells that were positive for FITC (excitation with a 150 mW 488 nm laser, collection through a 528/38 filter) were isolated by fluorescence activated cell sorting using a Cytopiea Influx Cell Sorter at a flow rate of approximately 10,000 events/second (FIG. 52).
[0879] The results of the second sort show a significantly larger population of cells exhibiting high affinity HEL binding, consistent with the formation of higher affinity mutants by SHM during growth and culture. In cells that have been newly transfected with the AID expression vector and then incubated with 500 pM HEL (panel D of FIG. 52), this is clearly a much larger population of highly fluorescent cells (25.9% of the population versus 6.88% compared cells that did not receive additional AID expression vector; panel C in FIG. 52). These results demonstrate that re-transformation with the AID expression vector is effective in promoting a significant improvement in mutagenesis rate.
[0880] Continuing this process for 2 additional rounds of mutation with stringent gating on the selected cells (shown in FIG. 53, panel A) resulted in a profound and significant shift in the binding properties of the selected cells (FIG. 53, panel B).
3. Production of Secreted Immunoglobulins for Functional Analysis
[0881] Heavy and light chains of interest may be produced in a secreted form for further functional analysis as described below. In the case of heavy chains obtained from the surface displayed libraries, these are processed as described in Example 5 of priority U.S. Application Nos. 60/904,622 and 61/020,124 (i.e., by digestion with XhoI, followed by re-ligation), to remove the transmembrane domain allowing for direct secretion of the antibody into the media.
[0882] Approximately one day prior to transfection, 3×106 HEK-293 cells were seeded in 10 mL DMEM/10% FBS medium in a T75 culture flask and incubated overnight at 37° C. and 5% CO2. On the day of transfection, 500 μL OptiMEM (Invitrogen Corporation, Carlsbad, Calif.), 20 μL HD-Fugene (Roche Diagnostics Corporation, Indianapolis, Ind.) and 1.5 μg of each heavy and light chain expression vectors were mixed and incubated for approximately 25-30 minutes at room temperature. After incubation, this mixture was added drop-wise to the cell culture medium.
[0883] Approximately three days post-transfection, the cell growth medium was exchanged with 10 mL Freestyle medium (Invitrogen Corporation, Carlsbad, Calif.) and the cells were incubated for an additional 7 days. At the end of the incubation period, the cell culture supernatants were harvested and filtered through a sterile 0.2 μm filter. The secreted immunoglobulins were isolated via standard protein A affinity column chromatography prior to BIACORE analysis as described below.
[0884] HEL is immobilized onto a research grade CM5 sensor chip using standard amine coupling. Each of three surfaces is first activated for seven minutes using a 1:1 mixture of 0.1 mM N-hydroxysuccinimide (NHS) and 0.4 mM 1-ethyl-3-(3-dimethylaminopropyl)-carbodimide (EDC). Then, the HEL sample is diluted 1- to 50-fold in 10 mM sodium acetate, pH 4.0, and exposed to the activated chip surface for different lengths of time (ten seconds to two minutes) to create three different density surfaces of HEL. Each surface is then blocked with a seven-minute injection of 1 M ethanolamine, pH 8.2. Alternatively biotinylated HEL is diluted 100-fold and injected for different amounts of time to be captured at three different surface densities (60 RU, 45 RU, 12 RU; Response Unit (RU) is termed by Biacore and relates to target molecule per surface area) onto a streptavidin-containing sensor chip. All experiments are performed on a Biacore® 2000 or T100 optical biosensor. Anti-HEL antibodies are supplied at 100 μg/mL and tested in a 3-fold dilution series in sample running buffer over HEL conjugated surfaces. Bound anti-HEL antibody is removed using a five-second pulse with sensor regeneration solution. All data is collected at a temperature-controlled 20° C. The kinetic responses for the antibody injections are analyzed using the non-linear least squares analysis program CLAMP (Myszka, D. G. and Morton, T. A. (1998) Trends Biochem. Sci., 23: 149-150).
4. Sequence Analysis
[0885] Sequences of the heavy and light chains isolated in the first sort were determined by PCR amplification of heavy and light chains as described below.
[0886] At least 50,000 cells taken from populations of interest were pelleted at 1100×g for 5 min. at 4° C. Pelleted cells were resuspended in 15 μL distilled H2O and either used immediately in PCR reactions or were frozen for later processing.
[0887] PCR reactions consisting of 27.6 μL H2O, 5 μL 10× Pfx buffer, 1 μL cells from above, 8 μL of 2.5 μM of each primer (listed below), and 0.4 μL Pfx polymerase (Invitrogen Corp., Carlsbad, Calif.) for a total of 50 μL were run using the following format: 1 cycle of 95° C.×2 min., followed by 35 cycles of 95° C.×30 sec, 55° C. for 30 sec, 68° C. for 45 sec, followed by 1 cycle of 68° C. for 1 min. PCR primers used to amplify the open reading frames are:
[0888] Oligo 540: GTGGGAGGTCTATATAAGCAGAGC (SEQ ID NO: 362), which is a forward primer which maps at the 3' end of a CMV promoter region, approximately 140 nucleotides 5' to the ATG start codon for both heavy and light chain open reading frames.
[0889] Oligo 554: CAGAGGTGCTCTTGGAGGAGGGT (SEQ ID NO: 363), which is a heavy chain-specific reverse primer which maps in the IgG gamma chain constant region.
[0890] Oligo 552: ACACAACAGAGGCAGTTCCAGATT (SEQ ID NO: 364), which is a kappa light chain-specific reverse primer that maps near the amino end of the kappa constant region.
[0891] Oligo 577: AGTGTGGCCTTGTTGGCTTGAA (SEQ ID NO: 365), which is a lambda light chain-specific reverse primer that maps to an N-proximal constant region sequence shared by all five functional human lambda genes (IgL1, 2, 3, 6, and 7).
[0892] To amplify the heavy chain, oligos 540+554 were used.
[0893] To amplify the light chains from a population of cells (in which there was likelihood that a mixture of both kappa and lambda light chains would be present), oligos 540, 552 and 577 were used simultaneously. In this case, the volume of water in the PCR reaction mix was adjusted to 19.6 μL.
[0894] Following PCR, 5 μL of sample was removed for analysis on an agarose gel. Reactions for bands which were visualized on the gel and were then subjected to further PCR in the presence of Taq polymerase (Invitrogen) using the following conditions: added directly to the remaining 45 μL of PCR reaction were 2 μL H2O, 0.5 μL Taq, 0.2 μL dNTPs at 2.5 mM each, and 1.5 μL×50 mM MgCl2 for a total of 50 μL (or alternatively, 1 μL of 10× Taq buffer was used in place of MgCl2 while adjusting the H2O to maintain 50 μL final volume). PCR cycling was run as follows: 1 cycle of 95° C.×2 min., followed by 2 cycles of 95° C.×30 sec, 55° C. for 30 sec, 72° C. for 45 sec, followed by 1 cycle of 72° C. for 1 min.
[0895] Reactions for bands which were either not visualized on the gel or were otherwise judged to be too weak to continue, were supplemented with 1 μL Pfx buffer, 3.7 μL H2O, and 0.3 μL Pfx polymerase and subjected to 1 cycle of 95° C.×2 min., followed by 10 cycles of 95° C.×30 sec, 55° C. for 30 sec, 68° C. for 45 sec, followed by 1 cycle of 68° C. for 1 min.
[0896] PCR reactions for bands which were visible following analysis on an agarose gel were cloned using a TOPO® cloning kit from Invitrogen following the manufacturer's suggested protocol. In brief, 4 μL PCR reaction was added to 1 μL salt solution (provided in the TOPO® kit) plus 1 μL TOPO® cloning vector. Following a 20 min. incubation at room temp., 1 or 2 μL were used to transform 100 μL XL1 blue as per the manufacturer's suggested protocol.
[0897] Reading frames from templates whose sequences were of further interest were recovered as follows: heavy chain templates were recovered by digesting the TOPO® clones with SgrAI and NheI, which are both present in all of the original heavy chain sequences. The resulting approximately 500 bp fragments (which contain the entire variable region including all of CDR3), were cloned into the cognate sites of an expression vector already comprising the heavy chain constant region to generate an intact, contiguous heavy chain open reading frame. One version of this vector also contains the transmembrane domain and cytoplasmic domain from the murine H2kk gene as an in-frame fusion with the IgG1 constant region to permit retention of the final IgG molecule on the cell surface, as described in Example 9. The alternative version of the expression vector has the transmembrane deleted to allow for direct secretion of the antibodies of interest.
[0898] Similarly, light chain templates of interest were removed from their TOPO® cloning vectors using SbfI and MunI for kappa or SbfI and AclI for lambda, all of which sites are present in the original sequences. The resulting 350-400 bp fragments (which contain the entire light chain variable region including CDR3), were cloned into the cognate sites of the expression vector to generate an intact, contiguous light chain open reading frame.
[0899] The results demonstrated that in approximately 23% of the sequenced clones, there was at least one mutation within the CDR of the light chain resulting in the mutation of Glycine 31 to Aspartate (G31D). Based on the crystal structure of HyHEL 10 bound to HEL (Pons et al., (1999) Protein Science 8:958-68), this mutation would be predicted to result in the formation of an additional hydrogen bond interaction during antigen binding, which accounts for the increase in binding observed in the presence of 500 pM HEL in FIG. 52 and Biacore measurements. The type of mutations observed (FIGS. 54A and B) followed the predicted pattern of mutations for SHM mediated mutation (as shown in FIG. 50), and did not result in widespread non-specific mutation of the entire coding regions of the heavy and light chains. These results, therefore, demonstrate the ability of the system to provide good affinity discrimination, selection of improved variants of the antibodies and binding proteins of the present invention, and the ability to provide for both sustained and pulsed hypermutation directed to specific regions of interest within one or more target proteins. Furthermore, a handful of additional mutations were identified that, when recombined into a single antibody construct, improved upon the affinity of the wild-type protein from 30 pM to better than 4 pM (FIG. 54C). This example demonstrates how a single sequence or library under selective pressure and in the presence of SHM can quickly generate higher affinity mutants, and how this flow of mutational events can be predicted exactly by the computational algorithms outlined above.
[0900] The data presented herein demonstrate that the disclosed systems and seed polynucleotides for somatic hypermutation are capable of high level targeted mutagenesis of a target protein of interest. The system is capable of iterative rounds of mutagenesis and selection enabling the directed evolution of favorable mutations while reducing the accumulation of neutral and harmful mutations, both within the protein of interest and within the expression system.
5. Episomal Rescue
[0901] As episomal vectors remain unintegrated and easily separable from a host cell's chromosomal material, plasmids can be recovered by the method of Hirt (Hirt, 1967; Kapoor and Frappier, 2005; Yates et al., 1984), transformed into competent bacteria and further manipulated to verify the sequence, identity and/or properties of the encoded polypeptides.
[0902] Using an estimate of an average of 3 resident episomes of 8000 base pairs (bp) each per cell, one can expect a yield of approximately 30 picogram (pg) per million cells (see, e.g., Formula I). Assuming a transformation efficiency into electrocompetent E. coli of 107 colonies per μg of relaxed circle DNA, one can expect approximately 300 E. coli colonies, each representing a single recovered episome, to result per million mammalian cells.
(106 cells×3 episomes/cell)×(660 g/mol/bp)×(8000 bp/episome)×(106 colonies/μg)×(106 μg/g)/(6×1023 episomes/mol)=2.6×10-11 g (DNA per 106 cells). Formula 1
[0903] Plasmids can also be recovered using a standard alkaline lysis procedure, e.g., as per a protocol from Qiagen, Inc. (for procedure, see e.g., www1.qiagen.com/literature/handbooks/PDF/PlasmidDNAPurification/PLS- _QP_Miniprep/1034641_HB_QIAprep--112005.pdf; and Wade-Martins et al., Nuc Acids Res 27:1674-1682 (1999)). In one aspect, transfected mammalian cells are treated the same way as the E. coli described in the Qiagen protocol. Episomes present in the final eluate are transformed into competent E. coli as described above. Using either the Hirt supernatant or alkaline lysis method requires beginning with a significant cell population for isolating resident episomes. In one non-limiting example, starting with 50,000 clonally derived cells, one might expect to obtain 10 to 20 recovered episomes as manifested in colonies of transformed E. coli.
[0904] Additionally, expression of the SV40 T antigen provides for the rapid amplification of vectors containing an SV40 Ori, thus providing for a method to amplify vector number prior to episome rescue. To achieve this amplification, the SV40 T-antigen was cloned into an expression vector (as described herein) and was transiently transfected into 6.3×10e5 HEK 293 cells that were stably harboring HyHEL10 HC and LC episomal vectors. Samples were taken at time 0 (immediately prior to transfection), and at day 1, 2 and 3. Cells were harvested by trypsinization and episomal DNA was extracted using a Qiagen miniprep kit. Extracted DNA was transformed into E. coli, which were grown on carbenicillin plates overnight, and colonies were counted the next morning (Table 18).
TABLE-US-00048 TABLE 18 Number of colonies resulting from HyHEL10-expressing cell population before and following transient transfection with T-antigen. day # cells # colonies 0 6.3 × 105 0 1 6.3 × 105 35 2 6.3 × 105 800-900 3 6.3 × 105 >5000
[0905] Another standard method to characterize transfected genes, whether episomal or integrated, involves performing a Polymerase Chain Reaction (PCR) reaction directly on the relevant cell population followed by cloning and characterizing individual resulting PCR fragments. This method has the advantage of not requiring a large starting population of cells. PCR amplification of the resident active antibody open reading frame can successfully be performed on as little as a single cell. This has the effect of foreshortening the time from isolation of a cell of interest to the point of sequencing the responsible open reading frame.
[0906] Another option is to perform RT-PCR on the isolated cells thus identifying and characterizing the resident polypeptide(s) via expressed mRNA.
Example 10
Engineering Enhanced Mutants of AID
[0907] Activation induced cytidine deaminase (AID) is the primary enzyme responsible for initiating somatic hypermutation (SHM), class switch recombination (CSR) and gene conversion (GC) events during affinity maturation by the immune system. The enzyme has been especially well conserved during evolution, with the human, rat, cow, mouse and chicken orthologs exhibiting 94.4%, 93.9%, 93.9%, 92.4% and 89.4% identity to the canine (dog) amino acid sequence, respectively.
[0908] AID contains several predicted protein-protein interaction domains, post-translational modification sites and subcellular targeting motifs, one of which is a nuclear export signal (NES) that is localized in the carboxy terminal amino acids of the enzyme. The question as to whether or not a nuclear localization signal (NLS) is present within AID remains controversial with some groups claiming such a signal exists (Ito et al., PNAS 2004 Feb. 17; 101(7):1975-80) while others maintain that no functional NLS is present (Brar et al., J. Biol. Chem. 2004 Jun. 8; 279(25):26395-401; McBride et al., J. Exp. Med. 2004 May 3; 199(9):1235-44).
[0909] Native AID is found primarily in the cytoplasmic compartment of cells, as demonstrated by cell fractionation, western blotting and immunohistochemistry. Removal or disabling of the NES tends to permit higher steady-state resident concentrations of AID in the nucleus, higher levels of SHM, but also impaired or absent CSR (Brar et al, Id.; Durandy et al., Hum. Mutat. 2006 December; 27(12):1185-91; Ito et al, Id.; McBride et al, Id.).
[0910] Example 2 above describes the design and construction of an SHM resistant form of AID (SEQ ID NO. 341) comprising a mutation in the NES (L198A) designed to disable nuclear export thereby promoting nuclear retention. To further enhance nuclear localization and, thus, the mutator activity of AID, further engineered versions of the enzyme were created by inserting the strong nuclear localization signal (NLS; PKKKRKV; SEQ ID NO: 340) derived from the SV40 T antigen (Kalderon et al, (1984). Cell 39, 499-509) near the amino terminus. To track AID expression, a FLAG epitope tag was also inserted to create (SEQ ID NO. 342) which contains both a strong NLS and the mutant NES sequence.
[0911] Additional engineered versions of AID were also created by further modifying the C-terminal NES to reduce nuclear export. These constructs were prepared with and without the SV40 T antigen NLS.
[0912] In the first pair of NES mutants, polynucleotide sequences of SEQ ID NO: 341 (without NLS) and SEQ ID NO: 342 (with NLS) were modified such that amino acid residues L181, L183, L189, L196 and L198 encoded by the polynucleotide sequences were mutated to Alanine resulting in polynucleotide sequences of SEQ ID NO: 344 (without NLS) and SEQ ID NO: 346 (with NLS), respectively, and amino acid sequences of SEQ ID NO: 345 (without NLS) and SEQ ID NO: 347 (with NLS), respectively.
[0913] Muteins were generated by PCR, and then treated with Dpn1 to remove parental DNA.
[0914] To generate the alanine containing muteins, the following oligos were used: CAGCTCAGGAGAATCCTCGCCCCCGCTTATGAGGTCGACGACCTC (SEQ ID NO: 352) and GAGGTCGTCGACCTCATAAGCGGGGGCGAGGATTCTCCTGAGCTG (SEQ ID NO: 353).
[0915] Two separate PCR reactions were set up using vectors containing polynucleotide sequences set forth as SEQ ID NO: 341 or SEQ ID NO: 342 as template DNA, using Pfu Taq polymerase (Invitrogen) with the manufacturers kit buffers and 2.5 uM of each deoxynucleotide (Roche). PCR was performed with the following cycle conditions: 1 cycle of 95° C. for 3 min, followed by 20 cycles of [95° C. for 45 sec, 55° C. for 45 sec, 68° C. for 17 min], followed by 1 cycle of 68° C. for 5 min. After completion, 5 μl of the PCR reaction was run on a 1% agarose gel to confirm a successful reaction. The PCR reaction mix was then treated with Dpn1 (New England Biolabs) for at least 4 hrs at 37° C. to remove the parental DNA.
[0916] Five (5) μL of the Dpn1-treated PCR reaction was added to 100 μL of XL1-Blue super competent cells (Invitrogen) and transformed per the manufacturer's suggested protocol. Following sequence verification, the resulting DNA (which contained 2 of the 4 desired mutations; i.e., 181 and 183), was used as a template with oligos CCGCTTATGAGGTCGACGACGCCAGAGATGCCTTCCGGACCG (SEQ ID NO: 354) and AGGGTCCGGAAGGCATCTCTGGCGTCGTCGACCTCATAAGCGG (SEQ ID NO: 355) in the same protocols listed above to introduce the third of four mutations (i.e., 189). Finally, oligos CCAGAGATGCCTTCCGGACCGCCGGGGCTTGATGTACAATC (SEQ ID NO: 356) and GATTGTACATCAAGCCCCGGCGGTCCGGAAGGCATCTCTGG (SEQ ID NO: 357) were used to incorporate the fourth and final mutation (i.e., 196).
[0917] The final set of alanine-containing mutein products were digested using Sac1 and BsrG1 and ligated into vector backbones cut with the cognate restriction enzymes to generate SEQ. ID. NO. 344 (without NLS) and SEQ. ID. NO. 346 (with NLS), respectively.
[0918] In a second pair of muteins: polynucleotide sequences of SEQ. ID. NO. 341 (without NLS) and SEQ. ID. NO. 342 (with NLS) were modified such that amino acid residues Asp187, Asp188 and Asp191 encoded by the polynucleotide sequences were mutated to Glutamate and amino acid residue Thr195 encoded by the polynucleotide sequences was mutated to Isoluecine, thereby creating polynucleotide sequences SEQ. ID. NO. 348 (without NLS) and SEQ. ID. NO. 350 (with NLS), respectively, and amino acid sequences of SEQ. ID. NO. 349 (without NLS) and SEQ. ID. NO. 351 (with NLS), respectively.
[0919] The same set of procedures described above with respect to the alanine muteins was repeated to generate the glutamate containing muteins of AID SEQ. ID. NO. 348 and SEQ. ID. NO. 350, except that the following oligos: TCCTCCCCCTCTATGAGGTCGAAGAACTCAGAGAAGCCTTCCGGACCCTCGGGGC (SEQ ID NO: 358) and GCCCCGAGGGTCCGGAAGGCTTCTCTGAGTTCTTCGACCTCATAGAGGGGGAGGA (SEQ ID NO: 359) were used in place of the first pair of oligos, and the following oligos: AACTCAGAGAAGCCTTCCGGATCCTCGGGGCTTGATGTACAAT (SEQ ID NO: 360) and ATTGTACATCAAGCCCCGAGGATCCGGAAGGCTTCTCTGAGTT (SEQ ID NO: 361) were used in lieu of the second pair of oligos (no third PCR reaction was needed in this case). Products were treated as described above to generate SEQ. ID. NO. 348 (without NLS) and SEQ. ID. NO. 350 (with NLS).
[0920] Results and Discussion.
[0921] The six resulting AID constructs were subsequently tested for activity in a green fluorescent protein (GFP) reversion assay, and for frequency of mutations on an immunoglobulin IgG heavy chain (HC) template.
[0922] To perform the GFP reversion assay, the TAC codon for tyrosine 82 was altered to a TAG stop codon (GFP*). GFP* was cloned into an Anaptys episomal expression vector and stably transfected into HEK 293 (note: this cell line expresses EBNA1 from an integrated copy of the gene). Each AID construct in turn was transfected into the stably transfected GFP* cell line, and cells were placed under selection (blasticidin for GFP* and hygromycin for each of the AID constructs) by day 2 post transfection. Reversion of the stop codon back to tyrosine caused the episome-harboring cell to fluoresce green. The frequency of GFP reversion was measured by fluorescence-activated cell sorter (FACS) analysis at 3, 6, and 10 days post selection.
TABLE-US-00049 TABLE 19 Functional competence of AID muteins as gauged by FACS analysis of GFP revertant cells gated on days 3, 6, and 10. Table 19 % gated % gated % gated Vector(s)/AID variants day 3 day 6 day 10 GFP* alone 0.04% 0.02% 0.01% GFP* + expression of (SEQ ID. NO. 341) 0.44% 0.35% 0.39% GFP* + expression of (SEQ ID. NO. 342) 0.31% 0.37% 0.19% GFP* + expression of (SEQ ID. NO. 344) 0.19% 0.26% 0.21% GFP* + expression of (SEQ ID. NO. 346) 0.36% 0.35% 0.32% GFP* + expression of (SEQ ID. NO. 348) 0.37% 0.30% 0.41% GFP* + expression of (SEQ ID. NO. 350) 0.18% 0.26% 0.21%
[0923] The results indicate that co-transfection with each of the six AID constructs consistently yielded GFP revertants significantly above background, indicating that all 6 muteins of AID are functional.
[0924] Because the GFP reversion assay requires both the initial activity of AID and subsequent action by error prone polymerase in order to generate a positive, reverted cell, the results can provide a qualitative yes/no for function. In order to determine actual reversion rates, a more precise template mutagenesis experiment was also conducted. Thus, in addition to the GFP reversion assay, 2 of the AID constructs (SEQ ID. NO. 341; containing the L198A mutation in the NES) and SEQ ID. NO. 342, (containing the L198A NES mutation and the SV40 NLS)) were tested for their ability to induce mutations in the HC of HyHEL10 IgG (Pons et al, (1999) Protein Science 8:958-68; Smith-Gill et al. (1984) J. Immunology 132:963). Episomal expression constructs (as described previously) encoding the HC of HyHEL10, an N31G mutein of the HyHEL10 light chain (LC), and either an expression vector containing SEQ ID NO: 341 or the same vector backbone containing SEQ ID NO: 342, were co-transfected into HEK 293 cells. Antibiotic selective pressure was added to the transfected cell population (i.e., blasticidin, puromycin and hygromycin for HC, LC and AID, respectively), and cells were harvested following 2 months of culture. A total of 83 IgG HC templates were sequenced from cells transfected with an expression vector comprising SEQ ID NO. 341, and 61 templates were sequences from cells transfected with an expression vector comprising SEQ ID NO. 342. The percentage of mutations per template vs. form of AID is shown in Table 20, below. The mutation frequency calculated from the sequencing data is 1 mutation per 1438 bp generated by SEQ ID NO: 341, and 1 mutation per 1059 bp generated by SEQ ID NO: 342.
TABLE-US-00050 TABLE 20 Percentage of HyHEL10 IgG templates identified with mutations observed after co-expression of AID muteins SEQ ID NO. 341 or SEQ ID NO. 342 Table 20 # Mutations per heavy chain template SEQ ID. No. 341 SEQ ID. No. 342 0 71% 72% 1 26% 20% 2 2.4% 6.8% 3 0 1.6% 4 0 1.6%
[0925] The results indicate that the version of AID that contains the NLS (SEQ ID. NO. 342) induced a greater number of mutations in the HyHEL10 HC IgG template (1 per 1059 bp vs 1 per 1438 for the non-NLS containing homolog), and similarly resulted in a greater number of templates containing multiple mutations (10% of templates by AID+NLS vs 2.4% for AID-NLS).
[0926] Sequences
[0927] Cold canine AID. Nuclear export signal was abrogated by altering the unmodified CTT (Leu198) codon to GCT (ala, shown underlined below).
TABLE-US-00051 (SEQ ID NO: 341) ATGGACTCTCTCCTCATGAAGCAGAGAAAGTTTCTCTACCACTTCAAGAACGTCAGATGGGCC AAGGGGAGACATGAGACCTATCTCTGTTACGTCGTCAAGAGGAGAGACTCAGCCACCTCTTTCTCCCT CGACTTTGGGCATCTCCGGAACAAGTCTGGGTGTCATGTCGAACTCCTCTTCCTCCGCTATATCTCAGA CTGGGACCTCGACCCCGGGAGATGCTATAGAGTCACTTGGTTTACCTCTTGGTCCCCCTGTTATGACTG CGCCAGACATGTCGCCGACTTCCTCAGGGGGTATCCCAATCTCTCCCTCCGCATATTCGCCGCCCGACT CTATTTTTGTGAGGACAGGAAAGCCGAGCCCGAGGGGCTCAGGAGACTCCACCGGGCCGGGGTCCAG ATCGCCATCATGACATTTAAGGACTATTTCTATTGTTGGAATACATTTGTCGAGAATCGGGAGAAGACT TTCAAAGCCTGGGAGGGGCTCCATGAGAACTCTGTCAGACTCTCTAGGCAGCTCAGGAGAATCCTCCT CCCCCTCTATGAGGTCGACGACCTCAGAGATGCCTTCCGGACCCTCGGGGCTTGA.
[0928] Features of the polynucleotide sequences (or amino acid sequences) are in 5' to 3' (or N- to C-terminal where appropriate) as follows:
[0929] SacI restriction site used for cloning, boxed letters; Kozak consensus, underlined; ATG start codon (bold capital letters); FLAG epitope tag (single underline); NLS (double-underline); cold canine AID; TGA stop codon (bold capital letters); BsrGI and AscI restriction sites used for cloning (boxed letters). * indicates stop codon in protein sequence.
TABLE-US-00052 Flag-NLS-AID. (SEQ ID NO: 342) ##STR00002## ctaccacttcaagaacgtcagatgggccaaggggagacatgagacctatctctgttacgtcgtcaagaggagag- actcagccacctattctccctcga ctttgggcatctccggaacaagtctgggtgtcatgtcgaactcctcttcctccgctatatctcagactgggacc- tcgaccccgggagatgctatagag tcacttggtttacctcttggtccccctgttatgactgcgccagacatgtcgccgacttectcagggggtatccc- aatctctccctccgcatattcgcc gcccgactctatttttgtgaggacaggaaagccgagcccgaggggctcaggagactccaccgggccggggtcca- gatcgccatcatgacatttaagga ctatttctattgttggaatacatttgtcgagaatcgggagaagactttcaaagcctgggaggggctccatgaga- actctgtcagactctctaggcagc tcaggagaatcctcctccccctctatgaggtcgacgacctcagagatgccttccggaccctcgg ##STR00003## (SEQ ID NO: 343) MDYKDDDDKGPKKKRKVDSLLMKQRKFLYHFTCNVRWAKGRHETYLCYVVTCRRDSATSFSLDF GHLRNKSGCHVELLFLRYTSDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGYPNLSLRTFAARLYFC EDRKAEPEGLRRLHRAGVQTATMTFKDYFYCWNTFVENREKTFKAWEGLHENSVRLSRQLRRTLLPLYEVD DLRDAFRTLGA*.
[0930] The 4 underlined-and-capitalized GCC codons (ala) were changed from the original sequence (CTC encoding Leu) by site directed mutagenesis.
TABLE-US-00053 (SEQ ID NO: 344) gagctcctaaccaccATGgactctctcctcatgaagcagagaaagtttctctaccacttcaagaacgtca gatgggccaaggggagacatgagacctatctctgttacgtcgtcaagaggagagactcagccacctcttt ctccctcgactttgggcatctccggaacaagtctgggtgtcatgtcgaactcctcttcctccgctatatc tcagactgggacctcgaccccgggagatgctatagagtcacttggtttacctcttggtccccctgttatg actgcgccagacatgtcgccgacttcctcagggggtatcccaatctctccctccgcatattcgccgcccg actctatttttgtgaggacaggaaagccgagcccgaggggctcaggagactccaccgggccggggtccag atcgccatcatgacatttaaggactatttctattgttggaatacatttgtcgagaatcgggagaagactt tcaaagcctgggaggggctccatgagaactctgtcagactctctaggcagctcaggagaatcctcGCCcc cGCCtatgaggtcgacgacGCCagagatgccttccggaccGCCggggctTGAtgtaca. (SEQ ID NO: 345) MDSLLMKQRKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSFSLDFGHLRNKSGCHVELLFLRY ISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGYPNLSLRIFAARLYFCEDRKAEPEGLRRLHRAGV QIAIMTFKDYFYCWNTFVENREKTFKAWEGLHENSVRLSRQLRRILAPAYEVDDARDAFRTAGA*.
[0931] The 4 underlined-and-capitalized GCC codons (ala) were changed from the original sequence (CTC encoding Leu) by site directed mutagenesis. Boxes and underlines are as described above.
TABLE-US-00054 (SEQ ID NO: 346) ##STR00004## ctaccacttcaagaacgtcagatgggccaaggggagacatgagacctatctctgttacgtcgtcaagaggagag- actcagccacctctttctccctcga ctttgggcatctccggaacaagtctgggtgtcatgtcgaactectcttectccgctatatctcagactgggacc- tcgaccccgggagatgctatagagt cacttggfttacctcttggtccccctgttatgactgcgccagacatgtcgccgacttcctcagggggtatccca- atctctccctccgcatattcgccgc ccgactctatttttgtgaggacaggaaagccgagcccgaggggctcaggagactccaccgggccggggtccaga- tcgccatcatgacatttaaggacta tttctattgaggaatacatttgtcgagaatcgggagaagactttcaaagcctgggaggggctccatgagaactc- tgtcagactctctaggcagctcagg agaatcctcGCCcccGCCtatgaggtcgacgacGCCagagatgccttccggaccGCCggggctTGAtgtaca. (SEQ ID NO: 347) MDYKDDDDKGPKKKRKVDSLLMKQRKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSFSLDF GHLRNKSGCHVELLFLRYTSDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGYPNLSLRTFAARLYFC EDRTCAEPEGLRRLHRAGVQTATNTTFTCDYFYCWNTFVENREKTFKAWEGLHENSVRLSRQLRRTLAPAYEV DDARDAFRTAGA*.
[0932] The 3 underlined-and-capitalized GAA codons (Glu) were changed from the original sequence (Aspartate encoding codons). One additional mutation, T195I, (ACC to ATC) was also generated.
TABLE-US-00055 (SEQ ID NO: 348) gagctcctaaccaccATGgactctctcctcatgaagcagagaaagtttctctaccacttcaagaacgtca gatgggccaaggggagacatgagacctatctctgttacgtcgtcaagaggagagactcagccacctcttt ctccctcgactttgggcatctccggaacaagtctgggtgtcatgtcgaactcctcttcctccgctatatc tcagactgggacctcgaccccgggagatgctatagagtcacttggtttacctcttggtccccctgttatg actgcgccagacatgtcgccgacttcctcagggggtatcccaatctctccctccgcatattcgccgcccg actctatttttgtgaggacaggaaagccgagcccgaggggctcaggagactccaccgggccggggtccag atcgccatcatgacatttaaggactatttctattgttggaatacatttgtcgagaatcgggagaagactt tcaaagcctgggaggggctccatgagaactctgtcagactctctaggcagctcaggagaatcctcctccc cctctatgaggtcGAAGAActcagaGAAgccttccggATCctcggggctTGAtgtaca. (SEQ ID NO: 349) MDSLLMKQRKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSFSLDFGHLRNKSGCHVELLFLRY ISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGYPNLSLRIFAARLYFCEDRKAEPEGLRRLHRAGV QIAIMTFKDYFYCWNTFVENREKTFKAWEGLHENSVRLSRQLRRILLPLYEVEELREAFRILGA*.
[0933] The 3 underlined-and-capitalized GAA codons (Glu) were changed from the original sequence (Aspartate encoding codons). One additional mutation, T195I (ACC to ATC) was also generated. Boxes and underlines are as described above.
TABLE-US-00056 (SEQ ID NO: 350) ##STR00005## ctaccacttcaagaacgtcagatgggccaaggggagacatgagacctatctctgttacgtcgtcaagaggagag- actcagccacctctttctccctcgacttt gggcatctccggaacaagtctgggtgtcatgtcgaactcctcttcctccgctatatctcagactgggacctcga- ccccgggagatgctatagagtcacttggt ttacctcttggtccccctgttatgactgcgccagacatgtcgccgacttcctcagggggtatcccaatctctcc- ctccgcatattcgccgcccgactctattt ttgtgaggacaggaaagccgagcccgaggggctcaggagactccaccgggccggggtccagatcgccatcatga- catttaaggactatttctattgttggaat acatttgtcgagaatcgggagaagactttcaaagcctgggaggggctccatgagaactctgtcagactctctag- gcagctcaggagaatcctcctccccctct atgaggtcGAAGAActcagaGAAgccttccggATCctcggggctTGAtgtaca. (SEQ ID NO: 351) MDYKDDDDKGPKKKRKVDSLLMKQRKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSFSLDF GHLRNKSGCHVELLFLRYTSDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGYPNLSLRTFAARLYFC EDRTCAEPEGLRRUTRAGVQTATNTTFKDYFYCWNTFVENREKTFTCAWEGLHENSVRLSRQLRRTLLPLYEVE ELREAFRILGA.
[0934] While preferred embodiments of the present invention have been shown and described herein, such embodiments are provided by way of example only. It should be understood that various alternatives to the embodiments of the invention described herein can be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.
REFERENCES
[0935] 1. Wang et al. Evolution of new non-antibody proteins via iterative somatic hypermutation. Proc Natl Acad Sci USA. 2004 Nov. 30; 101(48):16745-16749. [0936] 2. Yelamos, et al, Targeting of non-Ig sequences in place of V segment by somatic hypermutation. Nature 1995; 376: 225-229. [0937] 3. Zheng, et al., Intricate targeting of immunoglobulin somatic hypermutation maximizes the efficiency of affinity maturation. J Exp Med. 2005 May 2; 201(9):1467-1478. [0938] 4. Ruckerl et al., Episomal vectors to monitor and induce somatic hypermutation in human Burkitt-Lymphoma cell lines. Mol. Immunol. 2006 April; 43(10): 1645-1652. [0939] 5. Bachl et al., Increased transcription levels induce higher mutation rates in a hypermutating cell line. J. Immunol. 2001 Apr. 15; 166(8):5051-5057. [0940] 6. Cumbers et al., Generation and iterative affinity maturation of antibodies in vitro using hypermutating B-cell lines. Nat. Biotechnol. 2002 November; 20(11): 1129-1134. [0941] 7. Neuberger, et al. Somatic hypermutation at A.T pairs: polymerase error versus dUTP incorporation. Nat Rev Immunol. 2005 February; 5(2): 171-178. Review. [0942] 8. Wang, et al. Genome-wide somatic hypermutation. Proc Natl Acad Sci USA. 2004 May 11; 101(19):7352-7356. [0943] 9. Wang and Wabl. Hypermutation rate normalized by chronological time. J. Immunol. 2005 May 1; 174(9):5650-5654. [0944] 10. Martin et al. Somatic hypermutation of the AID transgene in B and non-B cells. Proc Natl Acad Sci USA. 2002 Sep. 17; 99(19): 12304-12308. [0945] 11. Shinkura R, et al. Separate domains of AID are required for somatic hypermutation and class-switch recombination. Nat. Immunol. 2004 July; 5(7):707-712. [0946] 12. Zhang (Scharff) et al., Clonal instability of V region hypermutation in the Ramos Burkitt's lymphoma cell line. Int Immunol. 2001 September; 13(9): 1175-1184. [0947] 13. Ruckerl and Bachl. Activation induced cytidine deaminase fails to induce a mutator phenotype in the human pre-B cell line Nalm6. Eur. J. Immunol. 2005; 35: 290-298. [0948] 14. Rogozin and Diaz. Cutting edge: DGYW/WRCH is a better predictor of mutability at G:C bases in Ig hypermutation than the widely accepted RGYW/WRCY motif and probably reflects a two-step activation-induced cytidine deaminase-triggered process. J. Immunol., 2004, 172: 3382-3384. [0949] 15. Martin et al. Activation-induced cytidine deaminase turns on somatic hypermutation in hybridomas. Nature. 2002 Feb. 14; 415(6873): 802-806. [0950] 16. U.S. Pat. No. 6,815,194 [0951] 17. U.S. Pat. No. 5,885,827 [0952] 18. Coker et al., (2006) Genetic and In vitro assays of DNA deamination Methods Enzymology 408 156-170 [0953] 20. Conticello et al., (2005) Evolution of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases. Mol. Biol. Evol. 22 (2) 367-377 [0954] 21. Odegard et al., (2006) Targeting of somatic hypermutation Nature Rev. Imm. 6 573-583 [0955] 22. Shen et al. (2006) Somatic hypermutation and class switch recombination in Msh6-/-Ung-/-double-knock out mice. J. Imm. 177 5386-5392 [0956] 23. Neuberger et al. (2005) Somatic hypermutation at A.T pairs: polymerase error versus dUTP incorporation. Nat. Rev. Immunol. 5(2) 171-8 [0957] 24. Rogozin et al. (2004) Cutting Edge: DGYW/WRCH is a better predictor of mutability at G:C bases in Ig hypermutation than the widely accepted RGYW/WRCY motif and probably reflects a two step activation induced cytidine deaminase triggered process. J. Imm. 172 3382-3384 [0958] 25. Wilson et al. (2005) MSH2-MSH6 stimulates DNA polymerase eta, suggesting a role for A:T mutations in antibody genes. J. Exp. Med. 201 (4) 637-645 [0959] 26. Santa-Marta et al. (2006) HIV-1 vif protein blocks the cytidine deaminase activity of B-cell specific AID in the E. coli by a similar mechanism of action. Mol. Imm. 44 583-590 [0960] 27. Zan et al. (2005) The translesion DNA polymerase theta play a dominant role in immunoglobulin gene somatic hypermutation. EMBO J. 24 3757-3769 [0961] 28. Watanebe et al. (2004) Rad18 guides pol eta to replication stalling sites through physical interaction and PCNA monoubiquitination. EMBO J. 23 3886-3896 [0962] 29. Besmer et al., (2006) The transcription elongation complex directs activation induced cytidine deaminase mediated DNA deamination. Mol. Cell. Biol. (2006) 26 (11) 4378-4385. [0963] 30. Steele et al. (2006) Computational analyses show A to G mutations correlate with nascent mRNA hairpins at somatic hypermutation hotspots. DNA Repair doi:10.1016/j.dnarep.2006.06.002 [0964] 31. Odegard et al. (2005) Histone modifications associated with somatic hypermutation. Immunity 23 101-110 [0965] 32. Komori et al. (2006) biased dA/dT somatic hypermutation as regulated by the heavy chain intronic iEu enhancer and 3' E alpha enhancers in human lymphoblastoid B cells. Mol. Imm. 43 1817-1826 [0966] 33. Rada et al., (2001) The intrinsic hypermutability of antibody heavy and light chain genes decays exponentially. EMBO J. 20 4570-4576 [0967] 34. Larijani et al. (2006) Mol. Cell. Biol. Doi:10.1128/MCB.00824-06. [0968] 35. Larijani et al., (2005) Methylation protects cytidines from AID-mediated deamination. Mol. Immunol. 42(5) 599-604 [0969] 36. Poltoratsky et al., (2006) Down regulation of DNA polymerase beta accompanies somatic hypermutation in human BL2 cell lines. DNA Repair. 2006 doi:10.1016/j.dnarep.2006.10.003 [0970] 37. Hirt, (1967) Selective extraction of polyoma DNA from infected mouse cell cultures. J. Mol. Biol. 26:365-369. [0971] 38. Kapoor and Frappier, (2005) Methods for measuring the replication and segregation of Epstein-Barr virus-based plasmids. Methods Mol Biol. 292:247-66. [0972] 39. Wade-Martins et al., (1999) Long-term stability of large insert genomic DNA episomal shuttle vectors in human cells. Nuc Acids Res 27:1674-1682 [0973] 40. Qiagen, Inc. alkaline lysis procedure, see www1.qiagen.com/literature/handbooks/PDF/PlasmidDNAPurification/PLS_QP_Mi- niprep/1034641_HB_QIAprep--112005.pdf [0974] 41. Yates et al., (1984) A cis-acting element from the Epstein-Barr viral genome that permits stable replication of recombinant plasmids in latently infected cells. PNAS 81; 3806-3810. [0975] 42. Baker, (2005) The selectivity of beta-adrenoceptor antagonists at the human beta1, beta2 and beta3 adrenoceptors. Br J. Pharmacol. February; 144(3):317-22. [0976] 43. Fitzgerald et al., (1998) Pharmacological and biochemical characterization of a recombinant human galanin GALR1 receptor: agonist character of chimeric galanin peptides. J Pharmacol Exp Ther. 1998 November; 287(2):448-56. [0977] 44. Ghosh et al., (2006) Design, synthesis, and progress toward optimization of potent small molecule antagonists of CC chemokine receptor 8 (CCR8). J Med. Chem. May 4; 49(9):2669-72. [0978] 45. Gillian R. et al., (2004) Quantitative Assays of Chemotaxis and Chemokinesis for Human Neural Cells. ASSAY and Drug Development Technologies. 2(5): 465-472. [0979] 46. Hintermann et al., (2005) Integrin Alpha6-Beta4-erbB2 Complex Inhibits Haptotaxis by Up-regulating E-cadherin Cell-Cell Junctions in Keratinocytes. J. Biol. Chem. 280(9): 8004-8015. [0980] 47. Iwatsubo et al., (2003) J. Cardiovasc Pharmacol. January; 41 Suppl 1:S53-56. [0981] 48. Gearhart and Wood, (2001) Emerging links between hypermutation of antibody genes and DNA polymerases. Nature Rev. Immunol. 1: 187-192. [0982] 49. Kawamura et al., (2004) DNA polymerase theta is preferentially expressed in lymphoid tissues and upregulated in human cancers. Int. J. Cancer 109(1):9-16. [0983] 50. Zan et al., (2005) The translesion DNA polymerase theta plays a dominant role in immunoglobulin gene somatic hypermutation. EMBO Journal 24, 3757-3769. [0984] 51. Zeng et al., (2001) DNA polymerase eta is an A-T mutator in somatic hypermutation of immunoglobulin variable genes. Nat. Immunol. 2(6):537-41. [0985] 52. Habel et al. (2004) Maintenance of Epstein-Barr virus-derived episomal vectors in the murine Sp2/0 myeloma cell line is dependent upon exogenous expression of human EBP2. Biochem Cell Biol. 82(3):375-80. [0986] 53. Kapoor et al. (2001) Reconstitution of Epstein-Barr virus-based plasmid partitioning in budding yeast. EMBO J. 20(1-2):222-30.
Sequence CWU
1
3911691DNAArtificial SequenceDescription of Artificial Sequence Synthetic
construct 1agcttggccc attgcatacg ttgtatccat atcataatat ctacatttat
attggctcat 60gtccaacatt accgccatgt tgacattgat tattgactag ttattaatag
taatcaatta 120cggggtcatt agttcatagc ccatatatgg agttccgcgt tacataactt
acggtaaatg 180gcccgcctgg ctgaccgccc aacgaccccc gcccattgac gtcaataatg
acgtatgttc 240ccatagtaac gccaataggg actttccatt gacgtcaatg ggtggagtat
ttacggtaaa 300ctgcccactt ggcagtacat caagtgtatc atatgccaag tacgccccct
attgacgtca 360atgacggtaa atggcccgcc tggcattatg cccagtacat gaccttatgg
gactttccta 420cttggcagta catctacgta ttagtcatcg ctattaccat ggtgatgcgg
ttttggcagt 480acatcaatgg gcgtggatag cggtttgact cacggggatt tccaagtctc
caccccattg 540acgtcaatgg gagtttgttt tggcaccaaa atcaacggga ctttccaaaa
tgtcgtaaca 600actccgcccc attgacgcaa atgggcggta ggcgtgtacg gtgggaggtc
tatataagca 660gagctggttt agtgaaccgt cagatcgcct a
691285DNAArtificial SequenceDescription of Artificial
Sequence Synthetic construct 2ttccctgcag gattgtttaa acaccagatc
tgcttgaatc cgcggataag aggactagta 60ttcgtctcac tagggagagc tccta
853617DNAArtificial
SequenceDescription of Artificial Sequence Synthetic construct
3tgtacaatcc gcgtgagacg atcggcgcgc ccgcccctct ccctcccccc cccctaacgt
60tactggccga agccgcttgg aataaggccg gtgtgcgttt gtctatatgt tattttccac
120catattgccg tcttttggca atgtgagggc ccggaaacct ggccctgtct tcttgacgag
180cattcctagg ggtctttccc ctctcgccaa aggaatgcaa ggtctgttga atgtcgtgaa
240ggaagcagtt cctctggaag cttcttgaag acaaacaacg tctgtagcga ccctttgcag
300gcagcggaac cccccacctg gcgacaggtg cctctgcggc caaaagccac gtgtataaga
360tacacctgca aaggcggcac aaccccagtg ccacgttgtg agttggatag ttgtggaaag
420agtcaaatgg ctctcctcaa gcgtattcaa caaggggctg aaggatgccc agaaggtacc
480ccattgtatg ggatctgatc tggggcctcg gtgcacatgc tttacatgtg tttagtcgag
540gttaaaaaaa cgtctaggcc ccccgaacca cggggacgtg gttttccttt gaaaaacacg
600atgataatat ggccggc
6174405DNAArtificial SequenceDescription of Artificial Sequence Synthetic
construct 4atggccaagc ctttgtctca agaagaatcc accctcattg aaagggccac
tgctacaatc 60aacagcatcc ccatctctga agactactct gtcgccagcg cagctctctc
ctctgacggg 120agaatcttca ctggtgtcaa tgtatatcat tttactgggg gaccttgcgc
agagcttgtg 180gtcctgggga ctgctgctgc tgctgcagcc ggaaacctga cttgtatcgt
cgccataggg 240aatgagaaca gaggcatctt gagcccctgt gggagatgca gacaagtcct
cctggacctc 300catcctggga tcaaagccat agtgaaggac agtgatggac agcccacagc
cgttgggatc 360agggagttgc tgccatctgg ttatgtgtgg gagggctaat ctaga
40551032DNAArtificial SequenceDescription of Artificial
Sequence Synthetic construct 5atgaaaaagc ctgaactgac tgccacctct
gttgagaagt ttttaataga gaagtttgac 60tctgtgtcag acctcatgca gctttctgag
ggagaggagt ctagagcctt tagctttgat 120gtggggggga gaggctatgt cctgagagtc
aatagctgtg cagatggttt ctacaaagat 180aggtatgtct atagacattt tgcatccgcc
gccctcccca ttccagaggt ccttgacatt 240ggggaattct cagagagcct gacctattgc
atttcccgga gagcccaggg tgtgactctt 300caagacctgc ctgagacaga actccctgca
gtgctccagc ccgtcgccga ggccatggat 360gcaatcgccg ccgcagacct cagccagacc
tcggggtttg ggccctttgg cccccagggg 420ataggccaat acactacatg gagagatttc
atatgcgcta ttgctgaccc ccatgtgtat 480cactggcaaa ctgtgatgga cgacacagtc
tcagcctctg tcgcacaagc cctggacgag 540ctgatgcttt gggccgagga ctgcccagag
gtcagacatc tcgtccatgc cgactttggg 600tcaaacaatg tcctgacgga caatgggaga
atcactgctg tcattgactg gagcgaggcc 660atgtttgggg actcccaata cgaggtcgcc
aacatcttct tctggagacc ctggttggct 720tgtatggagc agcagacccg ttactttgag
aggaggcatc cagagctcgc tgggagccct 780agattgaggg cctatatgct caggataggg
cttgaccaac tctatcagag cttggttgac 840ggcaattttg atgacgcagc ttgggctcag
gggagatgcg acgccatagt gaggagtggg 900gccgggactg tcgggagaac tcagatcgcc
aggaggtcag ctgccgtctg gactgacggc 960tgtgtagaag tcttagccga ctctgggaac
aggagaccca gcactcgtcc agaggccaag 1020gaatgatcta ga
10326610DNAArtificial
SequenceDescription of Artificial Sequence Synthetic construct
6caccatgacc gagtacaagc ccacggtgcg cctcgccacc cgcgacgacg tcccccgggc
60cgttcgcacc ctcgccgccg cgttcgccga ctaccccgcc acgcgccaca ccgtggaccc
120ggacaggcac atcgagcggg tcaccgagct gcaagaactc ttcctcacgc gcgtcgggct
180cgacatcggc aaggtgtggg tcgcggacga cggcgccgct gtggcggtct ggaccacgcc
240ggagagcgtc gaagcggggg cggtgttcgc cgagatcggc ccgcgcatgg ccgagttgag
300cggttcccgg ctggccgcgc agcaacagat ggaaggcctc ctggcgccgc accggcccaa
360ggagcccgcg tggttcctgg ctaccgtcgg agtctcgccc gaccaccagg gcaagggtct
420gggcagcgcc gtcgtgctcc ccggagtgga ggctgccgag cgtgccgggg tgcccgcctt
480cctcgagacc tccgcgcccc gcaacctccc cttctacgag cggctcggct tcaccgtcac
540cgccgacgtc gaggtgcccg aaggaccgcg cacctggtgc atgacccgca agcccggtgc
600ctgatctaga
6107700DNAArtificial SequenceDescription of Artificial Sequence Synthetic
construct 7ggatctttgt gaaggaacct tacttctgtg gtgtgacata attggacaaa
ctacctacag 60agatttaaag ctctaaggta aatataaaat ttttaagtgt ataatgtgtt
aaactactga 120ttctaattgt tgtggtattt tagattccaa cctatggaac ttatgaatgg
gagcagtggt 180ggaatgcctt taatgaggaa aacctgtttt gctcagaaga aatgccatct
agtgatgatg 240aggctactgc tgactctcaa cattctactc ctccaaaaaa gaagagaaag
gtagaagacc 300ccaaggactt tccttcagaa ttggtaagtt ttttgagtca tgctgtgttt
agtaatagaa 360ctcttgcttg ctttgctatt tacaccacaa aggaaaaagc tgcactgcta
tacaagaaaa 420ttatggaaaa atatttgatg tatagtgcct tgactagaga tcataatcag
ccataccaca 480tttgtagagg ttttacttgc tttaaaaaac ctcccacacc tccccctgaa
cctgaaacat 540aaaatgaatg caattgttgt tgttaacttg tttattgcag cttataatgg
ttacaaataa 600agcaatagca tcacaaattt cacaaataaa gcatttttat cactgcattc
tagttgtggt 660ttgtccaaac tcatcaatgt atcttatcat gtctggatcc
70082026DNAArtificial SequenceDescription of Artificial
Sequence Synthetic construct 8actgtcttct ttatcatgca actcgtagga
caggtgccct ggccgggtcc gcaggaaaag 60gacaagcagc gaaaattcac gcccccttgg
gaggtggcgg catatgcaaa ggatagcact 120cccactctac tactgggtat catatgctga
ctgtatatgc atgaggatag catatgctac 180ccggatacag attaggatag catatactac
ccagatatag attaggatag catatgctac 240ccagatatag attaggatag cctatgctac
ccagatataa attaggatag catatactac 300ccagatatag attaggatag catatgctac
ccagatatag attaggatag cctatgctac 360ccagatatag attaggatag catatgctac
ccagatatag attaggatag catatgctat 420ccagatattt gggtagtata tgctacccag
atataaatta ggatagcata tactacccta 480atctctatta ggatagcata tgctacccgg
atacagatta ggatagcata tactacccag 540atatagatta ggatagcata tgctacccag
atatagatta ggatagccta tgctacccag 600atataaatta ggatagcata tactacccag
atatagatta ggatagcata tgctacccag 660atatagatta ggatagccta tgctacccag
atatagatta ggatagcata tgctatccag 720atatttgggt agtatatgct acccatggca
acattagccc accgtgctct cagcgacctc 780gtgaatatga ggaccaacaa ccctgtgctt
ggcgctcagg cgcaagtgtg tgtaatttgt 840cctccagatc gcagcaatcg cgcccctatc
ttggcccgcc cacctactta tgcaggtatt 900ccccggggtg ccattagtgg ttttgtgggc
aagtggtttg accgcagtgg ttagcggggt 960tacaatcagc caagttatta cacccttatt
ttacagtcca aaaccgcagg gcggcgtgtg 1020ggggctgacg cgtgccatca ctccacaatt
tcaagagaaa gagtggccac ttgtctttgt 1080ttatgggccc cattggcgtg gagccccgtt
taattttcgg gggtgttaga gacaaccagt 1140ggagtccgct gctgtcggcg tccactctct
ttccccttgt tacaaataga gtgtaacaac 1200atggttcacc tgtcttggtc cctgcctggg
acacatctta ataaccccag tatcatattg 1260cactaggatt atgtgttgcc catagccata
aattcgtgtg agatggacat ccagtcttta 1320cggcttgtcc ccaccccatg gatttctatt
gttaaagata ttcagaatgt ttcattccta 1380cactaggatt tattgcccaa ggggtttgtg
agggttatat tggtgtcata gcacaatgcc 1440accactgaac ccatcgtcca aattttattc
tggatgcgtc acctgaaacc ttgttttcga 1500gcacctcaca tacaccttac tgttcacaac
tcagcagtta ttctattagc taaacgaagg 1560agaatgaaga agcaggcgaa gattcaggag
agttcactgc ccgctccttg atcttcagcc 1620actgcccttg tgactaaaat ggttcactac
cctcgtggaa tcctgacccc atgtaaataa 1680aaccgtgaca gctcatgggg tgggagatat
cgctgttcct taggaccctt ttactaaccc 1740taattcgata gcatatgctt cccgttgggt
aacatatgct attgaattag ggttagtctg 1800gatagtatat actactaccc gggaagcata
tgctacccgt ttagggttaa caagggggcc 1860ttataaacac tattgctaat gccctcttga
gggtccgctt atcggtagct acacaggccc 1920ctctgattga cgttggtgta gcctcccgta
gtcttcctgg gcccctggga ggtacatgtc 1980ccccagcatt ggtgtaagag cttcagccaa
gagttacaca taaagg 202691015DNAArtificial
SequenceDescription of Artificial Sequence Synthetic construct
9aaaaggggcc cgagcttaag actggccgtc gttttacaac acagaaagag tttgtagaaa
60cgcaaaaagg ccatccgtca ggggccttct gcttagtttg atgcctggca gttccctact
120ctcgccttcc gcttcctcgc tcactgactc gctgcgctcg gtcgttcggc tgcggcgagc
180ggtatcagct cactcaaagg cggtaatacg gttatccaca gaatcagggg ataacgcagg
240aaagaacatg tgagcaaaag gccagcaaaa ggccaggaac cgtaaaaagg ccgcgttgct
300ggcgtttttc cataggctcc gcccccctga cgagcatcac aaaaatcgac gctcaagtca
360gaggtggcga aacccgacag gactataaag ataccaggcg tttccccctg gaagctccct
420cgtgcgctct cctgttccga ccctgccgct taccggatac ctgtccgcct ttctcccttc
480gggaagcgtg gcgctttctc atagctcacg ctgtaggtat ctcagttcgg tgtaggtcgt
540tcgctccaag ctgggctgtg tgcacgaacc ccccgttcag cccgaccgct gcgccttatc
600cggtaactat cgtcttgagt ccaacccggt aagacacgac ttatcgccac tggcagcagc
660cactggtaac aggattagca gagcgaggta tgtaggcggt gctacagagt tcttgaagtg
720gtgggctaac tacggctaca ctagaagaac agtatttggt atctgcgctc tgctgaagcc
780agttaccttc ggaaaaagag ttggtagctc ttgatccggc aaacaaacca ccgctggtag
840cggtggtttt tttgtttgca agcagcagat tacgcgcaga aaaaaaggat ctcaagaaga
900tcctttgatc ttttctacgg ggtctgacgc tcagtggaac gacgcgcgcg taactcacgt
960taagggattt tggtcatgag cttgcgccgt cccgtcaagt cagcgtaatg ctctg
1015101078DNAArtificial SequenceDescription of Artificial Sequence
Synthetic construct 10cttaccaatg cttaatcagt gaggcaccta tctcagcgat
ctgtctattt cgttcatcca 60tagttgcctg actccccgtc gtgtagataa ctacgatacg
ggagggctta ccatctggcc 120ccagcgctgc gatgataccg cgagaaccac gctcaccggc
tccggattta tcagcaataa 180accagccagc cggaagggcc gagcgcagaa gtggtcctgc
aactttatcc gcctccatcc 240agtctattaa ttgttgccgg gaagctagag taagtagttc
gccagttaat agtttgcgca 300acgttgttgc catcgctaca ggcatcgtgg tgtcacgctc
gtcgtttggt atggcttcat 360tcagctccgg ttcccaacga tcaaggcgag ttacatgatc
ccccatgttg tgcaaaaaag 420cggttagctc cttcggtcct ccgatcgttg tcagaagtaa
gttggccgca gtgttatcac 480tcatggttat ggcagcactg cataattctc ttactgtcat
gccatccgta agatgctttt 540ctgtgactgg tgagtactca accaagtcat tctgagaata
gtgtatgcgg cgaccgagtt 600gctcttgccc ggcgtcaata cgggataata ccgcgccaca
tagcagaact ttaaaagtgc 660tcatcattgg aaaacgttct tcggggcgaa aactctcaag
gatcttaccg ctgttgagat 720ccagttcgat gtaacccact cgtgcaccca actgatcttc
agcatctttt actttcacca 780gcgtttctgg gtgagcaaaa acaggaaggc aaaatgccgc
aaaaaaggga ataagggcga 840cacggaaatg ttgaatactc atattcttcc tttttcaata
ttattgaagc atttatcagg 900gttattgtct catgagcgga tacatatttg aatgtattta
gaaaaataaa caaatagggg 960tcagtgttac aaccaattaa ccaattctga acattatcgc
gagcccattt atacctgaat 1020atggctcata acaccccttg cagtgcgact aacggcatga
agctcgtcgg ggcgtacg 1078111228DNAArtificial SequenceDescription of
Artificial Sequence Synthetic construct 11cttagaaaaa ctcatcgagc
atcaaatgaa actgcaattt attcatatca ggattatcaa 60taccatattt ttgaaaaagc
cgtttctgta atgaaggaga aaactcaccg aggcagttcc 120ataggatggc aagatcctgg
tatcggtctg cgattccgac tcgtccaaca tcaatacaac 180ctattaattt cccctcgtca
aaaataaggt tatcaagtga gaaatcacca tgagtgacga 240ctgaatccgg tgagaatggc
aaaagtttat gcatttcttt ccagacttgt tcaacaggcc 300agccattacg ctcgtcatca
aaatcactcg catcaaccaa accgttattc attcgtgatt 360gcgcctgagc gaggcgaaat
acgcgatcgc tgttaaaagg acaattacaa acaggaatcg 420agtgcaaccg gcgcaggaac
actgccagcg catcaacaat attttcacct gaatcaggat 480attcttctaa tacctggaac
gctgtttttc cggggatcgc agtggtgagt aaccatgcat 540catcaggagt acggataaaa
tgcttgatgg tcggaagtgg cataaattcc gtcagccagt 600ttagtctgac catctcatct
gtaacatcat tggcaacgct acctttgcca tgtttcagaa 660acaactctgg cgcatcgggc
ttcccataca agcgatagat tgtcgcacct gattgcccga 720cattatcgcg agcccattta
tacccatata aatcagcatc catgttggaa tttaatcgcg 780gcctcgacgt ttcccgttga
atatggctca tattcttcct ttttcaatat tattgaagca 840tttatcaggg ttattgtctc
atgagcggat acatatttga atgtatttag aaaaataaac 900aaataggggt cagtgttaca
accaattaac caattctgaa cattatcgcg agcccattta 960tacctgaata tggctcataa
caccccttgc agtgcgacta acggcatgaa gctcgtcggg 1020gaaataatga ttttattttg
actgatagtg acctgttcgt tgcaacaaat tgataagcaa 1080tgctttctta taatgccaac
tttgtacaag aaagctgggt ttttttttta gcctgctttt 1140ttgtacaaag ttggcattat
aaaaaagcat tgctcatcaa tttgttgcaa cgaacaggtc 1200actatcagtc aaaataaaat
cattattt 122812291DNAHomo sapiens
12cgtacgtact cctgcttgct gatccacatc tgctggaagg tggacagcga ggccaggatg
60gagccgccga tccacacgga gtacttgcgc tcaggaggag caatgaagct tatctgagga
120gggaagggga caggcagtga ggaccctgga tgtgacagct ccaagcttcc acacaccaca
180ggaccccaca gccgacctgc ccaggtcagc tcaggcagga aagacaccca ccttgatctt
240cattgtgctg ggtgccaggg cagtgatctc cttctgcatc ctgtcatcga t
29113288DNAHomo sapiens 13cgtacgaggt gaggctgcag ttccatgatg tgtccggcga
catcttccac cagcagtgca 60agcgcaacga gctggtgatc cgcgtgcagc ccaacgaggc
cgtgtaccag agaaggagca 120gtgtggaggg tgggcggcct gggcccgggg gactccacat
ggtggcaggc agtggcatca 180gcaagacact ctctccctca cagaacgtga agctccctga
cgcctacgag cgcctcatcc 240tggacgtctt ctgcgggagc cagatgcact tcgtgcgcag
gaatcgat 28814374DNAArtificial SequenceDescription of
Artificial Sequence Synthetic construct 14ttcgaagctg tggaatgtgt
gtcagttagg gtgtggaaag tccccaggct ccccagcagg 60cagaagtatg caaagcatgc
atctcaatta gtcagcaacc aggtgtggaa agtccccagg 120ctccccagca ggcagaagta
tgcaaagcat gcatctcaat tagtcagcaa ccatagtccc 180gcccctaact ccgcccatcc
cgcccctaac tccgcccagt tccgcccatt ctccgcccca 240tggctgacta atttttttta
tttatgcaga ggccgaggcc gcctcggcct ctgagctatt 300ccagaagtag tgaggaggct
tttttggagg cctaggcttt tgcaaaaagc tctgacccct 360cacaaggagc cggc
37415198PRTHomo sapiens
15Met Asp Ser Leu Leu Met Asn Arg Arg Lys Phe Leu Tyr Gln Phe Lys1
5 10 15Asn Val Arg Trp Ala Lys
Gly Arg Arg Glu Thr Tyr Leu Cys Tyr Val 20 25
30Val Lys Arg Arg Asp Ser Ala Thr Ser Phe Ser Leu Asp
Phe Gly Tyr 35 40 45Leu Arg Asn
Lys Asn Gly Cys His Val Glu Leu Leu Phe Leu Arg Tyr 50
55 60Ile Ser Asp Trp Asp Leu Asp Pro Gly Arg Cys Tyr
Arg Val Thr Trp65 70 75
80Phe Thr Ser Trp Ser Pro Cys Tyr Asp Cys Ala Arg His Val Ala Asp
85 90 95Phe Leu Arg Gly Asn Pro
Asn Leu Ser Leu Arg Ile Phe Thr Ala Arg 100
105 110Leu Tyr Phe Cys Glu Asp Arg Lys Ala Glu Pro Glu
Gly Leu Arg Arg 115 120 125Leu His
Arg Ala Gly Val Gln Ile Ala Ile Met Thr Phe Lys Asp Tyr 130
135 140Phe Tyr Cys Trp Asn Thr Phe Val Glu Asn His
Glu Arg Thr Phe Lys145 150 155
160Ala Trp Glu Gly Leu His Glu Asn Ser Val Arg Leu Ser Arg Gln Leu
165 170 175Arg Arg Ile Leu
Leu Pro Leu Tyr Glu Val Asp Asp Leu Arg Asp Ala 180
185 190Phe Arg Thr Leu Gly Leu 19516198PRTMus
musculus 16Met Asp Ser Leu Leu Met Lys Gln Lys Lys Phe Leu Tyr His Phe
Lys1 5 10 15Asn Val Arg
Trp Ala Lys Gly Arg His Glu Thr Tyr Leu Cys Tyr Val 20
25 30Val Lys Arg Arg Asp Ser Ala Thr Ser Cys
Ser Leu Asp Phe Gly His 35 40
45Leu Arg Asn Lys Ser Gly Cys His Val Glu Leu Leu Phe Leu Arg Tyr 50
55 60Ile Ser Asp Trp Asp Leu Asp Pro Gly
Arg Cys Tyr Arg Val Thr Trp65 70 75
80Phe Thr Ser Trp Ser Pro Cys Tyr Asp Cys Ala Arg His Val
Ala Glu 85 90 95Phe Leu
Arg Trp Asn Pro Asn Leu Ser Leu Arg Ile Phe Thr Ala Arg 100
105 110Leu Tyr Phe Cys Glu Asp Arg Lys Ala
Glu Pro Glu Gly Leu Arg Arg 115 120
125Leu His Arg Ala Gly Val Gln Ile Gly Ile Met Thr Phe Lys Asp Tyr
130 135 140Phe Tyr Cys Trp Asn Thr Phe
Val Glu Asn Arg Glu Arg Thr Phe Lys145 150
155 160Ala Trp Glu Gly Leu His Glu Asn Ser Val Arg Leu
Thr Arg Gln Leu 165 170
175Arg Arg Ile Leu Leu Pro Leu Tyr Glu Val Asp Asp Leu Arg Asp Ala
180 185 190Phe Arg Met Leu Gly Phe
195177727DNAArtificial SequenceDescription of Artificial Sequence
Synthetic construct 17agcttggccc attgcatacg ttgtatccat atcataatat
ctacatttat attggctcat 60gtccaacatt accgccatgt tgacattgat tattgactag
ttattaatag taatcaatta 120cggggtcatt agttcatagc ccatatatgg agttccgcgt
tacataactt acggtaaatg 180gcccgcctgg ctgaccgccc aacgaccccc gcccattgac
gtcaataatg acgtatgttc 240ccatagtaac gccaataggg actttccatt gacgtcaatg
ggtggagtat ttacggtaaa 300ctgcccactt ggcagtacat caagtgtatc atatgccaag
tacgccccct attgacgtca 360atgacggtaa atggcccgcc tggcattatg cccagtacat
gaccttatgg gactttccta 420cttggcagta catctacgta ttagtcatcg ctattaccat
ggtgatgcgg ttttggcagt 480acatcaatgg gcgtggatag cggtttgact cacggggatt
tccaagtctc caccccattg 540acgtcaatgg gagtttgttt tggcaccaaa atcaacggga
ctttccaaaa tgtcgtaaca 600actccgcccc attgacgcaa atgggcggta ggcgtgtacg
gtgggaggtc tatataagca 660gagctggttt agtgaaccgt cagatcgcct attccctgca
ggattgttta aacaccagat 720ctgcttgaat ccgcggataa gaggactagt attcgtctca
ctagggagag ctcctagcca 780ccatggctca gtcaaagcac ggtctaacaa aagaaatgac
aatgaaatac cgtatggaag 840ggtgcgtcga tggacataaa tttgtgatca cgggagaggg
cattggatat ccgttcaaag 900ggaaacaggc tattaatctg tgtgtggtcg aaggtggacc
attgccattt gccgaagaca 960tattgtcagc tgcctttatg tacggaaaca gggttttcac
tgaatatcct caagacatag 1020ctgactattt caagaactcg tgtcctgctg gttatacatg
ggacaggtct tttctctttg 1080aggatggagc agtttgcata tgtaatgcag atataacagt
gagtgttgaa gaaaactgca 1140tgtatcatga gtccaaattt tatggagtga attttcctgc
tgatggacct gtgatgaaaa 1200agatgacaga taactgggag ccatcctgcg agaagatcat
accagtacct aagcagggga 1260tattgaaagg ggatgtctcc atgtacctcc ttctgaagga
tggtgggcgt ttacggtgcc 1320aattcgacac agtttacaaa gcaaagtctg tgccaagaaa
gatgccggac tggcacttca 1380tccagcataa gctcacccgt gaagaccgca gcgatgctaa
gaatcagaaa tggcatctga 1440cagaacatgc tattgcatcc ggatctgcat tgccctaccc
atacgacgtc ccagactacg 1500cttagtgtac aatccgcgtg agacgatcgg cgcgcccgcc
cctctccctc ccccccccct 1560aacgttactg gccgaagccg cttggaataa ggccggtgtg
cgtttgtcta tatgttattt 1620tccaccatat tgccgtcttt tggcaatgtg agggcccgga
aacctggccc tgtcttcttg 1680acgagcattc ctaggggtct ttcccctctc gccaaaggaa
tgcaaggtct gttgaatgtc 1740gtgaaggaag cagttcctct ggaagcttct tgaagacaaa
caacgtctgt agcgaccctt 1800tgcaggcagc ggaacccccc acctggcgac aggtgcctct
gcggccaaaa gccacgtgta 1860taagatacac ctgcaaaggc ggcacaaccc cagtgccacg
ttgtgagttg gatagttgtg 1920gaaagagtca aatggctctc ctcaagcgta ttcaacaagg
ggctgaagga tgcccagaag 1980gtaccccatt gtatgggatc tgatctgggg cctcggtgca
catgctttac atgtgtttag 2040tcgaggttaa aaaaacgtct aggccccccg aaccacgggg
acgtggtttt cctttgaaaa 2100acacgatgat aatatggccg gcatggccaa gcctttgtct
caagaagaat ccaccctcat 2160tgaaagggcc actgctacaa tcaacagcat ccccatctct
gaagactact ctgtcgccag 2220cgcagctctc tcctctgacg ggagaatctt cactggtgtc
aatgtatatc attttactgg 2280gggaccttgc gcagagcttg tggtcctggg gactgctgct
gctgctgcag ccggaaacct 2340gacttgtatc gtcgccatag ggaatgagaa cagaggcatc
ttgagcccct gtgggagatg 2400cagacaagtc ctcctggacc tccatcctgg gatcaaagcc
atagtgaagg acagtgatgg 2460acagcccaca gccgttggga tcagggagtt gctgccatct
ggttatgtgt gggagggcta 2520atctagagga tctttgtgaa ggaaccttac ttctgtggtg
tgacataatt ggacaaacta 2580cctacagaga tttaaagctc taaggtaaat ataaaatttt
taagtgtata atgtgttaaa 2640ctactgattc taattgttgt ggtattttag attccaacct
atggaactta tgaatgggag 2700cagtggtgga atgcctttaa tgaggaaaac ctgttttgct
cagaagaaat gccatctagt 2760gatgatgagg ctactgctga ctctcaacat tctactcctc
caaaaaagaa gagaaaggta 2820gaagacccca aggactttcc ttcagaattg gtaagttttt
tgagtcatgc tgtgtttagt 2880aatagaactc ttgcttgctt tgctatttac accacaaagg
aaaaagctgc actgctatac 2940aagaaaatta tggaaaaata tttgatgtat agtgccttga
ctagagatca taatcagcca 3000taccacattt gtagaggttt tacttgcttt aaaaaacctc
ccacacctcc ccctgaacct 3060gaaacataaa atgaatgcaa ttgttgttgt taacttgttt
attgcagctt ataatggtta 3120caaataaagc aatagcatca caaatttcac aaataaagca
tttttatcac tgcattctag 3180ttgtggtttg tccaaactca tcaatgtatc ttatcatgtc
tggatccact gtcttcttta 3240tcatgcaact cgtaggacag gtgccctggc cgggtccgca
ggaaaaggac aagcagcgaa 3300aattcacgcc cccttgggag gtggcggcat atgcaaagga
tagcactccc actctactac 3360tgggtatcat atgctgactg tatatgcatg aggatagcat
atgctacccg gatacagatt 3420aggatagcat atactaccca gatatagatt aggatagcat
atgctaccca gatatagatt 3480aggatagcct atgctaccca gatataaatt aggatagcat
atactaccca gatatagatt 3540aggatagcat atgctaccca gatatagatt aggatagcct
atgctaccca gatatagatt 3600aggatagcat atgctaccca gatatagatt aggatagcat
atgctatcca gatatttggg 3660tagtatatgc tacccagata taaattagga tagcatatac
taccctaatc tctattagga 3720tagcatatgc tacccggata cagattagga tagcatatac
tacccagata tagattagga 3780tagcatatgc tacccagata tagattagga tagcctatgc
tacccagata taaattagga 3840tagcatatac tacccagata tagattagga tagcatatgc
tacccagata tagattagga 3900tagcctatgc tacccagata tagattagga tagcatatgc
tatccagata tttgggtagt 3960atatgctacc catggcaaca ttagcccacc gtgctctcag
cgacctcgtg aatatgagga 4020ccaacaaccc tgtgcttggc gctcaggcgc aagtgtgtgt
aatttgtcct ccagatcgca 4080gcaatcgcgc ccctatcttg gcccgcccac ctacttatgc
aggtattccc cggggtgcca 4140ttagtggttt tgtgggcaag tggtttgacc gcagtggtta
gcggggttac aatcagccaa 4200gttattacac ccttatttta cagtccaaaa ccgcagggcg
gcgtgtgggg gctgacgcgt 4260gccatcactc cacaatttca agagaaagag tggccacttg
tctttgttta tgggccccat 4320tggcgtggag ccccgtttaa ttttcggggg tgttagagac
aaccagtgga gtccgctgct 4380gtcggcgtcc actctctttc cccttgttac aaatagagtg
taacaacatg gttcacctgt 4440cttggtccct gcctgggaca catcttaata accccagtat
catattgcac taggattatg 4500tgttgcccat agccataaat tcgtgtgaga tggacatcca
gtctttacgg cttgtcccca 4560ccccatggat ttctattgtt aaagatattc agaatgtttc
attcctacac taggatttat 4620tgcccaaggg gtttgtgagg gttatattgg tgtcatagca
caatgccacc actgaaccca 4680tcgtccaaat tttattctgg atgcgtcacc tgaaaccttg
ttttcgagca cctcacatac 4740accttactgt tcacaactca gcagttattc tattagctaa
acgaaggaga atgaagaagc 4800aggcgaagat tcaggagagt tcactgcccg ctccttgatc
ttcagccact gcccttgtga 4860ctaaaatggt tcactaccct cgtggaatcc tgaccccatg
taaataaaac cgtgacagct 4920catggggtgg gagatatcgc tgttccttag gaccctttta
ctaaccctaa ttcgatagca 4980tatgcttccc gttgggtaac atatgctatt gaattagggt
tagtctggat agtatatact 5040actacccggg aagcatatgc tacccgttta gggttaacaa
gggggcctta taaacactat 5100tgctaatgcc ctcttgaggg tccgcttatc ggtagctaca
caggcccctc tgattgacgt 5160tggtgtagcc tcccgtagtc ttcctgggcc cctgggaggt
acatgtcccc cagcattggt 5220gtaagagctt cagccaagag ttacacataa aggaaaaggg
gcccgagctt aagactggcc 5280gtcgttttac aacacagaaa gagtttgtag aaacgcaaaa
aggccatccg tcaggggcct 5340tctgcttagt ttgatgcctg gcagttccct actctcgcct
tccgcttcct cgctcactga 5400ctcgctgcgc tcggtcgttc ggctgcggcg agcggtatca
gctcactcaa aggcggtaat 5460acggttatcc acagaatcag gggataacgc aggaaagaac
atgtgagcaa aaggccagca 5520aaaggccagg aaccgtaaaa aggccgcgtt gctggcgttt
ttccataggc tccgcccccc 5580tgacgagcat cacaaaaatc gacgctcaag tcagaggtgg
cgaaacccga caggactata 5640aagataccag gcgtttcccc ctggaagctc cctcgtgcgc
tctcctgttc cgaccctgcc 5700gcttaccgga tacctgtccg cctttctccc ttcgggaagc
gtggcgcttt ctcatagctc 5760acgctgtagg tatctcagtt cggtgtaggt cgttcgctcc
aagctgggct gtgtgcacga 5820accccccgtt cagcccgacc gctgcgcctt atccggtaac
tatcgtcttg agtccaaccc 5880ggtaagacac gacttatcgc cactggcagc agccactggt
aacaggatta gcagagcgag 5940gtatgtaggc ggtgctacag agttcttgaa gtggtgggct
aactacggct acactagaag 6000aacagtattt ggtatctgcg ctctgctgaa gccagttacc
ttcggaaaaa gagttggtag 6060ctcttgatcc ggcaaacaaa ccaccgctgg tagcggtggt
ttttttgttt gcaagcagca 6120gattacgcgc agaaaaaaag gatctcaaga agatcctttg
atcttttcta cggggtctga 6180cgctcagtgg aacgacgcgc gcgtaactca cgttaaggga
ttttggtcat gagcttgcgc 6240cgtcccgtca agtcagcgta atgctctgct taccaatgct
taatcagtga ggcacctatc 6300tcagcgatct gtctatttcg ttcatccata gttgcctgac
tccccgtcgt gtagataact 6360acgatacggg agggcttacc atctggcccc agcgctgcga
tgataccgcg agaaccacgc 6420tcaccggctc cggatttatc agcaataaac cagccagccg
gaagggccga gcgcagaagt 6480ggtcctgcaa ctttatccgc ctccatccag tctattaatt
gttgccggga agctagagta 6540agtagttcgc cagttaatag tttgcgcaac gttgttgcca
tcgctacagg catcgtggtg 6600tcacgctcgt cgtttggtat ggcttcattc agctccggtt
cccaacgatc aaggcgagtt 6660acatgatccc ccatgttgtg caaaaaagcg gttagctcct
tcggtcctcc gatcgttgtc 6720agaagtaagt tggccgcagt gttatcactc atggttatgg
cagcactgca taattctctt 6780actgtcatgc catccgtaag atgcttttct gtgactggtg
agtactcaac caagtcattc 6840tgagaatagt gtatgcggcg accgagttgc tcttgcccgg
cgtcaatacg ggataatacc 6900gcgccacata gcagaacttt aaaagtgctc atcattggaa
aacgttcttc ggggcgaaaa 6960ctctcaagga tcttaccgct gttgagatcc agttcgatgt
aacccactcg tgcacccaac 7020tgatcttcag catcttttac tttcaccagc gtttctgggt
gagcaaaaac aggaaggcaa 7080aatgccgcaa aaaagggaat aagggcgaca cggaaatgtt
gaatactcat attcttcctt 7140tttcaatatt attgaagcat ttatcagggt tattgtctca
tgagcggata catatttgaa 7200tgtatttaga aaaataaaca aataggggtc agtgttacaa
ccaattaacc aattctgaac 7260attatcgcga gcccatttat acctgaatat ggctcataac
accccttgca gtgcgactaa 7320cggcatgaag ctcgtcgggg cgtacgaggt gaggctgcag
ttccatgatg tgtccggcga 7380catcttccac cagcagtgca agcgcaacga gctggtgatc
cgcgtgcagc ccaacgaggc 7440cgtgtaccag agaaggagca gtgtggaggg tgggcggcct
gggcccgggg gactccacat 7500ggtggcaggc agtggcatca gcaagacact ctctccctca
cagaacgtga agctccctga 7560cgcctacgag cgcctcatcc tggacgtctt ctgcgggagc
cagatgcact tcgtgcgcag 7620gaatcgatta aagattctcg agcaaggtct catcgaaatt
gatcaaggga attcacactt 7680caaccggtca aggcctgaga ccagtgcggc cgcaaacaca
agctagc 7727187801DNAArtificial SequenceDescription of
Artificial Sequence Synthetic construct 18agcttggccc attgcatacg
ttgtatccat atcataatat ctacatttat attggctcat 60gtccaacatt accgccatgt
tgacattgat tattgactag ttattaatag taatcaatta 120cggggtcatt agttcatagc
ccatatatgg agttccgcgt tacataactt acggtaaatg 180gcccgcctgg ctgaccgccc
aacgaccccc gcccattgac gtcaataatg acgtatgttc 240ccatagtaac gccaataggg
actttccatt gacgtcaatg ggtggagtat ttacggtaaa 300ctgcccactt ggcagtacat
caagtgtatc atatgccaag tacgccccct attgacgtca 360atgacggtaa atggcccgcc
tggcattatg cccagtacat gaccttatgg gactttccta 420cttggcagta catctacgta
ttagtcatcg ctattaccat ggtgatgcgg ttttggcagt 480acatcaatgg gcgtggatag
cggtttgact cacggggatt tccaagtctc caccccattg 540acgtcaatgg gagtttgttt
tggcaccaaa atcaacggga ctttccaaaa tgtcgtaaca 600actccgcccc attgacgcaa
atgggcggta ggcgtgtacg gtgggaggtc tatataagca 660gagctggttt agtgaaccgt
cagatcgcct attccctgca ggattgttta aacaccagat 720ctgcttgaat ccgcggataa
gaggactagt attcgtctca ctagggagag ctcctagcca 780ccatggctca gtcaaagcac
ggtctaacaa aagaaatgac aatgaaatac cgtatggaag 840ggtgcgtcga tggacataaa
tttgtgatca cgggagaggg cattggatat ccgttcaaag 900ggaaacaggc tattaatctg
tgtgtggtcg aaggtggacc attgccattt gccgaagaca 960tattgtcagc tgcctttatg
tacggaaaca gggttttcac tgaatatcct caagacatag 1020ctgactattt caagaactcg
tgtcctgctg gttatacatg ggacaggtct tttctctttg 1080aggatggagc agtttgcata
tgtaatgcag atataacagt gagtgttgaa gaaaactgca 1140tgtatcatga gtccaaattt
tatggagtga attttcctgc tgatggacct gtgatgaaaa 1200agatgacaga taactgggag
ccatcctgcg agaagatcat accagtacct aagcagggga 1260tattgaaagg ggatgtctcc
atgtacctcc ttctgaagga tggtgggcgt ttacggtgcc 1320aattcgacac agtttacaaa
gcaaagtctg tgccaagaaa gatgccggac tggcacttca 1380tccagcataa gctcacccgt
gaagaccgca gcgatgctaa gaatcagaaa tggcatctga 1440cagaacatgc tattgcatcc
ggatctgcat tgccctaccc atacgacgtc ccagactacg 1500cttagtgtac aatccgcgtg
agacgatcgg cgcgccatcc gtggttggct agaggatctt 1560tgtgaaggaa ccttacttct
gtggtgtgac ataattggac aaactaccta cagagattta 1620aagctctaag gtaaatataa
aatttttaag tgtataatgt gttaaactac tgattctaat 1680tgttgtggta ttttagattc
caacctatgg aacttatgaa tgggagcagt ggtggaatgc 1740ctttaatgag gaaaacctgt
tttgctcaga agaaatgcca tctagtgatg atgaggctac 1800tgctgactct caacattcta
ctcctccaaa aaagaagaga aaggtagaag accccaagga 1860ctttccttca gaattggtaa
gttttttgag tcatgctgtg tttagtaata gaactcttgc 1920ttgctttgct atttacacca
caaaggaaaa agctgcactg ctatacaaga aaattatgga 1980aaaatatttg atgtatagtg
ccttgactag agatcataat cagccatacc acatttgtag 2040aggttttact tgctttaaaa
aacctcccac acctccccct gaacctgaaa cataaaatga 2100atgcaattgt tgttgttaac
ttgtttattg cagcttataa tggttacaaa taaagcaata 2160gcatcacaaa tttcacaaat
aaagcatttt tatcactgca ttctagttgt ggtttgtcca 2220aactcatcaa tgtatcttat
catgtctgga tccactgtct tctttatcat gcaactcgta 2280ggacaggtgc cctggccggg
tccgcaggaa aaggacaagc agcgaaaatt cacgccccct 2340tgggaggtgg cggcatatgc
aaaggatagc actcccactc tactactggg tatcatatgc 2400tgactgtata tgcatgagga
tagcatatgc tacccggata cagattagga tagcatatac 2460tacccagata tagattagga
tagcatatgc tacccagata tagattagga tagcctatgc 2520tacccagata taaattagga
tagcatatac tacccagata tagattagga tagcatatgc 2580tacccagata tagattagga
tagcctatgc tacccagata tagattagga tagcatatgc 2640tacccagata tagattagga
tagcatatgc tatccagata tttgggtagt atatgctacc 2700cagatataaa ttaggatagc
atatactacc ctaatctcta ttaggatagc atatgctacc 2760cggatacaga ttaggatagc
atatactacc cagatataga ttaggatagc atatgctacc 2820cagatataga ttaggatagc
ctatgctacc cagatataaa ttaggatagc atatactacc 2880cagatataga ttaggatagc
atatgctacc cagatataga ttaggatagc ctatgctacc 2940cagatataga ttaggatagc
atatgctatc cagatatttg ggtagtatat gctacccatg 3000gcaacattag cccaccgtgc
tctcagcgac ctcgtgaata tgaggaccaa caaccctgtg 3060cttggcgctc aggcgcaagt
gtgtgtaatt tgtcctccag atcgcagcaa tcgcgcccct 3120atcttggccc gcccacctac
ttatgcaggt attccccggg gtgccattag tggttttgtg 3180ggcaagtggt ttgaccgcag
tggttagcgg ggttacaatc agccaagtta ttacaccctt 3240attttacagt ccaaaaccgc
agggcggcgt gtgggggctg acgcgtgcca tcactccaca 3300atttcaagag aaagagtggc
cacttgtctt tgtttatggg ccccattggc gtggagcccc 3360gtttaatttt cgggggtgtt
agagacaacc agtggagtcc gctgctgtcg gcgtccactc 3420tctttcccct tgttacaaat
agagtgtaac aacatggttc acctgtcttg gtccctgcct 3480gggacacatc ttaataaccc
cagtatcata ttgcactagg attatgtgtt gcccatagcc 3540ataaattcgt gtgagatgga
catccagtct ttacggcttg tccccacccc atggatttct 3600attgttaaag atattcagaa
tgtttcattc ctacactagg atttattgcc caaggggttt 3660gtgagggtta tattggtgtc
atagcacaat gccaccactg aacccatcgt ccaaatttta 3720ttctggatgc gtcacctgaa
accttgtttt cgagcacctc acatacacct tactgttcac 3780aactcagcag ttattctatt
agctaaacga aggagaatga agaagcaggc gaagattcag 3840gagagttcac tgcccgctcc
ttgatcttca gccactgccc ttgtgactaa aatggttcac 3900taccctcgtg gaatcctgac
cccatgtaaa taaaaccgtg acagctcatg gggtgggaga 3960tatcgctgtt ccttaggacc
cttttactaa ccctaattcg atagcatatg cttcccgttg 4020ggtaacatat gctattgaat
tagggttagt ctggatagta tatactacta cccgggaagc 4080atatgctacc cgtttagggt
taacaagggg gccttataaa cactattgct aatgccctct 4140tgagggtccg cttatcggta
gctacacagg cccctctgat tgacgttggt gtagcctccc 4200gtagtcttcc tgggcccctg
ggaggtacat gtcccccagc attggtgtaa gagcttcagc 4260caagagttac acataaagga
aaaggggccc gagttcgaag ctgtggaatg tgtgtcagtt 4320agggtgtgga aagtccccag
gctccccagc aggcagaagt atgcaaagca tgcatctcaa 4380ttagtcagca accaggtgtg
gaaagtcccc aggctcccca gcaggcagaa gtatgcaaag 4440catgcatctc aattagtcag
caaccatagt cccgccccta actccgccca tcccgcccct 4500aactccgccc agttccgccc
attctccgcc ccatggctga ctaatttttt ttatttatgc 4560agaggccgag gccgcctcgg
cctctgagct attccagaag tagtgaggag gcttttttgg 4620aggcctaggc ttttgcaaaa
agctctgacc cctcacaagg agccggcatg gccaagcctt 4680tgtctcaaga agaatccacc
ctcattgaaa gggccactgc tacaatcaac agcatcccca 4740tctctgaaga ctactctgtc
gccagcgcag ctctctcctc tgacgggaga atcttcactg 4800gtgtcaatgt atatcatttt
actgggggac cttgcgcaga gcttgtggtc ctggggactg 4860ctgctgctgc tgcagccgga
aacctgactt gtatcgtcgc catagggaat gagaacagag 4920gcatcttgag cccctgtggg
agatgcagac aagtcctcct ggacctccat cctgggatca 4980aagccatagt gaaggacagt
gatggacagc ccacagccgt tgggatcagg gagttgctgc 5040catctggtta tgtgtgggag
ggctaatcta gacgaccgaa aggaggatca taatcagcca 5100taccacattt gtagaggttt
tacttgcttt aaaaaacctc ccacacctcc ccctgaacct 5160gaaacataaa atgaatgcaa
ttgttgttgt taacttgttt attgcagctt ataatggtta 5220caaataaagc aatagcatca
caaatttcac aaataaagca tttttttcac tgcattctag 5280ttgtggtttg tccaaactca
tcaatgtatc ttatcatgtc tggatcttcg aaatcatcct 5340taagactggc cgtcgtttta
caacacagaa agagtttgta gaaacgcaaa aaggccatcc 5400gtcaggggcc ttctgcttag
tttgatgcct ggcagttccc tactctcgcc ttccgcttcc 5460tcgctcactg actcgctgcg
ctcggtcgtt cggctgcggc gagcggtatc agctcactca 5520aaggcggtaa tacggttatc
cacagaatca ggggataacg caggaaagaa catgtgagca 5580aaaggccagc aaaaggccag
gaaccgtaaa aaggccgcgt tgctggcgtt tttccatagg 5640ctccgccccc ctgacgagca
tcacaaaaat cgacgctcaa gtcagaggtg gcgaaacccg 5700acaggactat aaagatacca
ggcgtttccc cctggaagct ccctcgtgcg ctctcctgtt 5760ccgaccctgc cgcttaccgg
atacctgtcc gcctttctcc cttcgggaag cgtggcgctt 5820tctcatagct cacgctgtag
gtatctcagt tcggtgtagg tcgttcgctc caagctgggc 5880tgtgtgcacg aaccccccgt
tcagcccgac cgctgcgcct tatccggtaa ctatcgtctt 5940gagtccaacc cggtaagaca
cgacttatcg ccactggcag cagccactgg taacaggatt 6000agcagagcga ggtatgtagg
cggtgctaca gagttcttga agtggtgggc taactacggc 6060tacactagaa gaacagtatt
tggtatctgc gctctgctga agccagttac cttcggaaaa 6120agagttggta gctcttgatc
cggcaaacaa accaccgctg gtagcggtgg tttttttgtt 6180tgcaagcagc agattacgcg
cagaaaaaaa ggatctcaag aagatccttt gatcttttct 6240acggggtctg acgctcagtg
gaacgacgcg cgcgtaactc acgttaaggg attttggtca 6300tgagcttgcg ccgtcccgtc
aagtcagcgt aatgctctgc ttaccaatgc ttaatcagtg 6360aggcacctat ctcagcgatc
tgtctatttc gttcatccat agttgcctga ctccccgtcg 6420tgtagataac tacgatacgg
gagggcttac catctggccc cagcgctgcg atgataccgc 6480gagaaccacg ctcaccggct
ccggatttat cagcaataaa ccagccagcc ggaagggccg 6540agcgcagaag tggtcctgca
actttatccg cctccatcca gtctattaat tgttgccggg 6600aagctagagt aagtagttcg
ccagttaata gtttgcgcaa cgttgttgcc atcgctacag 6660gcatcgtggt gtcacgctcg
tcgtttggta tggcttcatt cagctccggt tcccaacgat 6720caaggcgagt tacatgatcc
cccatgttgt gcaaaaaagc ggttagctcc ttcggtcctc 6780cgatcgttgt cagaagtaag
ttggccgcag tgttatcact catggttatg gcagcactgc 6840ataattctct tactgtcatg
ccatccgtaa gatgcttttc tgtgactggt gagtactcaa 6900ccaagtcatt ctgagaatag
tgtatgcggc gaccgagttg ctcttgcccg gcgtcaatac 6960gggataatac cgcgccacat
agcagaactt taaaagtgct catcattgga aaacgttctt 7020cggggcgaaa actctcaagg
atcttaccgc tgttgagatc cagttcgatg taacccactc 7080gtgcacccaa ctgatcttca
gcatctttta ctttcaccag cgtttctggg tgagcaaaaa 7140caggaaggca aaatgccgca
aaaaagggaa taagggcgac acggaaatgt tgaatactca 7200tattcttcct ttttcaatat
tattgaagca tttatcaggg ttattgtctc atgagcggat 7260acatatttga atgtatttag
aaaaataaac aaataggggt cagtgttaca accaattaac 7320caattctgaa cattatcgcg
agcccattta tacctgaata tggctcataa caccccttgc 7380agtgcgacta acggcatgaa
gctcgtcggg gcgtacgtac tcctgcttgc tgatccacat 7440ctgctggaag gtggacagcg
aggccaggat ggagccgccg atccacacgg agtacttgcg 7500ctcaggagga gcaatgaagc
ttatctgagg agggaagggg acaggcagtg aggaccctgg 7560atgtgacagc tccaagcttc
cacacaccac aggaccccac agccgacctg cccaggtcag 7620ctcaggcagg aaagacaccc
accttgatct tcattgtgct gggtgccagg gcagtgatct 7680ccttctgcat cctgtcatcg
attaaagatt ctcgagcaag gtctcatcga aattgatcaa 7740gggaattcac acttcaaccg
gtcaaggcct gagaccagtg cggccgcaaa cacaagctag 7800c
7801199433DNAArtificial
SequenceDescription of Artificial Sequence Synthetic construct
19agcttggccc attgcatacg ttgtatccat atcataatat ctacatttat attggctcat
60gtccaacatt accgccatgt tgacattgat tattgactag ttattaatag taatcaatta
120cggggtcatt agttcatagc ccatatatgg agttccgcgt tacataactt acggtaaatg
180gcccgcctgg ctgaccgccc aacgaccccc gcccattgac gtcaataatg acgtatgttc
240ccatagtaac gccaataggg actttccatt gacgtcaatg ggtggagtat ttacggtaaa
300ctgcccactt ggcagtacat caagtgtatc atatgccaag tacgccccct attgacgtca
360atgacggtaa atggcccgcc tggcattatg cccagtacat gaccttatgg gactttccta
420cttggcagta catctacgta ttagtcatcg ctattaccat ggtgatgcgg ttttggcagt
480acatcaatgg gcgtggatag cggtttgact cacggggatt tccaagtctc caccccattg
540acgtcaatgg gagtttgttt tggcaccaaa atcaacggga ctttccaaaa tgtcgtaaca
600actccgcccc attgacgcaa atgggcggta ggcgtgtacg gtgggaggtc tatataagca
660gagctggttt agtgaaccgt cagatcgcct attccctgca ggattgttta aacaccagat
720ctgcttgaat ccgcggataa gaggactagt attcgtctca ctagggagag ctcctagcca
780ccatggttag taaaggagaa gaaacaacaa tgggagtaat aaagccagac atgaagatta
840agttgaagat ggagggcaat gtaaacgggc atgcttttgt tatagaggga gaaggtgagg
900gcaagcccta tgatggtaca aacactatta accttgaggt taaggaaggt gcaccactgc
960cttttagtta tgacatactt acaactgcct ttgcatatgg taacagagct tttacaaagt
1020accctgatga catacctaac tacttcaagc agagcttccc cgagggttac agttgggagc
1080gtaccatgac ctttgaggat aagggtattg ttaaagtaaa atctgacatc agtatggagg
1140aggacagctt tatatacgag atacacctga agggtgaaaa cttcccacct aatggccctg
1200taatgcagaa gaaaacaacc ggatgggatg ccagtacaga aagaatgtat gttcgggatg
1260gtgtacttaa aggtgatgta aaacacaagt tgctactgga gggaggtggg catcaccgag
1320ttgacttcaa aactatctac cgggcaaaga aagcagttaa actacccgat taccactttg
1380ttgaccaccg catagaaata ctgaaccacg acaaggacta caacaaggtt actgtatacg
1440aatcagcagt agcccgtaac agtacagatg gcatggatga gctgtataag tacccatacg
1500acgtcccaga ctacgcttag tgtacaatcc gcgtgagacg atcggcgcgc ccgcccctct
1560ccctcccccc cccctaacgt tactggccga agccgcttgg aataaggccg gtgtgcgttt
1620gtctatatgt tattttccac catattgccg tcttttggca atgtgagggc ccggaaacct
1680ggccctgtct tcttgacgag cattcctagg ggtctttccc ctctcgccaa aggaatgcaa
1740ggtctgttga atgtcgtgaa ggaagcagtt cctctggaag cttcttgaag acaaacaacg
1800tctgtagcga ccctttgcag gcagcggaac cccccacctg gcgacaggtg cctctgcggc
1860caaaagccac gtgtataaga tacacctgca aaggcggcac aaccccagtg ccacgttgtg
1920agttggatag ttgtggaaag agtcaaatgg ctctcctcaa gcgtattcaa caaggggctg
1980aaggatgccc agaaggtacc ccattgtatg ggatctgatc tggggcctcg gtgcacatgc
2040tttacatgtg tttagtcgag gttaaaaaaa cgtctaggcc ccccgaacca cggggacgtg
2100gttttccttt gaaaaacacg atgataatat ggccggcacc atgacagagt acaagcccac
2160tgtgagactg gccaccagag atgatgtccc aagggcagtg agaacccttg cagctgcatt
2220tgctgactac ccagccacta gacatactgt tgacccagac agacacattg agagggtcac
2280tgagctgcaa gaactcttcc tcacgagggt cgggctcgac attgggaaag tgtgggtcgc
2340cgacgacgga gccgcagtgg ccgtctggac cacccccgag tcagtcgagg ccggggctgt
2400cttcgccgag attggacccc gcatggcaga gctgtcaggg tctaggctgg ccgcccagca
2460gcagatggaa ggcctcctgg ccccccatcg gcccaaggag cccgcctggt tcctggccac
2520tgtcggagtc tctcccgacc accagggcaa gggtctgggg agtgcagtcg tgctccctgg
2580ggtcgaggct gccgagagag ccggggtgcc cgccttcctg gaaacctcgg ccccccgcaa
2640cctccccttc tacgagagat tggggtttac cgtcaccgcc gacgtcgagt gccccaagga
2700cagggccacc tggtgcatga ccaggaagcc cggggcctga ttctagagga tctttgtgaa
2760ggaaccttac ttctgtggtg tgacataatt ggacaaacta cctacagaga tttaaagctc
2820taaggtaaat ataaaatttt taagtgtata atgtgttaaa ctactgattc taattgttgt
2880ggtattttag attccaacct atggaactta tgaatgggag cagtggtgga atgcctttaa
2940tgaggaaaac ctgttttgct cagaagaaat gccatctagt gatgatgagg ctactgctga
3000ctctcaacat tctactcctc caaaaaagaa gagaaaggta gaagacccca aggactttcc
3060ttcagaattg gtaagttttt tgagtcatgc tgtgtttagt aatagaactc ttgcttgctt
3120tgctatttac accacaaagg aaaaagctgc actgctatac aagaaaatta tggaaaaata
3180tttgatgtat agtgccttga ctagagatca taatcagcca taccacattt gtagaggttt
3240tacttgcttt aaaaaacctc ccacacctcc ccctgaacct gaaacataaa atgaatgcaa
3300ttgttgttgt taacttgttt attgcagctt ataatggtta caaataaagc aatagcatca
3360caaatttcac aaataaagca tttttatcac tgcattctag ttgtggtttg tccaaactca
3420tcaatgtatc ttatcatgtc tggatccact gtcttcttta tcatgcaact cgtaggacag
3480gtgccctggc cgggtccgca ggaaaaggac aagcagcgaa aattcacgcc cccttgggag
3540gtggcggcat atgcaaagga tagcactccc actctactac tgggtatcat atgctgactg
3600tatatgcatg aggatagcat atgctacccg gatacagatt aggatagcat atactaccca
3660gatatagatt aggatagcat atgctaccca gatatagatt aggatagcct atgctaccca
3720gatataaatt aggatagcat atactaccca gatatagatt aggatagcat atgctaccca
3780gatatagatt aggatagcct atgctaccca gatatagatt aggatagcat atgctaccca
3840gatatagatt aggatagcat atgctatcca gatatttggg tagtatatgc tacccagata
3900taaattagga tagcatatac taccctaatc tctattagga tagcatatgc tacccggata
3960cagattagga tagcatatac tacccagata tagattagga tagcatatgc tacccagata
4020tagattagga tagcctatgc tacccagata taaattagga tagcatatac tacccagata
4080tagattagga tagcatatgc tacccagata tagattagga tagcctatgc tacccagata
4140tagattagga tagcatatgc tatccagata tttgggtagt atatgctacc catggcaaca
4200ttagcccacc gtgctctcag cgacctcgtg aatatgagga ccaacaaccc tgtgcttggc
4260gctcaggcgc aagtgtgtgt aatttgtcct ccagatcgca gcaatcgcgc ccctatcttg
4320gcccgcccac ctacttatgc aggtattccc cggggtgcca ttagtggttt tgtgggcaag
4380tggtttgacc gcagtggtta gcggggttac aatcagccaa gttattacac ccttatttta
4440cagtccaaaa ccgcagggcg gcgtgtgggg gctgacgcgt gccatcactc cacaatttca
4500agagaaagag tggccacttg tctttgttta tgggccccat tggcgtggag ccccgtttaa
4560ttttcggggg tgttagagac aaccagtgga gtccgctgct gtcggcgtcc actctctttc
4620cccttgttac aaatagagtg taacaacatg gttcacctgt cttggtccct gcctgggaca
4680catcttaata accccagtat catattgcac taggattatg tgttgcccat agccataaat
4740tcgtgtgaga tggacatcca gtctttacgg cttgtcccca ccccatggat ttctattgtt
4800aaagatattc agaatgtttc attcctacac taggatttat tgcccaaggg gtttgtgagg
4860gttatattgg tgtcatagca caatgccacc actgaaccca tcgtccaaat tttattctgg
4920atgcgtcacc tgaaaccttg ttttcgagca cctcacatac accttactgt tcacaactca
4980gcagttattc tattagctaa acgaaggaga atgaagaagc aggcgaagat tcaggagagt
5040tcactgcccg ctccttgatc ttcagccact gcccttgtga ctaaaatggt tcactaccct
5100cgtggaatcc tgaccccatg taaataaaac cgtgacagct catggggtgg gagatatcgc
5160tgttccttag gaccctttta ctaaccctaa ttcgatagca tatgcttccc gttgggtaac
5220atatgctatt gaattagggt tagtctggat agtatatact actacccggg aagcatatgc
5280tacccgttta gggttaacaa gggggcctta taaacactat tgctaatgcc ctcttgaggg
5340tccgcttatc ggtagctaca caggcccctc tgattgacgt tggtgtagcc tcccgtagtc
5400ttcctgggcc cctgggaggt acatgtcccc cagcattggt gtaagagctt cagccaagag
5460ttacacataa aggaaaaggg gcccgagctt aagactggcc gtcgttttac aacacagaaa
5520gagtttgtag aaacgcaaaa aggccatccg tcaggggcct tctgcttagt ttgatgcctg
5580gcagttccct actctcgcct tccgcttcct cgctcactga ctcgctgcgc tcggtcgttc
5640ggctgcggcg agcggtatca gctcactcaa aggcggtaat acggttatcc acagaatcag
5700gggataacgc aggaaagaac atgtgagcaa aaggccagca aaaggccagg aaccgtaaaa
5760aggccgcgtt gctggcgttt ttccataggc tccgcccccc tgacgagcat cacaaaaatc
5820gacgctcaag tcagaggtgg cgaaacccga caggactata aagataccag gcgtttcccc
5880ctggaagctc cctcgtgcgc tctcctgttc cgaccctgcc gcttaccgga tacctgtccg
5940cctttctccc ttcgggaagc gtggcgcttt ctcatagctc acgctgtagg tatctcagtt
6000cggtgtaggt cgttcgctcc aagctgggct gtgtgcacga accccccgtt cagcccgacc
6060gctgcgcctt atccggtaac tatcgtcttg agtccaaccc ggtaagacac gacttatcgc
6120cactggcagc agccactggt aacaggatta gcagagcgag gtatgtaggc ggtgctacag
6180agttcttgaa gtggtgggct aactacggct acactagaag aacagtattt ggtatctgcg
6240ctctgctgaa gccagttacc ttcggaaaaa gagttggtag ctcttgatcc ggcaaacaaa
6300ccaccgctgg tagcggtggt ttttttgttt gcaagcagca gattacgcgc agaaaaaaag
6360gatctcaaga agatcctttg atcttttcta cggggtctga cgctcagtgg aacgacgcgc
6420gcgtaactca cgttaaggga ttttggtcat gagcttgcgc cgtcccgtca agtcagcgta
6480atgctctgct taccaatgct taatcagtga ggcacctatc tcagcgatct gtctatttcg
6540ttcatccata gttgcctgac tccccgtcgt gtagataact acgatacggg agggcttacc
6600atctggcccc agcgctgcga tgataccgcg agaaccacgc tcaccggctc cggatttatc
6660agcaataaac cagccagccg gaagggccga gcgcagaagt ggtcctgcaa ctttatccgc
6720ctccatccag tctattaatt gttgccggga agctagagta agtagttcgc cagttaatag
6780tttgcgcaac gttgttgcca tcgctacagg catcgtggtg tcacgctcgt cgtttggtat
6840ggcttcattc agctccggtt cccaacgatc aaggcgagtt acatgatccc ccatgttgtg
6900caaaaaagcg gttagctcct tcggtcctcc gatcgttgtc agaagtaagt tggccgcagt
6960gttatcactc atggttatgg cagcactgca taattctctt actgtcatgc catccgtaag
7020atgcttttct gtgactggtg agtactcaac caagtcattc tgagaatagt gtatgcggcg
7080accgagttgc tcttgcccgg cgtcaatacg ggataatacc gcgccacata gcagaacttt
7140aaaagtgctc atcattggaa aacgttcttc ggggcgaaaa ctctcaagga tcttaccgct
7200gttgagatcc agttcgatgt aacccactcg tgcacccaac tgatcttcag catcttttac
7260tttcaccagc gtttctgggt gagcaaaaac aggaaggcaa aatgccgcaa aaaagggaat
7320aagggcgaca cggaaatgtt gaatactcat attcttcctt tttcaatatt attgaagcat
7380ttatcagggt tattgtctca tgagcggata catatttgaa tgtatttaga aaaataaaca
7440aataggggtc agtgttacaa ccaattaacc aattctgaac attatcgcga gcccatttat
7500acctgaatat ggctcataac accccttgca gtgcgactaa cggcatgaag ctcgtcgggg
7560cgtacgtact cctgcttgct gatccacatc tgctggaagg tggacagcga ggccaggatg
7620gagccgccga tccacacgga gtacttgcgc tcaggaggag caatgaagct tatctgagga
7680gggaagggga caggcagtga ggaccctgga tgtgacagct ccaagcttcc acacaccaca
7740ggaccccaca gccgacctgc ccaggtcagc tcaggcagga aagacaccca ccttgatctt
7800cattgtgctg ggtgccaggg cagtgatctc cttctgcatc ctgtcatcga ttaaagattc
7860tcgagagaca tgataagata cattgatgag tttggacaaa ccacaactag aatgcagtga
7920taaaaatgct ttatttgtga aatttgtgat gctattgctt tatttgtaac cattataagc
7980tgcaataaac aagttaacaa caacaattgc attcatttta tgtttcaggt tcagggggag
8040gtgtgggagg ttttttaaag caagtaaaac ctctacaaat gtggtatggc tgattatgat
8100ctctagtcaa ggcactatac atcaaatatt tttccataat tttcttgtat agcagtgcag
8160ctttttcctt tgtggtgtaa atagcaaagc aagcaagagt tctattacta aacacagcat
8220gactcaaaaa acttaccaat tctgaaggaa agtccttggg gtcttctacc tttctcttct
8280tttttggagg agtagaatgt tgagagtcag cagtagcctc atcatcacta gatggcattt
8340cttctgagca aaacaggttt tcctcattaa aggcattcca ccactgctcc cattcataag
8400ttccataggt tggaatctaa aataccacaa caattagaat cagtagttta acacattata
8460cacttaaaaa ttttatattt accttagagc tttaaatctc tgtaggtagt ttgtccaatt
8520atgtcacacc acagaagtaa ggttccttca caaagatccg aattcttact tacccaggcg
8580gttcatttcg atatcagtgt acttatacag ttcgtccata ccaccagtac tgtgcctgcc
8640ctcagcacgt tcatactgtt ctactattgt gtagtcctcg ttatggctgg taatgtcaag
8700tttgatatca acaatgtatg caccgggtag ttgtacgggt ttctttgctt tgtaagtagt
8760ttttacttca cttgcatagt gccctccatc tttcagcttt aaccgcttct taatttcaga
8820ttttaaagca ccgtcctctg ggtacatccg ttcgctgctg gcttcccaac ccattgtttt
8880cttctgcatt acagggccgt cgctagggaa gttggtaccc ctcagcttaa ccttgtaaat
8940gaacacacca tcttgtaggc tgctgtcttg gttaacatgt attataccgc cgtcctcgaa
9000gttcataact ctctcccact taaagccctc cggaaagctc aacttaaagt agtcgggtat
9060atcagctgga tgctttatat acactttact gccatacata aactgtggtg aaagtatatc
9120ccaggcaaaa ggcagaggcc cgcctttagt aaccttcagc ttagctgttt gaaatgcctc
9180gtaaggtcta ccctcgcctt cgccttctat ttcaaattca tgcccattta cagaaccttc
9240catgtgtacc ttgaacctca taaactcctt tataattgcc atgttgtttt cctcaccctt
9300gcttaccatg gtggcaccgg tgaaggcctg agaccaatgc ggccgcatag cggatctgac
9360ggttcactaa accagctctg cttatataga cctcccaccg tacacgccta ccgcccattt
9420gcgtcaagct agc
94332010848DNAArtificial SequenceDescription of Artificial Sequence
Synthetic construct 20agcttggccc attgcatacg ttgtatccat atcataatat
ctacatttat attggctcat 60gtccaacatt accgccatgt tgacattgat tattgactag
ttattaatag taatcaatta 120cggggtcatt agttcatagc ccatatatgg agttccgcgt
tacataactt acggtaaatg 180gcccgcctgg ctgaccgccc aacgaccccc gcccattgac
gtcaataatg acgtatgttc 240ccatagtaac gccaataggg actttccatt gacgtcaatg
ggtggagtat ttacggtaaa 300ctgcccactt ggcagtacat caagtgtatc atatgccaag
tacgccccct attgacgtca 360atgacggtaa atggcccgcc tggcattatg cccagtacat
gaccttatgg gactttccta 420cttggcagta catctacgta ttagtcatcg ctattaccat
ggtgatgcgg ttttggcagt 480acatcaatgg gcgtggatag cggtttgact cacggggatt
tccaagtctc caccccattg 540acgtcaatgg gagtttgttt tggcaccaaa atcaacggga
ctttccaaaa tgtcgtaaca 600actccgcccc attgacgcaa atgggcggta ggcgtgtacg
gtgggaggtc tatataagca 660gagctggttt agtgaaccgt cagatcgcct attccctgca
ggattgttta aacaccagat 720ctgcttgaat ccgcggataa gaggactagt attcgtctca
ctagggagag ctcctagcca 780ccatggctca gtcaaagcac ggtctaacaa aagaaatgac
aatgaaatac cgtatggaag 840ggtgcgtcga tggacataaa tttgtgatca cgggagaggg
cattggatat ccgttcaaag 900ggaaacaggc tattaatctg tgtgtggtcg aaggtggacc
attgccattt gccgaagaca 960tattgtcagc tgcctttatg tacggaaaca gggttttcac
tgaatatcct caagacatag 1020ctgactattt caagaactcg tgtcctgctg gttatacatg
ggacaggtct tttctctttg 1080aggatggagc agtttgcata tgtaatgcag atataacagt
gagtgttgaa gaaaactgca 1140tgtatcatga gtccaaattt tatggagtga attttcctgc
tgatggacct gtgatgaaaa 1200agatgacaga taactgggag ccatcctgcg agaagatcat
accagtacct aagcagggga 1260tattgaaagg ggatgtctcc atgtacctcc ttctgaagga
tggtgggcgt ttacggtgcc 1320aattcgacac agtttacaaa gcaaagtctg tgccaagaaa
gatgccggac tggcacttca 1380tccagcataa gctcacccgt gaagaccgca gcgatgctaa
gaatcagaaa tggcatctga 1440cagaacatgc tattgcatcc ggatctgcat tgccctaccc
atacgacgtc ccagactacg 1500cttagtgtac aatccgcgtg agacgatcgg cgcgcccgcc
cctctccctc ccccccccct 1560aacgttactg gccgaagccg cttggaataa ggccggtgtg
cgtttgtcta tatgttattt 1620tccaccatat tgccgtcttt tggcaatgtg agggcccgga
aacctggccc tgtcttcttg 1680acgagcattc ctaggggtct ttcccctctc gccaaaggaa
tgcaaggtct gttgaatgtc 1740gtgaaggaag cagttcctct ggaagcttct tgaagacaaa
caacgtctgt agcgaccctt 1800tgcaggcagc ggaacccccc acctggcgac aggtgcctct
gcggccaaaa gccacgtgta 1860taagatacac ctgcaaaggc ggcacaaccc cagtgccacg
ttgtgagttg gatagttgtg 1920gaaagagtca aatggctctc ctcaagcgta ttcaacaagg
ggctgaagga tgcccagaag 1980gtaccccatt gtatgggatc tgatctgggg cctcggtgca
catgctttac atgtgtttag 2040tcgaggttaa aaaaacgtct aggccccccg aaccacgggg
acgtggtttt cctttgaaaa 2100acacgatgat aatatggccg gcaccatggt aagcaagggt
gaggaaaaca acatggcaat 2160tataaaggag tttatgaggt tcaaggtaca catggaaggt
tctgtaaatg ggcatgaatt 2220tgaaatagaa ggcgaaggcg agggtagacc ttacgaggca
tttcaaacag ctaagctgaa 2280ggttactaaa ggcgggcctc tgccttttgc ctgggatata
ctttcaccac agtttatgta 2340tggcagtaaa gtgtatataa agcatccagc tgatataccc
gactacttta agttgagctt 2400tccggagggc tttaagtggg agagagttat gaacttcgag
gacggcggta taatacatgt 2460taaccaagac agcagcctac aagatggtgt gttcatttac
aaggttaagc tgaggggtac 2520caacttccct agcgacggcc ctgtaatgca gaagaaaaca
atgggttggg aagccagcag 2580cgaacggatg tacccagagg acggtgcttt aaaatctgaa
attaagaagc ggttaaagct 2640gaaagatgga gggcactatg caagtgaagt aaaaactact
tacaaagcaa agaaacccgt 2700acaactaccc ggtgcataca ttgttgatat caaacttgac
attaccagcc ataacgagga 2760ctacacaata gtagaacagt atgaacgtgc tgagggcagg
cacagtactg gtggtatgga 2820cgaactgtat aagtacactg atatcgaaat gaaccgcctg
ggtaagtaat tctagaggat 2880ctttgtgaag gaaccttact tctgtggtgt gacataattg
gacaaactac ctacagagat 2940ttaaagctct aaggtaaata taaaattttt aagtgtataa
tgtgttaaac tactgattct 3000aattgttgtg gtattttaga ttccaaccta tggaacttat
gaatgggagc agtggtggaa 3060tgcctttaat gaggaaaacc tgttttgctc agaagaaatg
ccatctagtg atgatgaggc 3120tactgctgac tctcaacatt ctactcctcc aaaaaagaag
agaaaggtag aagaccccaa 3180ggactttcct tcagaattgg taagtttttt gagtcatgct
gtgtttagta atagaactct 3240tgcttgcttt gctatttaca ccacaaagga aaaagctgca
ctgctataca agaaaattat 3300ggaaaaatat ttgatgtata gtgccttgac tagagatcat
aatcagccat accacatttg 3360tagaggtttt acttgcttta aaaaacctcc cacacctccc
cctgaacctg aaacataaaa 3420tgaatgcaat tgttgttgtt aacttgttta ttgcagctta
taatggttac aaataaagca 3480atagcatcac aaatttcaca aataaagcat ttttatcact
gcattctagt tgtggtttgt 3540ccaaactcat caatgtatct tatcatgtct ggatccactg
tcttctttat catgcaactc 3600gtaggacagg tgccctggcc gggtccgcag gaaaaggaca
agcagcgaaa attcacgccc 3660ccttgggagg tggcggcata tgcaaaggat agcactccca
ctctactact gggtatcata 3720tgctgactgt atatgcatga ggatagcata tgctacccgg
atacagatta ggatagcata 3780tactacccag atatagatta ggatagcata tgctacccag
atatagatta ggatagccta 3840tgctacccag atataaatta ggatagcata tactacccag
atatagatta ggatagcata 3900tgctacccag atatagatta ggatagccta tgctacccag
atatagatta ggatagcata 3960tgctacccag atatagatta ggatagcata tgctatccag
atatttgggt agtatatgct 4020acccagatat aaattaggat agcatatact accctaatct
ctattaggat agcatatgct 4080acccggatac agattaggat agcatatact acccagatat
agattaggat agcatatgct 4140acccagatat agattaggat agcctatgct acccagatat
aaattaggat agcatatact 4200acccagatat agattaggat agcatatgct acccagatat
agattaggat agcctatgct 4260acccagatat agattaggat agcatatgct atccagatat
ttgggtagta tatgctaccc 4320atggcaacat tagcccaccg tgctctcagc gacctcgtga
atatgaggac caacaaccct 4380gtgcttggcg ctcaggcgca agtgtgtgta atttgtcctc
cagatcgcag caatcgcgcc 4440cctatcttgg cccgcccacc tacttatgca ggtattcccc
ggggtgccat tagtggtttt 4500gtgggcaagt ggtttgaccg cagtggttag cggggttaca
atcagccaag ttattacacc 4560cttattttac agtccaaaac cgcagggcgg cgtgtggggg
ctgacgcgtg ccatcactcc 4620acaatttcaa gagaaagagt ggccacttgt ctttgtttat
gggccccatt ggcgtggagc 4680cccgtttaat tttcgggggt gttagagaca accagtggag
tccgctgctg tcggcgtcca 4740ctctctttcc ccttgttaca aatagagtgt aacaacatgg
ttcacctgtc ttggtccctg 4800cctgggacac atcttaataa ccccagtatc atattgcact
aggattatgt gttgcccata 4860gccataaatt cgtgtgagat ggacatccag tctttacggc
ttgtccccac cccatggatt 4920tctattgtta aagatattca gaatgtttca ttcctacact
aggatttatt gcccaagggg 4980tttgtgaggg ttatattggt gtcatagcac aatgccacca
ctgaacccat cgtccaaatt 5040ttattctgga tgcgtcacct gaaaccttgt tttcgagcac
ctcacataca ccttactgtt 5100cacaactcag cagttattct attagctaaa cgaaggagaa
tgaagaagca ggcgaagatt 5160caggagagtt cactgcccgc tccttgatct tcagccactg
cccttgtgac taaaatggtt 5220cactaccctc gtggaatcct gaccccatgt aaataaaacc
gtgacagctc atggggtggg 5280agatatcgct gttccttagg acccttttac taaccctaat
tcgatagcat atgcttcccg 5340ttgggtaaca tatgctattg aattagggtt agtctggata
gtatatacta ctacccggga 5400agcatatgct acccgtttag ggttaacaag ggggccttat
aaacactatt gctaatgccc 5460tcttgagggt ccgcttatcg gtagctacac aggcccctct
gattgacgtt ggtgtagcct 5520cccgtagtct tcctgggccc ctgggaggta catgtccccc
agcattggtg taagagcttc 5580agccaagagt tacacataaa ggaaaagggg cccgagttcg
aagctgtgga atgtgtgtca 5640gttagggtgt ggaaagtccc caggctcccc agcaggcaga
agtatgcaaa gcatgcatct 5700caattagtca gcaaccaggt gtggaaagtc cccaggctcc
ccagcaggca gaagtatgca 5760aagcatgcat ctcaattagt cagcaaccat agtcccgccc
ctaactccgc ccatcccgcc 5820cctaactccg cccagttccg cccattctcc gccccatggc
tgactaattt tttttattta 5880tgcagaggcc gaggccgcct cggcctctga gctattccag
aagtagtgag gaggcttttt 5940tggaggccta ggcttttgca aaaagctctg acccctcaca
aggagccggc atggccaagc 6000ctttgtctca agaagaatcc accctcattg aaagggccac
tgctacaatc aacagcatcc 6060ccatctctga agactactct gtcgccagcg cagctctctc
ctctgacggg agaatcttca 6120ctggtgtcaa tgtatatcat tttactgggg gaccttgcgc
agagcttgtg gtcctgggga 6180ctgctgctgc tgctgcagcc ggaaacctga cttgtatcgt
cgccataggg aatgagaaca 6240gaggcatctt gagcccctgt gggagatgca gacaagtcct
cctggacctc catcctggga 6300tcaaagccat agtgaaggac agtgatggac agcccacagc
cgttgggatc agggagttgc 6360tgccatctgg ttatgtgtgg gagggctaat ctagacgacc
gaaaggagga tcataatcag 6420ccataccaca tttgtagagg ttttacttgc tttaaaaaac
ctcccacacc tccccctgaa 6480cctgaaacat aaaatgaatg caattgttgt tgttaacttg
tttattgcag cttataatgg 6540ttacaaataa agcaatagca tcacaaattt cacaaataaa
gcattttttt cactgcattc 6600tagttgtggt ttgtccaaac tcatcaatgt atcttatcat
gtctggatct tcgaaatcat 6660ccttaagact ggccgtcgtt ttacaacaca gaaagagttt
gtagaaacgc aaaaaggcca 6720tccgtcaggg gccttctgct tagtttgatg cctggcagtt
ccctactctc gccttccgct 6780tcctcgctca ctgactcgct gcgctcggtc gttcggctgc
ggcgagcggt atcagctcac 6840tcaaaggcgg taatacggtt atccacagaa tcaggggata
acgcaggaaa gaacatgtga 6900gcaaaaggcc agcaaaaggc caggaaccgt aaaaaggccg
cgttgctggc gtttttccat 6960aggctccgcc cccctgacga gcatcacaaa aatcgacgct
caagtcagag gtggcgaaac 7020ccgacaggac tataaagata ccaggcgttt ccccctggaa
gctccctcgt gcgctctcct 7080gttccgaccc tgccgcttac cggatacctg tccgcctttc
tcccttcggg aagcgtggcg 7140ctttctcata gctcacgctg taggtatctc agttcggtgt
aggtcgttcg ctccaagctg 7200ggctgtgtgc acgaaccccc cgttcagccc gaccgctgcg
ccttatccgg taactatcgt 7260cttgagtcca acccggtaag acacgactta tcgccactgg
cagcagccac tggtaacagg 7320attagcagag cgaggtatgt aggcggtgct acagagttct
tgaagtggtg ggctaactac 7380ggctacacta gaagaacagt atttggtatc tgcgctctgc
tgaagccagt taccttcgga 7440aaaagagttg gtagctcttg atccggcaaa caaaccaccg
ctggtagcgg tggttttttt 7500gtttgcaagc agcagattac gcgcagaaaa aaaggatctc
aagaagatcc tttgatcttt 7560tctacggggt ctgacgctca gtggaacgac gcgcgcgtaa
ctcacgttaa gggattttgg 7620tcatgagctt gcgccgtccc gtcaagtcag cgtaatgctc
tgcttaccaa tgcttaatca 7680gtgaggcacc tatctcagcg atctgtctat ttcgttcatc
catagttgcc tgactccccg 7740tcgtgtagat aactacgata cgggagggct taccatctgg
ccccagcgct gcgatgatac 7800cgcgagaacc acgctcaccg gctccggatt tatcagcaat
aaaccagcca gccggaaggg 7860ccgagcgcag aagtggtcct gcaactttat ccgcctccat
ccagtctatt aattgttgcc 7920gggaagctag agtaagtagt tcgccagtta atagtttgcg
caacgttgtt gccatcgcta 7980caggcatcgt ggtgtcacgc tcgtcgtttg gtatggcttc
attcagctcc ggttcccaac 8040gatcaaggcg agttacatga tcccccatgt tgtgcaaaaa
agcggttagc tccttcggtc 8100ctccgatcgt tgtcagaagt aagttggccg cagtgttatc
actcatggtt atggcagcac 8160tgcataattc tcttactgtc atgccatccg taagatgctt
ttctgtgact ggtgagtact 8220caaccaagtc attctgagaa tagtgtatgc ggcgaccgag
ttgctcttgc ccggcgtcaa 8280tacgggataa taccgcgcca catagcagaa ctttaaaagt
gctcatcatt ggaaaacgtt 8340cttcggggcg aaaactctca aggatcttac cgctgttgag
atccagttcg atgtaaccca 8400ctcgtgcacc caactgatct tcagcatctt ttactttcac
cagcgtttct gggtgagcaa 8460aaacaggaag gcaaaatgcc gcaaaaaagg gaataagggc
gacacggaaa tgttgaatac 8520tcatattctt cctttttcaa tattattgaa gcatttatca
gggttattgt ctcatgagcg 8580gatacatatt tgaatgtatt tagaaaaata aacaaatagg
ggtcagtgtt acaaccaatt 8640aaccaattct gaacattatc gcgagcccat ttatacctga
atatggctca taacacccct 8700tgcagtgcga ctaacggcat gaagctcgtc ggggcgtacg
tactcctgct tgctgatcca 8760catctgctgg aaggtggaca gcgaggccag gatggagccg
ccgatccaca cggagtactt 8820gcgctcagga ggagcaatga agcttatctg aggagggaag
gggacaggca gtgaggaccc 8880tggatgtgac agctccaagc ttccacacac cacaggaccc
cacagccgac ctgcccaggt 8940cagctcaggc aggaaagaca cccaccttga tcttcattgt
gctgggtgcc agggcagtga 9000tctccttctg catcctgtca tcgattaaag attctcgaga
gacatgataa gatacattga 9060tgagtttgga caaaccacaa ctagaatgca gtgataaaaa
tgctttattt gtgaaatttg 9120tgatgctatt gctttatttg taaccattat aagctgcaat
aaacaagtta acaacaacaa 9180ttgcattcat tttatgtttc aggttcaggg ggaggtgtgg
gaggtttttt aaagcaagta 9240aaacctctac aaatgtggta tggctgatta tgatctctag
tcaaggcact atacatcaaa 9300tatttttcca taattttctt gtatagcagt gcagcttttt
cctttgtggt gtaaatagca 9360aagcaagcaa gagttctatt actaaacaca gcatgactca
aaaaacttac caattctgaa 9420ggaaagtcct tggggtcttc tacctttctc ttcttttttg
gaggagtaga atgttgagag 9480tcagcagtag cctcatcatc actagatggc atttcttctg
agcaaaacag gttttcctca 9540ttaaaggcat tccaccactg ctcccattca taagttccat
aggttggaat ctaaaatacc 9600acaacaatta gaatcagtag tttaacacat tatacactta
aaaattttat atttacctta 9660gagctttaaa tctctgtagg tagtttgtcc aattatgtca
caccacagaa gtaaggttcc 9720ttcacaaaga tccgaattcc tacccaccgt actcgtcaat
tccaagggca tcggtaaaca 9780tctgctcaaa ctcgaagtcg gccatatcca gagcgccgta
gggggcggag tcgtgggggg 9840taaatcccgg acccggggaa tccccgtccc ccaacatgtc
cagatcgaaa tcgtctagcg 9900cgtcggcatg cgccatcgcc acgtcctcgc cgtctaagtg
cagctcgtcc cccaggctga 9960catcggtcgg gggggccgtc gacagtctgc gcgtgtgtcc
agcggggaga aaggacaggc 10020gcggagccgc cagccccgcc tcttcggggg cgtcgtcgtc
cgggagatcg agcaggccct 10080cgatggtaga cccgtaattg tttttcgtgc gcgcgcggct
gtacgcagac ccactctcgc 10140attttaattg cttctccagc ccacagataa tcagctccag
cccaaagaga aatgctggct 10200cggccccctg atggtcaaac aattcaatgg cctgtctcaa
gagtgggggc attgaatctg 10260tggttggggt ctctctctct tccttagcaa cctggtgctc
ctggtcctcc agtacacagc 10320ccagtgtgaa atgacccact gctgacaggg catataaagc
gttctccaga gagaagccct 10380gctggcacag aaatgccaac tgattttcta gggtttcata
ctgcttttct gtaggtcttg 10440tatcagaatg gaccttggcc ccgtttctat gtgacagaag
ggcgcatctg aagctcttgg 10500cattattcct cagaaagtcc tgccacgact ccccttttaa
gggacagaag tgtgtatgat 10560gtctgtccag catctctatg gcgagggcgt ccagcaaggc
tcttttattc ttgacatgcc 10620agtatagagt aggctgttcg acccccagct tctgagcgag
tttgcgggtg gtcaagccct 10680ctatcccaac ttcattcaac agttctagtg cggagtttat
gaccttactt ttgtcgagcc 10740tgctcatggt ggtgcggccg cttagcggat ctgacggttc
actaaaccag ctctgcttat 10800atagacctcc caccgtacac gcctaccgcc catttgcgtc
aagctagc 108482110232DNAArtificial SequenceDescription of
Artificial Sequence Synthetic construct 21agcttggccc attgcatacg
ttgtatccat atcataatat ctacatttat attggctcat 60gtccaacatt accgccatgt
tgacattgat tattgactag ttattaatag taatcaatta 120cggggtcatt agttcatagc
ccatatatgg agttccgcgt tacataactt acggtaaatg 180gcccgcctgg ctgaccgccc
aacgaccccc gcccattgac gtcaataatg acgtatgttc 240ccatagtaac gccaataggg
actttccatt gacgtcaatg ggtggagtat ttacggtaaa 300ctgcccactt ggcagtacat
caagtgtatc atatgccaag tacgccccct attgacgtca 360atgacggtaa atggcccgcc
tggcattatg cccagtacat gaccttatgg gactttccta 420cttggcagta catctacgta
ttagtcatcg ctattaccat ggtgatgcgg ttttggcagt 480acatcaatgg gcgtggatag
cggtttgact cacggggatt tccaagtctc caccccattg 540acgtcaatgg gagtttgttt
tggcaccaaa atcaacggga ctttccaaaa tgtcgtaaca 600actccgcccc attgacgcaa
atgggcggta ggcgtgtacg gtgggaggtc tatataagca 660gagctggttt agtgaaccgt
cagatcgcct attccctgca ggattgttta aacaccagat 720ctaccaccat gagcaggctc
gacaaaagta aggtcataaa ctccgcacta gaactgttga 780atgaagttgg gatagagggc
ttgaccaccc gcaaactcgc tcagaagctg ggggtcgaac 840agcctactct atactggcat
gtcaagaata aaagagcctt gctggacgcc ctcgccatag 900agatgctgga cagacatcat
acacacttct gtcccttaaa aggggagtcg tggcaggact 960ttctgaggaa taatgccaag
agcttcagat gcgcccttct gtcacataga aacggggcca 1020aggtccattc tgatacaaga
cctacagaaa agcagtatga aaccctagaa aatcagttgg 1080catttctgtg ccagcagggc
ttctctctgg agaacgcttt atatgccctg tcagcagtgg 1140gtcatttcac actgggctgt
gtactggagg accaggagca ccaggttgct aaggaagaga 1200gagagacccc aaccacagat
tcaatgcccc cactcttgag acaggccatt gaattgtttg 1260accatcaggg ggccgagcca
gcatttctct ttgggctgga gctgattatc tgtgggctgg 1320agaagcaatt aaaatgcgag
agtgggtctg cgtacagccg cgcgcgcacg aaaaacaatt 1380acgggtctac catcgagggc
ctgctcgatc tcccggacga cgacgccccc gaagaggcgg 1440ggctggcggc tccgcgcctg
tcctttctcc ccgctggaca cacgcgcaga ctgtcgacgg 1500cccccccgac cgatgtcagc
ctgggggacg agctgcactt agacggcgag gacgtggcga 1560tggcgcatgc cgacgcgcta
gacgatttcg atctggacat gttgggggac ggggattccc 1620cgggtccggg atttaccccc
cacgactccg ccccctacgg cgctctggat atggccgact 1680tcgagtttga gcagatgttt
accgatgccc ttggaattga cgagtacggt gggtagggcg 1740cgcccgcccc tctccctccc
ccccccctaa cgttactggc cgaagccgct tggaataagg 1800ccggtgtgcg tttgtctata
tgttattttc caccatattg ccgtcttttg gcaatgtgag 1860ggcccggaaa cctggccctg
tcttcttgac gagcattcct aggggtcttt cccctctcgc 1920caaaggaatg caaggtctgt
tgaatgtcgt gaaggaagca gttcctctgg aagcttcttg 1980aagacaaaca acgtctgtag
cgaccctttg caggcagcgg aaccccccac ctggcgacag 2040gtgcctctgc ggccaaaagc
cacgtgtata agatacacct gcaaaggcgg cacaacccca 2100gtgccacgtt gtgagttgga
tagttgtgga aagagtcaaa tggctctcct caagcgtatt 2160caacaagggg ctgaaggatg
cccagaaggt accccattgt atgggatctg atctggggcc 2220tcggtgcaca tgctttacat
gtgtttagtc gaggttaaaa aaacgtctag gccccccgaa 2280ccacggggac gtggttttcc
tttgaaaaac acgatgataa tatggccggc accatgaaaa 2340agcctgaact gactgccacc
tctgttgaga agtttttaat agagaagttt gactctgtgt 2400cagacctcat gcagctttct
gagggagagg agtccagagc ctttagcttt gatgtggggg 2460ggagaggcta tgtcctgaga
gtcaatagct gtgcagatgg tttctacaaa gataggtatg 2520tctatagaca ttttgcatcc
gccgccctcc ccattccaga ggtccttgac attggggagt 2580tctcagagag cctgacctat
tgcatttccc ggagagccca gggtgtgact cttcaagacc 2640tgcctgagac agaactccct
gctgtgctcc agcccgtcgc cgaggccatg gatgcaatcg 2700ccgccgcaga cctcagccag
acctcggggt ttgggccctt tggcccccag gggataggcc 2760aatacactac atggagagat
ttcatatgcg ctattgctga cccccatgtg tatcactggc 2820aaactgtgat ggacgacaca
gtctcagcct ctgtcgcaca agccctggac gagctgatgc 2880tttgggccga ggactgccca
gaggtcagac atctcgtcca tgccgacttt gggtcaaaca 2940atgtcctgac ggacaatggg
agaatcactg ctgtcattga ctggagcgag gccatgtttg 3000gggactccca atacgaggtc
gccaacatct tcttctggag accctggttg gcttgtatgg 3060agcagcagac ccgttacttt
gagaggaggc atccagagct ggctgggagc cctagattga 3120gggcctatat gctcaggata
gggcttgacc aactctatca gagcttggtt gacggcaatt 3180ttgatgacgc agcttgggct
caggggagat gcgacgccat agtgaggagt ggggccggga 3240ctgtcgggag aactcagatc
gccaggaggt cagctgccgt ctggactgac ggctgtgtag 3300aagtcttagc cgactctggg
aacaggagac ccagcactcg tccagaggcc aaggagttcg 3360ggagatgggg gaggctaact
gagaccagaa aggagacaat acctgagggt accagggcca 3420tgacagccat aaaaagacag
aataagactc acgggtgttg ggtcgtttgt tcatagttct 3480agaggatctt tgtgaaggaa
ccttacttct gtggtgtgac ataattggac aaactaccta 3540cagagattta aagctctaag
gtaaatataa aatttttaag tgtataatgt gttaaactac 3600tgattctaat tgttgtggta
ttttagattc caacctatgg aacttatgaa tgggagcagt 3660ggtggaatgc ctttaatgag
gaaaacctgt tttgctcaga agaaatgcca tctagtgatg 3720atgaggctac tgctgactct
caacattcta ctcctccaaa aaagaagaga aaggtagaag 3780accccaagga ctttccttca
gaattggtaa gttttttgag tcatgctgtg tttagtaata 3840gaactcttgc ttgctttgct
atttacacca caaaggaaaa agctgcactg ctatacaaga 3900aaattatgga aaaatatttg
atgtatagtg ccttgactag agatcataat cagccatacc 3960acatttgtag aggttttact
tgctttaaaa aacctcccac acctccccct gaacctgaaa 4020cataaaatga atgcaattgt
tgttgttaac ttgtttattg cagcttataa tggttacaaa 4080taaagcaata gcatcacaaa
tttcacaaat aaagcatttt tatcactgca ttctagttgt 4140ggtttgtcca aactcatcaa
tgtatcttat catgtctgga tccactgtct tctttatcat 4200gcaactcgta ggacaggtgc
cctggccggg tccgcaggaa aaggacaagc agcgaaaatt 4260cacgccccct tgggaggtgg
cggcatatgc aaaggatagc actcccactc tactactggg 4320tatcatatgc tgactgtata
tgcatgagga tagcatatgc tacccggata cagattagga 4380tagcatatac tacccagata
tagattagga tagcatatgc tacccagata tagattagga 4440tagcctatgc tacccagata
taaattagga tagcatatac tacccagata tagattagga 4500tagcatatgc tacccagata
tagattagga tagcctatgc tacccagata tagattagga 4560tagcatatgc tacccagata
tagattagga tagcatatgc tatccagata tttgggtagt 4620atatgctacc cagatataaa
ttaggatagc atatactacc ctaatctcta ttaggatagc 4680atatgctacc cggatacaga
ttaggatagc atatactacc cagatataga ttaggatagc 4740atatgctacc cagatataga
ttaggatagc ctatgctacc cagatataaa ttaggatagc 4800atatactacc cagatataga
ttaggatagc atatgctacc cagatataga ttaggatagc 4860ctatgctacc cagatataga
ttaggatagc atatgctatc cagatatttg ggtagtatat 4920gctacccatg gcaacattag
cccaccgtgc tctcagcgac ctcgtgaata tgaggaccaa 4980caaccctgtg cttggcgctc
aggcgcaagt gtgtgtaatt tgtcctccag atcgcagcaa 5040tcgcgcccct atcttggccc
gcccacctac ttatgcaggt attccccggg gtgccattag 5100tggttttgtg ggcaagtggt
ttgaccgcag tggttagcgg ggttacaatc agccaagtta 5160ttacaccctt attttacagt
ccaaaaccgc agggcggcgt gtgggggctg acgcgtgcca 5220tcactccaca atttcaagag
aaagagtggc cacttgtctt tgtttatggg ccccattggc 5280gtggagcccc gtttaatttt
cgggggtgtt agagacaacc agtggagtcc gctgctgtcg 5340gcgtccactc tctttcccct
tgttacaaat agagtgtaac aacatggttc acctgtcttg 5400gtccctgcct gggacacatc
ttaataaccc cagtatcata ttgcactagg attatgtgtt 5460gcccatagcc ataaattcgt
gtgagatgga catccagtct ttacggcttg tccccacccc 5520atggatttct attgttaaag
atattcagaa tgtttcattc ctacactagg atttattgcc 5580caaggggttt gtgagggtta
tattggtgtc atagcacaat gccaccactg aacccatcgt 5640ccaaatttta ttctggatgc
gtcacctgaa accttgtttt cgagcacctc acatacacct 5700tactgttcac aactcagcag
ttattctatt agctaaacga aggagaatga agaagcaggc 5760gaagattcag gagagttcac
tgcccgctcc ttgatcttca gccactgccc ttgtgactaa 5820aatggttcac taccctcgtg
gaatcctgac cccatgtaaa taaaaccgtg acagctcatg 5880gggtgggaga tatcgctgtt
ccttaggacc cttttactaa ccctaattcg atagcatatg 5940cttcccgttg ggtaacatat
gctattgaat tagggttagt ctggatagta tatactacta 6000cccgggaagc atatgctacc
cgtttagggt taacaagggg gccttataaa cactattgct 6060aatgccctct tgagggtccg
cttatcggta gctacacagg cccctctgat tgacgttggt 6120gtagcctccc gtagtcttcc
tgggcccctg ggaggtacat gtcccccagc attggtgtaa 6180gagcttcagc caagagttac
acataaagga aaaggggccc gagttcgaaa aggggcccga 6240gcttaagttt accactccct
atcagtgata gagaaaagtg aaaggatctt ttaccactcc 6300ctatcagtga tagagaaaag
tgaaaggatc ttttaccact ccctatcagt gatagagaaa 6360agtgaaagga tcttttacca
ctccctatca gtgatagaga aaagtgaaag gatcttttac 6420cactccctat cagtgataga
gaaaagtgaa aggatctttt accactccct atcagtgata 6480gagaaaagtg aaaggatctt
ttaccactcc ctatcagtga tagagaaaag tgaaagagct 6540cacagtggga gagaaggggc
cagggtataa aaagggccca caagagacca gctcaaggat 6600tccaaggcac tagtaccacc
atggactctc tcctcatgaa gcagagaaag tttctctacc 6660acttcaagaa cgtcagatgg
gccaagggga gacatgagac ctatctctgt tacgtcgtca 6720agaggagaga ctcagccacc
tctttctccc tcgactttgg gcatctccgg aacaagtctg 6780ggtgtcatgt cgaactcctc
ttcctccgct atatctcaga ctgggacctc gaccccggga 6840gatgctatag agtcacttgg
tttacctctt ggtccccctg ttatgactgc gccagacatg 6900tcgccgactt cctcaggggg
tatcccaatc tctccctccg catattcgcc gcccgactct 6960atttttgtga ggacaggaaa
gccgagcccg aggggctcag gagactccac cgggccgggg 7020tccagatcgc catcatgaca
tttaaggact atttctattg ttggaataca tttgtcgaga 7080atcgggagaa gactttcaaa
gcctgggagg ggctccatga gaactctgtc agactctcta 7140ggcagctcag gagaatcctc
ctccccctct atgaggtcga cgacctcaga gatgccttcc 7200ggaccctcgg ggcttgaacc
ggtggatctt tgtgaaggaa ccttacttct gtggtgtgac 7260ataattggac aaactaccta
cagagattta aagctctaag gtaaatataa aatttttaag 7320tgtataatgt gttaaactac
tgattctaat tgttgtggta ttttagattc caacctatgg 7380aacttatgaa tgggagcagt
ggtggaatgc ctttaatgag gaaaacctgt tttgctcaga 7440agaaatgcca tctagtgatg
atgaggctac tgctgactct caacattcta ctcctccaaa 7500aaagaagaga aaggtagaag
accccaagga ctttccttca gaattggtaa gttttttgag 7560tcatgctgtg tttagtaata
gaactcttgc ttgctttgct atttacacca caaaggaaaa 7620agctgcactg ctatacaaga
aaattatgga aaaatatttg atgtatagtg ccttgactag 7680agatcataat cagccatacc
acatttgtag aggttttact tgctttaaaa aacctcccac 7740acctccccct gaacctgaaa
cataaaatga atgcaattgt tgttgttaac ttgtttattg 7800cagcttataa tggttacaaa
taaagcaata gcatcacaaa tttcacaaat aaagcatttt 7860tatcactgca ttctagttgt
ggtttgtcca aactcatcaa tgtatcttat catgtctttc 7920gaaatcatcc ttaagactgg
ccgtcgtttt acaacacaga aagagtttgt agaaacgcaa 7980aaaggccatc cgtcaggggc
cttctgctta gtttgatgcc tggcagttcc ctactctcgc 8040cttccgcttc ctcgctcact
gactcgctgc gctcggtcgt tcggctgcgg cgagcggtat 8100cagctcactc aaaggcggta
atacggttat ccacagaatc aggggataac gcaggaaaga 8160acatgtgagc aaaaggccag
caaaaggcca ggaaccgtaa aaaggccgcg ttgctggcgt 8220ttttccatag gctccgcccc
cctgacgagc atcacaaaaa tcgacgctca agtcagaggt 8280ggcgaaaccc gacaggacta
taaagatacc aggcgtttcc ccctggaagc tccctcgtgc 8340gctctcctgt tccgaccctg
ccgcttaccg gatacctgtc cgcctttctc ccttcgggaa 8400gcgtggcgct ttctcatagc
tcacgctgta ggtatctcag ttcggtgtag gtcgttcgct 8460ccaagctggg ctgtgtgcac
gaaccccccg ttcagcccga ccgctgcgcc ttatccggta 8520actatcgtct tgagtccaac
ccggtaagac acgacttatc gccactggca gcagccactg 8580gtaacaggat tagcagagcg
aggtatgtag gcggtgctac agagttcttg aagtggtggg 8640ctaactacgg ctacactaga
agaacagtat ttggtatctg cgctctgctg aagccagtta 8700ccttcggaaa aagagttggt
agctcttgat ccggcaaaca aaccaccgct ggtagcggtg 8760gtttttttgt ttgcaagcag
cagattacgc gcagaaaaaa aggatctcaa gaagatcctt 8820tgatcttttc tacggggtct
gacgctcagt ggaacgacgc gcgcgtaact cacgttaagg 8880gattttggtc atgagcttgc
gccgtcccgt caagtcagcg taatgctctg cttagaaaaa 8940ctcatcgagc atcaaatgaa
actgcaattt attcatatca ggattatcaa taccatattt 9000ttgaaaaagc cgtttctgta
atgaaggaga aaactcaccg aggcagttcc ataggatggc 9060aagatcctgg tatcggtctg
cgattccgac tcgtccaaca tcaatacaac ctattaattt 9120cccctcgtca aaaataaggt
tatcaagtga gaaatcacca tgagtgacga ctgaatccgg 9180tgagaatggc aaaagtttat
gcatttcttt ccagacttgt tcaacaggcc agccattacg 9240ctcgtcatca aaatcactcg
catcaaccaa accgttattc attcgtgatt gcgcctgagc 9300gaggcgaaat acgcgatcgc
tgttaaaagg acaattacaa acaggaatcg agtgcaaccg 9360gcgcaggaac actgccagcg
catcaacaat attttcacct gaatcaggat attcttctaa 9420tacctggaac gctgtttttc
cggggatcgc agtggtgagt aaccatgcat catcaggagt 9480acggataaaa tgcttgatgg
tcggaagtgg cataaattcc gtcagccagt ttagtctgac 9540catctcatct gtaacatcat
tggcaacgct acctttgcca tgtttcagaa acaactctgg 9600cgcatcgggc ttcccataca
agcgatagat tgtcgcacct gattgcccga cattatcgcg 9660agcccattta tacccatata
aatcagcatc catgttggaa tttaatcgcg gcctcgacgt 9720ttcccgttga atatggctca
taacacccct tgtattactg tttatgtaag cagacagttt 9780tattgttcat gatgatatta
ttttatcttg tacaatgtaa catcagagat tttgagacac 9840gggccagagc tgccaggaaa
cagctatgac ctatagggga tatcagctgg atggcggggc 9900gtacgtactc ctgcttgctg
atccacatct gctggaaggt ggacagcgag gccaggatgg 9960agccgccgat ccacacggag
tacttgcgct caggaggagc aatgaagctt ccacacacca 10020caggacccca cagccgacct
gcccaggtca gctcaggcag gaaagacacc caccttgatc 10080ttcattgtgc tgggtgccag
ggcagtgatc tccttctgca tcctgtcatc gattaaagat 10140tctcgagcaa ggtctcatcg
aaattgatca agggaattca cacttcaacc ggtcaaggcc 10200tgagaccagt gcggccgcaa
acacaagcta gc 1023222597DNACanis sp.
22atggactctc tcctcatgaa gcagagaaag tttctctacc acttcaagaa cgtcagatgg
60gccaagggga gacatgagac ctatctctgt tacgtcgtca agaggagaga ctcagccacc
120tctttctccc tcgactttgg gcatctccgg aacaagtctg ggtgtcatgt cgaactcctc
180ttcctccgct atatctcaga ctgggacctc gaccccggga gatgctatag agtcacttgg
240tttacctctt ggtccccctg ttatgactgc gccagacatg tcgccgactt cctcaggggg
300tatcccaatc tctccctccg catattcgcc gcccgactct atttttgtga ggacaggaaa
360gccgagcccg aggggctcag gagactccac cgggccgggg tccagatcgc catcatgaca
420tttaaggact atttctattg ttggaataca tttgtcgaga atcgggagaa gactttcaaa
480gcctgggagg ggctccatga gaactctgtc agactctcta ggcagctcag gagaatcctc
540ctccccctct atgaggtcga cgacctcaga gatgccttcc ggaccctcgg ggcttga
597231245DNAHomo sapiens 23atggctactg gacaggatcg agtggttgct ctcgtggaca
tggactgttt ttttgttcaa 60gtggagcagc ggcaaaatcc tcatttgagg aataaacctt
gtgcagttgt acagtacaaa 120tcatggaagg gtggtggaat aattgcagtg agttatgaag
ctcgtgcatt tggagtcact 180agaagtatgt gggcagatga tgctaagaag ttatgtccag
atcttctact ggcacaagtt 240cgtgagtccc gtgggaaagc taacctcacc aagtaccggg
aagccagtgt tgaagtgatg 300gagataatgt ctcgttttgc tgtgattgaa cgtgccagca
ttgatgaggc ttacgtagat 360ctgaccagtg ctgtacaaga gagactacaa aagctacaag
gtcagcctat ctcggcagac 420ttgttgccaa gcacttacat tgaagggttg ccccaaggcc
ctacaacggc agaagagact 480gttcagaaag aggggatgcg aaaacaaggc ttatttcaat
ggctcgattc tcttcagatt 540gataacctca cctctccaga cctgcagctc accgtgggag
cagtgattgt ggaggaaatg 600agagcagcca tagagaggga gactggtttt cagtgttcag
ctggaatttc acacaataag 660gtcctggcaa aactggcctg tggactaaac aagcccaacc
gccaaaccct ggtttcacat 720gggtcagtcc cacagctctt cagccaaatg cccattcgca
aaatccgtag tcttggagga 780aagctagggg cctctgtcat tgagatccta gggatagaat
acatgggtga actgacccag 840ttcactgaat cccagctcca gagtcatttt ggggagaaga
atgggtcttg gctatatgcc 900atgtgccgag ggattgaaca tgatccagtt aaacccaggc
aactacccaa aaccattggc 960tgtagtaaga acttcccagg aaaaacagct cttgctactc
gggaacaggt acaatggtgg 1020ctgttgcaat tagcccagga actagaggag agactgacta
aagaccgaaa tgataatgac 1080agggtagcca cccagctggt tgtgagcatt cgtgtacaag
gagacaaacg cctcagcagc 1140ctgcgccgct gctgtgccct tacccgctat gatgctcaca
agatgagcca tgatgcattt 1200actgtcatca agaactgtaa tacttctgga atccagacag
aatga 124524915DNAHomo sapiens 24atgggcgtct tctgccttgg
gccgtggggg ttgggccgga agctgcggac gcctgggaag 60gggccgctgc agctcttgag
ccgcctctgc ggggaccact tgcaggccat cccagccaag 120aaggccccgg ctgggcagga
ggagcctggg acgccgccct cctcgccgct gagtgccgag 180cagttggacc ggatccagag
gaacaaggcc gcggccctgc tcagactcgc ggcccgcaac 240gtgcccgtgg gctttggaga
gagctggaag aagcacctca gcggggagtt cgggaaaccg 300tattttatca agctaatggg
atttgttgca gaagaaagaa agcattacac tgtttatcca 360cccccacacc aagtcttcac
ctggacccag atgtgtgaca taaaagatgt gaaggttgtc 420atcctgggac aggatccata
tcatggacct aatcaagctc acgggctctg ctttagtgtt 480caaaggcctg ttccgcctcc
gcccagtttg gagaacattt ataaagagtt gtctacagac 540atagaggatt ttgttcatcc
tggccatgga gatttatctg ggtgggccaa gcaaggtgtt 600ctccttctca acgctgtcct
cacggttcgt gcccatcaag ccaactctca taaggagcga 660ggctgggagc agttcactga
tgcagttgtg tcctggctaa atcagaactc gaatggcctt 720gttttcttgc tctggggctc
ttatgctcag aagaagggca gtgccattga taggaagcgg 780caccatgtac tacagacggc
tcatccctcc cctttgtcag tgtatagagg gttctttgga 840tgtagacact tttcaaagac
caatgagctg ctgcagaagt ctggcaagaa gcccattgac 900tggaaggagc tgtga
915251191DNAUnknownDescription of Unknown Tetracycline resistance
gene sequence 25atgaaatcta acaatgcgct catcgtcatc ctcggcaccg tcaccctgga
tgctgtaggc 60ataggcttgg ttatgccggt actgccgggc ctcttgcggg atatcgtcca
ttccgacagc 120atcgccagtc actatggcgt gctgctagcg ctatatgcgt tgatgcaatt
tctatgcgca 180cccgttctcg gagcactgtc cgaccgcttt ggccgccgcc cagtcctgct
cgcttcgcta 240cttggagcca ctatcgacta cgcgatcatg gcgaccacac ccgtcctgtg
gatcctctac 300gccggacgca tcgtggccgg catcaccggc gccacaggtg cggttgctgg
cgcctatatc 360gccgacatca ccgatgggga agatcgggct cgccacttcg ggctcatgag
cgcttgtttc 420ggcgtgggta tggtggcagg ccccgtggcc gggggactgt tgggcgccat
ctccttgcat 480gcaccattcc ttgcggcggc ggtgctcaac ggcctcaacc tactactggg
ctgcttccta 540atgcaggagt cgcataaggg agagcgtcga ccgatgccct tgagagcctt
caacccagtc 600agctccttcc ggtgggcgcg gggcatgact atcgtcgccg cacttatgac
tgtcttcttt 660atcatgcaac tcgtaggaca ggtgccggca gcgctctggg tcattttcgg
cgaggaccgc 720tttcgctgga gcgcgacgat gatcggcctg tcgcttgcgg tattcggaat
cttgcacgcc 780ctcgctcaag ccttcgtcac tggtcccgcc accaaacgtt tcggcgagaa
gcaggccatt 840atcgccggca tggcggccga cgcgctgggc tacgtcttgc tggcgttcgc
gacgcgaggc 900tggatggcct tccccattat gattcttctc gcttccggcg gcatcgggat
gcccgcgttg 960caggccatgc tgtccaggca ggtagatgac gaccatcagg gacagcttca
aggatcgctc 1020gcggctctta ccagcctaac ttcgatcact ggaccgctga tcgtcacggc
gatttatgcc 1080gcctcggcga gcacatggaa cgggttggca tggattgtag gcgccgccct
ataccttgtc 1140tgcctccccg cgttgcgtcg cggtgcatgg agccgggcca cctcgacctg a
119126399DNAAspergillus terreus 26atggccaagc ctttgtctca
agaagaatcc accctcattg aaagagcaac ggctacaatc 60aacagcatcc ccatctctga
agactacagc gtcgccagcg cagctctctc tagcgacggc 120cgcatcttca ctggtgtcaa
tgtatatcat tttactgggg gaccttgcgc agaactcgtg 180gtgctgggca ctgctgctgc
tgcggcagct ggcaacctga cttgtatcgt cgcgatcgga 240aatgagaaca ggggcatctt
gagcccctgc ggacggtgcc gacaggttct tctcgatctg 300catcctggga tcaaagccat
agtgaaggac agtgatggac agccgacggc agttgggatt 360cgtgaattgc tgccctctgg
ttatgtgtgg gagggctaa
39927600DNAUnknownDescription of Unknown Puromycin resistance gene
sequence 27atgaccgagt acaagcccac ggtgcgcctc gccacccgcg acgacgtccc
ccgggccgta 60cgcaccctcg ccgccgcgtt cgccgactac cccgccacgc gccacaccgt
cgacccggac 120cgccacatcg agcgggtcac cgagctgcaa gaactcttcc tcacgcgcgt
cgggctcgac 180atcggcaagg tgtgggtcgc ggacgacggc gccgcggtgg cggtctggac
cacgccggag 240agcgtcgaag cgggggcggt gttcgccgag atcggcccgc gcatggccga
gttgagcggt 300tcccggctgg ccgcgcagca acagatggaa ggcctcctgg cgccgcaccg
gcccaaggag 360cccgcgtggt tcctggccac cgtcggcgtc tcgcccgacc accagggcaa
gggtctgggc 420agcgccgtcg tgctccccgg agtggaggcg gccgagcgcg ccggggtgcc
cgccttcctg 480gagacctccg cgccccgcaa cctccccttc tacgagcggc tcggcttcac
cgtcaccgcc 540gacgtcgagg tgcccgaagg accgcgcacc tggtgcatga cccgcaagcc
cggtgcctga 600281038DNAUnknownDescription of Unknown Hygromycin
resistance gene sequence 28atgaaaaagc ctgaactcac cgcgacgtct
gtcgagaagt ttctgatcga aaagttcgac 60agcgtctccg acctgatgca gctctcggag
ggcgaagaat ctcgtgcttt cagcttcgat 120gtaggagggc gtggatatgt cctgcgggta
aatagctgcg ccgatggttt ctacaaagat 180cgttatgttt atcggcactt tgcatcggcc
gcgctcccga ttccggaagt gcttgacatt 240ggggaattca gcgagagcct gacctattgc
atctcccgcc gtgcacaggg tgtcacgttg 300caagacctgc ctgaaaccga actgcccgct
gttctgcagc cggtcgcgga ggccatggat 360gcgatcgctg cggccgatct tagccagacg
agcgggttcg gcccattcgg accgcaagga 420atcggtcaat acactacatg gcgtgatttc
atatgcgcga ttgctgatcc ccatgtgtat 480cactggcaaa ctgtgatgga cgacaccgtc
agtgcgtccg tcgcgcaggc tctcgatgag 540ctgatgcttt gggccgagga ctgccccgaa
gtccggcacc tcgtgcacgc ggatttcggc 600tccaacaatg tcctgacgga caatggccgc
ataacagcgg tcattgactg gagcgaggcg 660atgttcgggg attcccaata cgaggtcgcc
aacatcttct tctggaggcc gtggttggct 720tgtatggagc agcagacgcg ctacttcgag
cggaggcatc cggagcttgc aggatcgccg 780cggctccggg cgtatatgct ccgcattggt
cttgaccaac tctatcagag cttggttgac 840ggcaatttcg atgatgcagc ttgggcgcag
ggtcgatgcg acgcaatcgt ccgatccgga 900gccgggactg tcgggcgtac acaaatcgcc
cgcagaagcg cggccgtctg gaccgatggc 960tgtgtagaag tactcgccga tagtggaaac
cgacgcccca gcactcgtgg ggatcgggag 1020atgggggagg ctaactga
103829795DNAUnknownDescription of
Unknown Neomycin resistance gene sequence 29atgattgaac aagatggatt
gcacgcaggt tctccggccg cttgggtgga gaggctattc 60ggctatgact gggcacaaca
gacaatcggc tgctctgatg ccgccgtgtt ccggctgtca 120gcgcaggggc gcccggttct
ttttgtcaag accgacctgt ccggtgccct gaatgaactg 180caggacgagg cagcgcggct
atcgtggctg gccacgacgg gcgttccttg cgcagctgtg 240ctcgacgttg tcactgaagc
gggaagggac tggctgctat tgggcgaagt gccggggcag 300gatctcctgt catctcacct
tgctcctgcc gagaaagtat ccatcatggc tgatgcaatg 360cggcggctgc atacgcttga
tccggctacc tgcccattcg accaccaagc gaaacatcgc 420atcgagcgag cacgtactcg
gatggaagcc ggtcttgtcg atcaggatga tctggacgaa 480gagcatcagg ggctcgcgcc
agccgaactg ttcgccaggc tcaaggcgcg catgcccgac 540ggcgaggatc tcgtcgtgac
ccatggcgat gcctgcttgc cgaatatcat ggtggaaaat 600ggccgctttt ctggattcat
cgactgtggc cggctgggtg tggcggaccg ctatcaggac 660atagcgttgg ctacccgtga
tattgctgaa gagcttggcg gcgaatgggc tgaccgcttc 720ctcgtgcttt acggtatcgc
cgctcccgat tcgcagcgca tcgccttcta tcgccttctt 780gacgagttct tctga
79530375DNAUnknownDescription of Unknown Zeocin resistance gene
sequence 30atggccaagt tgaccagtgc cgttccggtg ctcaccgcgc gcgacgtcgc
cggagcggtc 60gagttctgga ccgaccggct cgggttctcc cgggacttcg tggaggacga
cttcgccggt 120gtggtccggg acgacgtgac cctgttcatc agcgcggtcc aggaccaggt
ggtgccggac 180aacaccctgg cctgggtgtg ggtgcgcggc ctggacgagc tgtacgccga
gtggtcggag 240gtcgtgtcca cgaacttccg ggacgcctcc gggccggcca tgaccgagat
cggcgagcag 300ccgtgggggc gggagttcgc cctgcgcgac ccggccggca actgcgtgca
cttcgtggcc 360gaggagcagg actga
375311131DNAHomo sapiens 31atggcttcgt acccctgcca tcaacacgcg
tctgcgttcg accaggctgc gcgttctcgc 60ggccataaca accgacgtac ggcgttgcgc
cctcgccggc aacaaaaagc cacggaagtc 120cgcctggagc agaaaatgcc cacgctactg
cgggtttata tagacggtcc ccacgggatg 180gggaaaacca ccaccacgca actgctggtg
gccctgggtt cgcgcgacga tatcgtctac 240gtacccgagc cgatgactta ctggcgggtg
ttgggggctt ccgagacaat cgcgaacatc 300tacaccacac aacaccgcct cgaccagggt
gagatatcgg ccggggacgc ggcggtggta 360atgacaagcg cccagataac aatgggcatg
ccttatgccg tgaccgacgc cgttctggct 420cctcatatcg ggggggaggc tgggagctca
catgccccgc ccccggccct caccctcatc 480ttcgaccgcc atcccatcgc cgccctcctg
tgctacccgg ccgcgcgata ccttatgggc 540agcatgaccc cccaggccgt gctggcgttc
gtggccctca tcccgccgac cttgcccggc 600acaaacatcg tgttgggggc ccttccggag
gacagacaca tcgaccgcct ggccaaacgc 660cagcgccccg gcgagcggct tgacctggct
atgctggccg cgattcgccg cgtttatggg 720ctgcttgcca atacggtgcg gtatctgcag
ggcggcgggt cgtggcggga ggattgggga 780cagctttcgg gggcggccgt gccgccccag
ggtgccgagc cccagagcaa cgcgggccca 840cgaccccata tcggggacac gttatttacc
ctgtttcggg cccccgagtt gctggccccc 900aacggcgacc tgtataacgt gtttgcctgg
gctttggacg tcttggccaa acgcctccgt 960cccatgcatg tctttatcct ggattacgac
caatcgcccg ccggctgccg ggacgccctg 1020ctgcaactta cctccgggat ggtccagacc
cacgtcacca ccccaggctc cataccgacg 1080atctgcgacc tggcgcgcac gtttgcccgg
gagatggggg aggctaactg a 113132713PRTHomo sapiens 32Met Ala Thr
Gly Gln Asp Arg Val Val Ala Leu Val Asp Met Asp Cys1 5
10 15Phe Phe Val Gln Val Glu Gln Arg Gln
Asn Pro His Leu Arg Asn Lys 20 25
30Pro Cys Ala Val Val Gln Tyr Lys Ser Trp Lys Gly Gly Gly Ile Ile
35 40 45Ala Val Ser Tyr Glu Ala Arg
Ala Phe Gly Val Thr Arg Ser Met Trp 50 55
60Ala Asp Asp Ala Lys Lys Leu Cys Pro Asp Leu Leu Leu Ala Gln Val65
70 75 80Arg Glu Ser Arg
Gly Lys Ala Asn Leu Thr Lys Tyr Arg Glu Ala Ser 85
90 95Val Glu Val Met Glu Ile Met Ser Arg Phe
Ala Val Ile Glu Arg Ala 100 105
110Ser Ile Asp Glu Ala Tyr Val Asp Leu Thr Ser Ala Val Gln Glu Arg
115 120 125Leu Gln Lys Leu Gln Gly Gln
Pro Ile Ser Ala Asp Leu Leu Pro Ser 130 135
140Thr Tyr Ile Glu Gly Leu Pro Gln Gly Pro Thr Thr Ala Glu Glu
Thr145 150 155 160Val Gln
Lys Glu Gly Met Arg Lys Gln Gly Leu Phe Gln Trp Leu Asp
165 170 175Ser Leu Gln Ile Asp Asn Leu
Thr Ser Pro Asp Leu Gln Leu Thr Val 180 185
190Gly Ala Val Ile Val Glu Glu Met Arg Ala Ala Ile Glu Arg
Glu Thr 195 200 205Gly Phe Gln Cys
Ser Ala Gly Ile Ser His Asn Lys Val Leu Ala Lys 210
215 220Leu Ala Cys Gly Leu Asn Lys Pro Asn Arg Gln Thr
Leu Val Ser His225 230 235
240Gly Ser Val Pro Gln Leu Phe Ser Gln Met Pro Ile Arg Lys Ile Arg
245 250 255Ser Leu Gly Gly Lys
Leu Gly Ala Ser Val Ile Glu Ile Leu Gly Ile 260
265 270Glu Tyr Met Gly Glu Leu Thr Gln Phe Thr Glu Ser
Gln Leu Gln Ser 275 280 285His Phe
Gly Glu Lys Asn Gly Ser Trp Leu Tyr Ala Met Cys Arg Gly 290
295 300Ile Glu His Asp Pro Val Lys Pro Arg Gln Leu
Pro Lys Thr Ile Gly305 310 315
320Cys Ser Lys Asn Phe Pro Gly Lys Thr Ala Leu Ala Thr Arg Glu Gln
325 330 335Val Gln Trp Trp
Leu Leu Gln Leu Ala Gln Glu Leu Glu Glu Arg Leu 340
345 350Thr Lys Asp Arg Asn Asp Asn Asp Arg Val Ala
Thr Gln Leu Val Val 355 360 365Ser
Ile Arg Val Gln Gly Asp Lys Arg Leu Ser Ser Leu Arg Arg Cys 370
375 380Cys Ala Leu Thr Arg Tyr Asp Ala His Lys
Met Ser His Asp Ala Phe385 390 395
400Thr Val Ile Lys Asn Cys Asn Thr Ser Gly Ile Gln Thr Glu Trp
Ser 405 410 415Pro Pro Leu
Thr Met Leu Phe Leu Cys Ala Thr Lys Phe Ser Ala Ser 420
425 430Ala Pro Ser Ser Ser Thr Asp Ile Thr Ser
Phe Leu Ser Ser Asp Pro 435 440
445Ser Ser Leu Pro Lys Val Pro Val Thr Ser Ser Glu Ala Lys Thr Gln 450
455 460Gly Ser Gly Pro Ala Val Thr Ala
Thr Lys Lys Ala Thr Thr Ser Leu465 470
475 480Glu Ser Phe Phe Gln Lys Ala Ala Glu Arg Gln Lys
Val Lys Glu Ala 485 490
495Ser Leu Ser Ser Leu Thr Ala Pro Thr Gln Ala Pro Met Ser Asn Ser
500 505 510Pro Ser Lys Pro Ser Leu
Pro Phe Gln Thr Ser Gln Ser Thr Gly Thr 515 520
525Glu Pro Phe Phe Lys Gln Lys Ser Leu Leu Leu Lys Gln Lys
Gln Leu 530 535 540Asn Asn Ser Ser Val
Ser Ser Pro Gln Gln Asn Pro Trp Ser Asn Cys545 550
555 560Lys Ala Leu Pro Asn Ser Leu Pro Thr Glu
Tyr Pro Gly Cys Val Pro 565 570
575Val Cys Glu Gly Val Ser Lys Leu Glu Glu Ser Ser Lys Ala Thr Pro
580 585 590Ala Glu Met Asp Leu
Ala His Asn Ser Gln Ser Met His Ala Ser Ser 595
600 605Ala Ser Lys Ser Val Leu Glu Val Thr Gln Lys Ala
Thr Pro Asn Pro 610 615 620Ser Leu Leu
Ala Ala Glu Asp Gln Val Pro Cys Glu Lys Cys Gly Ser625
630 635 640Leu Val Pro Val Trp Asp Met
Pro Glu His Met Asp Tyr His Phe Ala 645
650 655Leu Glu Leu Gln Lys Ser Phe Leu Gln Pro His Ser
Ser Asn Pro Gln 660 665 670Val
Val Ser Ala Val Ser His Gln Gly Lys Arg Asn Pro Lys Ser Pro 675
680 685Leu Ala Cys Thr Asn Lys Arg Pro Arg
Pro Glu Gly Met Gln Thr Leu 690 695
700Glu Ser Phe Phe Lys Pro Leu Thr His705
71033689PRTRattus norvegicus 33Met Ala Pro Gly Gln Asp Leu Val Val Ala
Leu Val Asp Met Asp Cys1 5 10
15Phe Phe Val Gln Val Glu Gln Arg Gln Asn Pro His Leu Arg Asn Lys
20 25 30Pro Cys Ala Val Val Gln
Tyr Lys Ser Trp Lys Gly Gly Gly Ile Ile 35 40
45Ala Val Ser Tyr Glu Ala Arg Ala Phe Gly Val Thr Arg Asn
Met Trp 50 55 60Ala Asp Asp Ala Lys
Lys Leu Cys Pro Asp Leu Leu Leu Ala Gln Val65 70
75 80Arg Glu Ser Arg Gly Lys Ala Asn Leu Thr
Lys Tyr Arg Glu Ala Ser 85 90
95Val Glu Val Met Glu Ile Met Ser His Phe Ala Val Ile Glu Arg Ala
100 105 110Ser Ile Asp Glu Ala
Tyr Ile Asp Leu Thr Asn Ala Val Gln Glu Arg 115
120 125Leu Glu Lys Leu Gln Gly Gln Pro Val Ser Ala Asp
Leu Leu Pro Ser 130 135 140Thr Tyr Ile
Glu Gly Leu Pro Arg Gly Pro Ala Val Glu Asp Thr Val145
150 155 160Glu Lys Glu Asp Ile Arg Lys
Gln Gly Leu Leu Gln Trp Leu Gly Ser 165
170 175Leu Glu Lys Asp Asp Pro Thr Ser Pro Asp Leu Arg
Leu Thr Val Gly 180 185 190Ala
Val Ile Val Glu Glu Met Arg Ala Ala Ile Glu Arg Lys Thr Gly 195
200 205Phe Gln Cys Ser Ala Gly Ile Ser His
Asn Lys Val Leu Ala Lys Leu 210 215
220Ala Cys Gly Leu Asn Lys Pro Asn Arg Gln Thr Leu Val Ser His Gly225
230 235 240Ser Val Pro Gln
Leu Phe Ser Gln Met Pro Ile Arg Lys Ile Arg Ser 245
250 255Leu Gly Gly Lys Leu Gly Ala Ser Val Ile
Asp Val Leu Gly Val Glu 260 265
270Tyr Met Gly Asp Leu Thr Gln Phe Thr Glu Ala Gln Leu Gln Ser His
275 280 285Phe Gly Glu Lys Asn Gly Ser
Trp Leu Tyr Ala Met Cys Arg Gly Ile 290 295
300Glu His Glu Pro Val Lys Pro Arg Gln Leu Pro Lys Thr Ile Gly
Cys305 310 315 320Ser Lys
Asn Phe Pro Gly Lys Thr Ala Leu Ala Thr Arg Glu Gln Val
325 330 335Gln Trp Trp Leu Leu Gln Leu
Ala Leu Glu Leu Glu Glu Arg Leu Thr 340 345
350Lys Asp Arg Thr Asp Asn Gly Arg Val Ala Thr Gln Leu Val
Val Ser 355 360 365Ile Arg Val Glu
Gly Asp Lys Arg Leu Ser Ser Leu Arg Arg Cys Cys 370
375 380Ala Leu Thr Arg Tyr Asp Ala His Lys Met Ser Gln
Asp Ala Phe Ala385 390 395
400Thr Ile Arg Asn Cys Asn Thr Ser Gly Val Gln Thr Glu Trp Ser Pro
405 410 415Pro Leu Thr Met Leu
Phe Leu Cys Ala Thr Lys Phe Ser Ala Ser Ala 420
425 430Pro Pro Ala Cys Thr Asp Ile Thr Val Phe Leu Ser
Ser Asp Ser Gly 435 440 445Cys Gln
Pro Lys Val Pro Ala Ala Ser Ser Gly Thr Arg Thr Gln Glu 450
455 460Pro Gly Pro Ala Ala Pro Thr Ser Lys Glu Ala
Ala Thr Ser Leu Glu465 470 475
480Ser Phe Phe Gln Lys Ala Ala Lys Arg Gln Arg Met Arg Glu Thr Ser
485 490 495Phe Val Pro Pro
Lys Val Ala Val Glu Lys Ser Ser Ser Lys Pro Ser 500
505 510Leu Leu Phe Gln Thr Ser Gly Ser Pro Gly Thr
Lys Ser Phe Phe Lys 515 520 525Gln
Lys Ser Leu Leu Leu Gln His Thr Glu Leu Ser Asn Ala Ala Ala 530
535 540Pro Cys Pro Pro Gln Ala Ser Ser Ala Val
Gln Pro Ser Arg Leu Pro545 550 555
560Thr Asp Arg Ala Asp Ser Arg Ala Ser Cys Glu Glu Val Cys Lys
Pro 565 570 575Val Ser Ser
Lys Ala Val Ser Thr Glu Val Asn Val Ala Gly Asn Ser 580
585 590Ser Leu Ala Tyr Asn Ser Gln Glu Met Thr
Gln Arg Ala Ala Glu Asp 595 600
605Gln Val Leu Cys Glu Lys Cys Asp Ser Leu Val Pro Val Trp Asp Met 610
615 620Pro Glu His Leu Asp Tyr His Phe
Ala Leu Glu Leu Gln Lys Ser Phe625 630
635 640Leu Gln Pro Cys Thr Ser Lys Pro Gln Ala Val Pro
Val Ser Pro Gln 645 650
655Gly Lys Arg Asn Pro Lys Ser Pro Leu Ala Ser Ser Asn Lys Arg Leu
660 665 670Arg Pro His Gly Met Gln
Thr Leu Glu Ser Phe Phe Lys Pro Leu Thr 675 680
685His 34673PRTGallus gallus 34Met Ser Arg Gly Arg Glu Arg
Val Val Ala Leu Val Asp Met Asp Cys1 5 10
15Phe Phe Met Gln Val Glu Gln Arg Phe Asp Pro Arg Leu
Arg Gly Arg 20 25 30Pro Cys
Ala Val Val Gln Tyr Asn Gln Trp Gln Gly Gly Gly Ile Ile 35
40 45Ala Val Ser Tyr Glu Ala Arg Ala Phe Gly
Val Ser Arg Gly Met Trp 50 55 60Ala
Thr Glu Ala Arg Ala Leu Cys Pro Glu Leu Leu Leu Ala Arg Val65
70 75 80Pro Glu Ala Arg Gly Lys
Ala Asp Leu Thr Arg Tyr Arg Glu Ala Ser 85
90 95Ala Glu Val Met Glu Val Leu Ser Arg Phe Ala Ala
Ile Glu Arg Ala 100 105 110Ser
Ile Asp Glu Ala Tyr Leu Asp Leu Thr Gly Ser Ala Arg Glu Arg 115
120 125Leu Arg Glu Leu Arg Gly Arg Pro Leu
Glu Ala Glu Leu Leu Pro Thr 130 135
140Thr Phe Val Gln Gly Leu Pro Ala Glu Pro Gly Leu Gln Pro Ala Asp145
150 155 160Lys Glu Glu Leu
Arg Arg Arg Gly Leu Gln Glu Trp Leu Ala Ser Leu 165
170 175Ser Phe Asp Asn Val Asn Cys Pro Asp Leu
Gln Leu Ala Met Gly Ala 180 185
190Val Ile Val Glu Glu Ile Arg Val Ala Val Glu Lys Ala Thr Gly Phe
195 200 205Arg Cys Ser Ala Gly Ile Ser
His Asn Lys Met Leu Ala Lys Leu Ala 210 215
220Cys Gly Leu Asn Lys Pro Asn Arg Gln Thr Leu Val Ser Ser Arg
Ser225 230 235 240Val Pro
Gln Leu Phe Ser Gln Met Pro Val Ser Ser Ile Arg Asn Leu
245 250 255Gly Gly Lys Leu Gly Val Ala
Ile Thr Asp Ile Leu Gly Val Glu Tyr 260 265
270Ile Gly Glu Val Thr Lys Phe Ser Glu Met Glu Leu Gln Thr
His Phe 275 280 285Gly Asp Lys Thr
Gly Ser Trp Leu Tyr Asp Leu Cys Arg Gly Ile Asp 290
295 300Asp Glu Pro Val Lys Asn Arg His Leu Pro Gln Ser
Ile Gly Cys Ser305 310 315
320Lys Asn Phe Pro Gly Lys Thr Ala Leu Ala Thr Gln Lys Glu Val Gln
325 330 335His Trp Leu Leu Gln
Leu Ala Leu Glu Leu Glu Ser Arg Leu Ile Lys 340
345 350Asp Arg Ser Gln Asn His Arg Val Ala Lys Gln Leu
Met Val Val Ile 355 360 365Arg Met
Gln Gly Asp Thr Arg Leu Ser Arg Phe Cys Ala Val Thr Arg 370
375 380Tyr Asp Ala Gln Lys Ile Phe Asn Asp Ala Phe
Ala Leu Ile Gln Asn385 390 395
400Cys Asn Met Ala Gly Ala His Gln Ala Ala Trp Ser Pro Pro Leu Ile
405 410 415Ser Val His Leu
Ala Ala Ser Lys Phe Ser Ala Pro Thr Phe Leu Ser 420
425 430Ala Gly Ile Ala Ser Phe Leu Thr Ser Asp Thr
Ser Ser Asp Gly Thr 435 440 445Asp
Ala Gly Ser Thr Glu Ala Thr Ser Ser Thr Arg Pro Arg Val Lys 450
455 460Phe Phe Arg Ser Pro Ser Lys Glu His Arg
Gln Lys Pro Ala Asn Ala465 470 475
480Ile Glu Ser Phe Phe Gln Lys Val Ala Glu Arg Gln Gln Ser Gln
Ala 485 490 495Val Pro Ser
Gly Leu Pro Ala Ala Thr His Ala His Ser Pro Ala Ala 500
505 510Ser Ser Met Glu His Pro Glu Gly Asp Ser
Ala Gly Leu Ala Ser Glu 515 520
525Gln Arg Glu Leu Glu Ala Ser Val Lys Gln Ser Pro Arg Asp Gly Ser 530
535 540Pro Ala Ser Pro Cys Lys Arg Pro
Pro Cys Glu Glu Leu Leu Ser Asp545 550
555 560Ala Thr Gln Thr Pro Ser Thr Pro Pro Ser Ser Arg
Ile Leu Pro Lys 565 570
575Leu Lys Pro Ala Leu Glu Gly Asn Glu Gln Asn Leu Pro Pro Pro Glu
580 585 590Gln Ala Leu Leu Pro His
Val Ser Pro Gly Asp Gln Gln Cys Cys Glu 595 600
605Lys Cys Gly Gln Tyr Val Leu Ala Trp Glu Leu Pro Glu His
Met Asp 610 615 620Tyr His Phe Ala Val
Glu Leu Gln Arg Ser Phe Gln Glu Pro Ser Ser625 630
635 640Pro Pro Ala Leu Ala Glu Val Pro Ile Ala
Lys Ala Ala Ala Ser Gly 645 650
655Ser Pro Ala Lys Val Gly Asn Lys Gly Pro Arg Ala Ser Ser Arg Glu
660 665 670Ser35712PRTCanis
familiaris 35Met Ala Thr Gly Gln Asp Arg Val Val Ala Leu Val Asp Met Asp
Cys1 5 10 15Phe Phe Val
Gln Val Glu Gln Arg Gln Asn Pro His Leu Arg Asn Lys 20
25 30Pro Cys Ala Val Val Gln Tyr Lys Ser Trp
Lys Gly Gly Gly Ile Val 35 40
45Ala Val Ser Tyr Glu Ala Arg Ala Phe Gly Val Thr Arg Ser Met Trp 50
55 60Ala Asp Asp Ala Lys Lys Leu Cys Pro
Asp Leu Leu Leu Ala Gln Val65 70 75
80Arg Glu Ser Arg Gly Lys Ala Asn Leu Thr Lys Tyr Arg Glu
Ala Ser 85 90 95Val Glu
Val Met Gly Ile Leu Ser Arg Phe Ala Val Ile Glu Arg Ala 100
105 110Ser Ile Asp Glu Ala Tyr Ile Asp Leu
Thr Ser Ala Val Gln Glu Arg 115 120
125Leu Gln Asn Leu Gln Gly Gln Pro Ile Ser Ala Asp Leu Leu Pro Thr
130 135 140Thr Tyr Ile Glu Gly Leu Pro
Gln Gly Pro Thr Thr Ala Glu Gly Thr145 150
155 160Asp Gln Lys Glu Glu Thr Arg Lys Gln Gly Leu Phe
Gln Trp Leu Asp 165 170
175Ser Leu Gln Ile Asp Asn Asn Thr Ser Pro Asp Leu Gln Leu Thr Val
180 185 190Gly Ala Val Ile Val Glu
Glu Met Arg Ala Ala Ile Glu Arg Glu Thr 195 200
205Gly Phe Gln Cys Ser Ala Gly Ile Ser His Asn Lys Val Leu
Ala Lys 210 215 220Leu Ala Cys Gly Leu
Asn Lys Pro Asn Arg Gln Thr Leu Val Ser His225 230
235 240Gly Ser Val Pro Gln Leu Phe Ser Gln Met
Pro Ile Ser Lys Ile Arg 245 250
255Ser Leu Gly Gly Lys Leu Gly Ala Ser Val Ile Glu Ile Leu Gly Val
260 265 270Glu Tyr Met Gly Glu
Leu Thr Gln Phe Thr Glu Ser Gln Leu Gln Ser 275
280 285His Phe Gly Glu Lys Asn Gly Ser Trp Leu Tyr Ala
Met Cys Arg Gly 290 295 300Ile Glu His
Asp Pro Val Lys Pro Arg Gln Leu Pro Lys Thr Ile Gly305
310 315 320Cys Ser Lys Asn Phe Pro Gly
Lys Thr Ala Leu Thr Thr Arg Glu Gln 325
330 335Val Gln Trp Trp Leu Leu Gln Leu Ala Gln Glu Leu
Glu Glu Arg Leu 340 345 350Thr
Lys Asp Arg Asn Asp Asn Asp Arg Val Ala Thr Gln Leu Ala Val 355
360 365Ser Ile Arg Val Gln Gly Asp Lys Arg
Leu Ser Ser Leu Arg Arg Cys 370 375
380Cys Ala Leu Thr Arg Tyr Asp Ala His Lys Met Ser His Asp Ala Phe385
390 395 400Ala Val Ile Lys
Asn Cys Asn Thr Ser Gly Ile Lys Thr Asp Trp Ser 405
410 415Pro Pro Leu Thr Met Leu Phe Leu Cys Ala
Thr Lys Phe Ser Ala Pro 420 425
430Ala Pro Ser Ser Cys Thr Asp Ile Thr Thr Phe Leu Ser Ser Asp Pro
435 440 445Ser Ser Val Thr Asn Val Pro
Val Ser Ser Ser Glu Ala Lys Thr Gln 450 455
460Gly Cys Asp Leu Ala Val Thr Ala Thr Lys Lys Ala Thr Thr Ser
Leu465 470 475 480Glu Ser
Phe Phe Gln Lys Ala Ala Lys Lys Gln Lys Val Lys Glu Ala
485 490 495Ser Leu Ser Ser Leu Thr Ala
Thr Ala Gln Val Pro Met Ser Asn Ser 500 505
510Pro Ser Lys Pro Ser Leu Pro Phe Gln Thr Ser Arg Thr Thr
Gly Ile 515 520 525Glu Pro Phe Phe
Lys Gln Lys Ser Leu Leu Leu Lys Gln Lys Gln Leu 530
535 540Asn Asn Pro Ser Ile Phe Phe Pro Pro Gln Asn Pro
Gln Ser Ser Pro545 550 555
560Glu Glu Leu Thr Asn Gly Phe Pro Thr Glu Tyr Pro Asn Tyr Thr Asp
565 570 575Gln Asn Leu Val Cys
Gln Ala Val Pro Lys Leu Gly Thr Ser Lys Thr 580
585 590Thr Pro Thr Glu Leu Asp Leu Thr Gln Asn Ser Pro
Ser Arg Leu Ala 595 600 605Ser Ser
Ser Ser Ala Leu Glu Val Ala Gln Lys Ser Thr Thr Thr Pro 610
615 620Ser Pro Met Ala Ala Glu Asp Gln Val Pro Cys
Glu Lys Cys Gly Ser625 630 635
640Leu Val Pro Val Trp Glu Met Pro Glu His Thr Asp Tyr His Phe Ala
645 650 655Leu Glu Leu Gln
Lys Ser Phe Leu Gln Pro His Ser Ser Thr Met Gln 660
665 670Val Val Pro Ala Ser Ser Gln Ser Lys Arg Asn
Pro Lys Ser Pro Ser 675 680 685Ala
Ser Asn Ser Lys Arg Thr Arg Pro Glu Gly Met Gln Thr Leu Glu 690
695 700Ser Phe Phe Lys Pro Leu Thr His705
71036694PRTMus musculus 36Met Ala Pro Gly Gln Asn Arg Val Val
Ala Leu Val Asp Met Asp Cys1 5 10
15Phe Phe Val Gln Val Glu Gln Arg Gln Asn Pro His Leu Arg Asn
Lys 20 25 30Pro Cys Ala Val
Val Gln Tyr Lys Ser Trp Lys Gly Gly Gly Ile Ile 35
40 45Ala Val Ser Tyr Glu Ala Arg Ala Phe Gly Val Thr
Arg Asn Met Trp 50 55 60Ala Asp Asp
Ala Lys Lys Leu Cys Pro Asp Leu Leu Leu Ala Gln Val65 70
75 80Arg Glu Ser Arg Gly Lys Ala Asn
Leu Thr Lys Tyr Arg Glu Ala Ser 85 90
95Val Glu Val Met Glu Ile Met Ser Tyr Phe Ala Val Ile Glu
Arg Ala 100 105 110Ser Ile Asp
Glu Ala Tyr Ile Asp Leu Thr Ser Ala Val Gln Glu Arg 115
120 125Leu Gln Lys Leu Gln Gly Gln Pro Ile Ser Ala
Asp Leu Leu Pro Ser 130 135 140Thr Tyr
Ile Glu Gly Leu Pro Arg Gly Pro Thr Val Glu Glu Thr Val145
150 155 160Gln Lys Glu Ala Ile Arg Lys
Gln Gly Leu Leu Gln Trp Leu Asp Ser 165
170 175Leu Gln Ser Asp Asp Pro Thr Ser Pro Asp Leu Arg
Leu Thr Val Gly 180 185 190Ala
Met Ile Val Glu Glu Met Arg Ala Ala Ile Glu Ser Lys Thr Gly 195
200 205Phe Gln Cys Ser Ala Gly Ile Ser His
Asn Lys Val Leu Ala Lys Leu 210 215
220Ala Cys Gly Leu Asn Lys Pro Asn Arg Gln Thr Leu Val Ser His Gly225
230 235 240Ser Val Pro Gln
Leu Phe Ser Gln Met Pro Ile Arg Lys Ile Arg Ser 245
250 255Leu Gly Gly Lys Leu Gly Ala Ser Val Ile
Glu Val Leu Gly Ile Glu 260 265
270Tyr Met Gly Asp Leu Thr Gln Phe Thr Glu Ser Gln Leu Gln Ser His
275 280 285Phe Gly Glu Lys Asn Gly Ser
Trp Leu Tyr Ala Met Cys Arg Gly Ile 290 295
300Glu His Asp Pro Val Lys Pro Arg Gln Leu Pro Lys Thr Ile Gly
Cys305 310 315 320Ser Lys
Asn Phe Pro Gly Lys Thr Ala Leu Ala Thr Arg Glu Gln Val
325 330 335Gln Trp Trp Leu Leu Gln Leu
Ala Leu Glu Leu Glu Glu Arg Leu Thr 340 345
350Lys Asp Arg Asn Asp Asn Asp Arg Val Ala Thr Gln Leu Val
Val Ser 355 360 365Ile Arg Phe Gln
Gly Asp Arg Arg Leu Ser Ser Leu Arg Arg Cys Cys 370
375 380Ala Leu Pro Arg Tyr Asp Ala His Lys Met Ser Gln
Asp Ala Phe Ala385 390 395
400Ala Ile Arg Asn Cys Asn Thr Ser Gly Ile Gln Thr Glu Trp Ser Pro
405 410 415Pro Leu Thr Met Leu
Phe Leu Cys Ala Thr Lys Phe Ser Ala Ala Ala 420
425 430Pro Pro Ala Cys Thr Asp Ile Thr Ala Phe Leu Ser
Ser Asp Ser Ser 435 440 445Cys Gln
Pro Lys Val Pro Ile Ala Ser Ser Glu Thr Arg Thr Gln Gly 450
455 460Ser Gly Pro Ala Val Pro Thr Ser Lys Glu Ala
Ala Thr Ser Leu Ala465 470 475
480Ser Phe Phe Gln Lys Ala Ala Lys Lys Gln Arg Met Lys Glu Thr Ser
485 490 495Phe Val Pro Leu
Asn Thr Ala Thr Glu Lys Leu Ser Ser Lys Pro Ser 500
505 510Leu Val Phe Gln Ser Ser Gln Thr Thr Gly Ser
Gln Ser Phe Phe Lys 515 520 525Gln
Lys Ser Leu Leu Leu Gln His Thr Gln Leu Ser Asn Ser Ala Ala 530
535 540Pro Asp Pro Pro Gln Ala Ser Pro Ala Ala
Gln Pro Ser Cys Leu Pro545 550 555
560Ala Glu Cys Val Asp Ser Gly Pro Asp Asp Gly Ala Val Lys Pro
Val 565 570 575Ser Ser Lys
Ala Val Ser Thr Glu Met Asn Val Ala Gly Asp Ser Pro 580
585 590Asn Val Leu Asp Ser Pro Ala Tyr Asn Ser
Gln Glu Val Thr Gln Arg 595 600
605Ala Thr Glu Asp Gln Val Leu Cys Glu Lys Cys Asp Ser Leu Val Pro 610
615 620Val Trp Asp Met Pro Glu His Thr
Asp Tyr His Phe Ala Leu Glu Leu625 630
635 640Gln Lys Ser Phe Leu Gln Pro Cys Thr Ser Lys Pro
Gln Ala Ile Pro 645 650
655Ala Val Ser Pro Gln Gly Lys Arg Asn Pro Lys Ser Pro Ser Ala Ser
660 665 670Ser Ser Lys Arg Leu Arg
Pro His Gly Met Gln Thr Leu Glu Ser Phe 675 680
685Phe Lys Pro Leu Thr His 690372590PRTHomo sapiens 37Met
Asn Leu Leu Arg Arg Ser Gly Lys Arg Arg Arg Ser Glu Ser Gly1
5 10 15Ser Asp Ser Phe Ser Gly Ser
Gly Gly Asp Ser Ser Ala Ser Pro Gln 20 25
30Phe Leu Ser Gly Ser Val Leu Ser Pro Pro Pro Gly Leu Gly
Arg Cys 35 40 45Leu Lys Ala Ala
Ala Ala Gly Glu Cys Lys Pro Thr Val Pro Asp Tyr 50 55
60Glu Ile Asp Lys Leu Leu Leu Ala Asn Trp Gly Leu Pro
Lys Ala Val65 70 75
80Leu Glu Lys Tyr His Ser Phe Gly Val Lys Lys Met Phe Glu Trp Gln
85 90 95Ala Glu Cys Leu Leu Leu
Gly Gln Val Leu Glu Gly Lys Asn Leu Val 100
105 110Tyr Ser Ala Pro Thr Ser Ala Gly Lys Thr Leu Val
Ala Glu Leu Leu 115 120 125Ile Leu
Lys Arg Val Leu Glu Met Arg Lys Lys Ala Leu Phe Ile Leu 130
135 140Pro Phe Val Ser Val Ala Lys Glu Lys Lys Tyr
Tyr Leu Gln Ser Leu145 150 155
160Phe Gln Glu Val Gly Ile Lys Val Asp Gly Tyr Met Gly Ser Thr Ser
165 170 175Pro Ser Arg His
Phe Ser Ser Leu Asp Ile Ala Val Cys Thr Ile Glu 180
185 190Arg Ala Asn Gly Leu Ile Asn Arg Leu Ile Glu
Glu Asn Lys Met Asp 195 200 205Leu
Leu Gly Met Val Val Val Asp Glu Leu His Met Leu Gly Asp Ser 210
215 220His Arg Gly Tyr Leu Leu Glu Leu Leu Leu
Thr Lys Ile Cys Tyr Ile225 230 235
240Thr Arg Lys Ser Ala Ser Cys Gln Ala Asp Leu Ala Ser Ser Leu
Ser 245 250 255Asn Ala Val
Gln Ile Val Gly Met Ser Ala Thr Leu Pro Asn Leu Glu 260
265 270Leu Val Ala Ser Trp Leu Asn Ala Glu Leu
Tyr His Thr Asp Phe Arg 275 280
285Pro Val Pro Leu Leu Glu Ser Val Lys Val Gly Asn Ser Ile Tyr Asp 290
295 300Ser Ser Met Lys Leu Val Arg Glu
Phe Glu Pro Met Leu Gln Val Lys305 310
315 320Gly Asp Glu Asp His Val Val Ser Leu Cys Tyr Glu
Thr Ile Cys Asp 325 330
335Asn His Ser Val Leu Leu Phe Cys Pro Ser Lys Lys Trp Cys Glu Lys
340 345 350Leu Ala Asp Ile Ile Ala
Arg Glu Phe Tyr Asn Leu His His Gln Ala 355 360
365Glu Gly Leu Val Lys Pro Ser Glu Cys Pro Pro Val Ile Leu
Glu Gln 370 375 380Lys Glu Leu Leu Glu
Val Met Asp Gln Leu Arg Arg Leu Pro Ser Gly385 390
395 400Leu Asp Ser Val Leu Gln Lys Thr Val Pro
Trp Gly Val Ala Phe His 405 410
415His Ala Gly Leu Thr Phe Glu Glu Arg Asp Ile Ile Glu Gly Ala Phe
420 425 430Arg Gln Gly Leu Ile
Arg Val Leu Ala Ala Thr Ser Thr Leu Ser Ser 435
440 445Gly Val Asn Leu Pro Ala Arg Arg Val Ile Ile Arg
Thr Pro Ile Phe 450 455 460Gly Gly Arg
Pro Leu Asp Ile Leu Thr Tyr Lys Gln Met Val Gly Arg465
470 475 480Ala Gly Arg Lys Gly Val Asp
Thr Val Gly Glu Ser Ile Leu Ile Cys 485
490 495Lys Asn Ser Glu Lys Ser Lys Gly Ile Ala Leu Leu
Gln Gly Ser Leu 500 505 510Lys
Pro Val Arg Ser Cys Leu Gln Arg Arg Glu Gly Glu Glu Val Thr 515
520 525Gly Ser Met Ile Arg Ala Ile Leu Glu
Ile Ile Val Gly Gly Val Ala 530 535
540Ser Thr Ser Gln Asp Met His Thr Tyr Ala Ala Cys Thr Phe Leu Ala545
550 555 560Ala Ser Met Lys
Glu Gly Lys Gln Gly Ile Gln Arg Asn Gln Glu Ser 565
570 575Val Gln Leu Gly Ala Ile Glu Ala Cys Val
Met Trp Leu Leu Glu Asn 580 585
590Glu Phe Ile Gln Ser Thr Glu Ala Ser Asp Gly Thr Glu Gly Lys Val
595 600 605Tyr His Pro Thr His Leu Gly
Ser Ala Thr Leu Ser Ser Ser Leu Ser 610 615
620Pro Ala Asp Thr Leu Asp Ile Phe Ala Asp Leu Gln Arg Ala Met
Lys625 630 635 640Gly Phe
Val Leu Glu Asn Asp Leu His Ile Leu Tyr Leu Val Thr Pro
645 650 655Met Phe Glu Asp Trp Thr Thr
Ile Asp Trp Tyr Arg Phe Phe Cys Leu 660 665
670Trp Glu Lys Leu Pro Thr Ser Met Lys Arg Val Ala Glu Leu
Val Gly 675 680 685Val Glu Glu Gly
Phe Leu Ala Arg Cys Val Lys Gly Lys Val Val Ala 690
695 700Arg Thr Glu Arg Gln His Arg Gln Met Ala Ile His
Lys Arg Phe Phe705 710 715
720Thr Ser Leu Val Leu Leu Asp Leu Ile Ser Glu Val Pro Leu Arg Glu
725 730 735Ile Asn Gln Lys Tyr
Gly Cys Asn Arg Gly Gln Ile Gln Ser Leu Gln 740
745 750Gln Ser Ala Ala Val Tyr Ala Gly Met Ile Thr Val
Phe Ser Asn Arg 755 760 765Leu Gly
Trp His Asn Met Glu Leu Leu Leu Ser Gln Phe Gln Lys Arg 770
775 780Leu Thr Phe Gly Ile Gln Arg Glu Leu Cys Asp
Leu Val Arg Val Ser785 790 795
800Leu Leu Asn Ala Gln Arg Ala Arg Val Leu Tyr Ala Ser Gly Phe His
805 810 815Thr Val Ala Asp
Leu Ala Arg Ala Asn Ile Val Glu Val Glu Val Ile 820
825 830Leu Lys Asn Ala Val Pro Phe Lys Ser Ala Arg
Lys Ala Val Asp Glu 835 840 845Glu
Glu Glu Ala Val Glu Glu Arg Arg Asn Met Arg Thr Ile Trp Val 850
855 860Thr Gly Arg Lys Gly Leu Thr Glu Arg Glu
Ala Ala Ala Leu Ile Val865 870 875
880Glu Glu Ala Arg Met Ile Leu Gln Gln Asp Leu Val Glu Met Gly
Val 885 890 895Gln Trp Asn
Pro Cys Ala Leu Leu His Ser Ser Thr Cys Ser Leu Thr 900
905 910His Ser Glu Ser Glu Val Lys Glu His Thr
Phe Ile Ser Gln Thr Lys 915 920
925Ser Ser Tyr Lys Lys Leu Thr Ser Lys Asn Lys Ser Asn Thr Ile Phe 930
935 940Ser Asp Ser Tyr Ile Lys His Ser
Pro Asn Ile Val Gln Asp Leu Asn945 950
955 960Lys Ser Arg Glu His Thr Ser Ser Phe Asn Cys Asn
Phe Gln Asn Gly 965 970
975Asn Gln Glu His Gln Thr Cys Ser Ile Phe Arg Ala Arg Lys Arg Ala
980 985 990Ser Leu Asp Ile Asn Lys
Glu Lys Pro Gly Ala Ser Gln Asn Glu Gly 995 1000
1005Lys Thr Ser Asp Lys Lys Val Val Gln Thr Phe Ser
Gln Lys Thr 1010 1015 1020Lys Lys Ala
Pro Leu Asn Phe Asn Ser Glu Lys Met Ser Arg Ser 1025
1030 1035Phe Arg Ser Trp Lys Arg Arg Lys His Leu Lys
Arg Ser Arg Asp 1040 1045 1050Ser Ser
Pro Leu Lys Asp Ser Gly Ala Cys Arg Ile His Leu Gln 1055
1060 1065Gly Gln Thr Leu Ser Asn Pro Ser Leu Cys
Glu Asp Pro Phe Thr 1070 1075 1080Leu
Asp Glu Lys Lys Thr Glu Phe Arg Asn Ser Gly Pro Phe Ala 1085
1090 1095Lys Asn Val Ser Leu Ser Gly Lys Glu
Lys Asp Asn Lys Thr Ser 1100 1105
1110Phe Pro Leu Gln Ile Lys Gln Asn Cys Ser Trp Asn Ile Thr Leu
1115 1120 1125Thr Asn Asp Asn Phe Val
Glu His Ile Val Thr Gly Ser Gln Ser 1130 1135
1140Lys Asn Val Thr Cys Gln Ala Thr Ser Val Val Ser Glu Lys
Gly 1145 1150 1155Arg Gly Val Ala Val
Glu Ala Glu Lys Ile Asn Glu Val Leu Ile 1160 1165
1170Gln Asn Gly Ser Lys Asn Gln Asn Val Tyr Met Lys His
His Asp 1175 1180 1185Ile His Pro Ile
Asn Gln Tyr Leu Arg Lys Gln Ser His Glu Gln 1190
1195 1200Thr Ser Thr Ile Thr Lys Gln Lys Asn Ile Ile
Glu Arg Gln Met 1205 1210 1215Pro Cys
Glu Ala Val Ser Ser Tyr Ile Asn Arg Asp Ser Asn Val 1220
1225 1230Thr Ile Asn Cys Glu Arg Ile Lys Leu Asn
Thr Glu Glu Asn Lys 1235 1240 1245Pro
Ser His Phe Gln Ala Leu Gly Asp Asp Ile Ser Arg Thr Val 1250
1255 1260Ile Pro Ser Glu Val Leu Pro Ser Ala
Gly Ala Phe Ser Lys Ser 1265 1270
1275Glu Gly Gln His Glu Asn Phe Leu Asn Ile Ser Arg Leu Gln Glu
1280 1285 1290Lys Thr Gly Thr Tyr Thr
Thr Asn Lys Thr Lys Asn Asn His Val 1295 1300
1305Ser Asp Leu Gly Leu Val Leu Cys Asp Phe Glu Asp Ser Phe
Tyr 1310 1315 1320Leu Asp Thr Gln Ser
Glu Lys Ile Ile Gln Gln Met Ala Thr Glu 1325 1330
1335Asn Ala Lys Leu Gly Ala Lys Asp Thr Asn Leu Ala Ala
Gly Ile 1340 1345 1350Met Gln Lys Ser
Leu Val Gln Gln Asn Ser Met Asn Ser Phe Gln 1355
1360 1365Lys Glu Cys His Ile Pro Phe Pro Ala Glu Gln
His Pro Leu Gly 1370 1375 1380Ala Thr
Lys Ile Asp His Leu Asp Leu Lys Thr Val Gly Thr Met 1385
1390 1395Lys Gln Ser Ser Asp Ser His Gly Val Asp
Ile Leu Thr Pro Glu 1400 1405 1410Ser
Pro Ile Phe His Ser Pro Ile Leu Leu Glu Glu Asn Gly Leu 1415
1420 1425Phe Leu Lys Lys Asn Glu Val Ser Val
Thr Asp Ser Gln Leu Asn 1430 1435
1440Ser Phe Leu Gln Gly Tyr Gln Thr Gln Glu Thr Val Lys Pro Val
1445 1450 1455Ile Leu Leu Ile Pro Gln
Lys Arg Thr Pro Thr Gly Val Glu Gly 1460 1465
1470Glu Cys Leu Pro Val Pro Glu Thr Ser Leu Asn Met Ser Asp
Ser 1475 1480 1485Leu Leu Phe Asp Ser
Phe Ser Asp Asp Tyr Leu Val Lys Glu Gln 1490 1495
1500Leu Pro Asp Met Gln Met Lys Glu Pro Leu Pro Ser Glu
Val Thr 1505 1510 1515Ser Asn His Phe
Ser Asp Ser Leu Cys Leu Gln Glu Asp Leu Ile 1520
1525 1530Lys Lys Ser Asn Val Asn Glu Asn Gln Asp Thr
His Gln Gln Leu 1535 1540 1545Thr Cys
Ser Asn Asp Glu Ser Ile Ile Phe Ser Glu Met Asp Ser 1550
1555 1560Val Gln Met Val Glu Ala Leu Asp Asn Val
Asp Ile Phe Pro Val 1565 1570 1575Gln
Glu Lys Asn His Thr Val Val Ser Pro Arg Ala Leu Glu Leu 1580
1585 1590Ser Asp Pro Val Leu Asp Glu His His
Gln Gly Asp Gln Asp Gly 1595 1600
1605Gly Asp Gln Asp Glu Arg Ala Glu Lys Ser Lys Leu Thr Gly Thr
1610 1615 1620Arg Gln Asn His Ser Phe
Ile Trp Ser Gly Ala Ser Phe Asp Leu 1625 1630
1635Ser Pro Gly Leu Gln Arg Ile Leu Asp Lys Val Ser Ser Pro
Leu 1640 1645 1650Glu Asn Glu Lys Leu
Lys Ser Met Thr Ile Asn Phe Ser Ser Leu 1655 1660
1665Asn Arg Lys Asn Thr Glu Leu Asn Glu Glu Gln Glu Val
Ile Ser 1670 1675 1680Asn Leu Glu Thr
Lys Gln Val Gln Gly Ile Ser Phe Ser Ser Asn 1685
1690 1695Asn Glu Val Lys Ser Lys Ile Glu Met Leu Glu
Asn Asn Ala Asn 1700 1705 1710His Asp
Glu Thr Ser Ser Leu Leu Pro Arg Lys Glu Ser Asn Ile 1715
1720 1725Val Asp Asp Asn Gly Leu Ile Pro Pro Thr
Pro Ile Pro Thr Ser 1730 1735 1740Ala
Ser Lys Leu Thr Phe Pro Gly Ile Leu Glu Thr Pro Val Asn 1745
1750 1755Pro Trp Lys Thr Asn Asn Val Leu Gln
Pro Gly Glu Ser Tyr Leu 1760 1765
1770Phe Gly Ser Pro Ser Asp Ile Lys Asn His Asp Leu Ser Pro Gly
1775 1780 1785Ser Arg Asn Gly Phe Lys
Asp Asn Ser Pro Ile Ser Asp Thr Ser 1790 1795
1800Phe Ser Leu Gln Leu Ser Gln Asp Gly Leu Gln Leu Thr Pro
Ala 1805 1810 1815Ser Ser Ser Ser Glu
Ser Leu Ser Ile Ile Asp Val Ala Ser Asp 1820 1825
1830Gln Asn Leu Phe Gln Thr Phe Ile Lys Glu Trp Arg Cys
Lys Lys 1835 1840 1845Arg Phe Ser Ile
Ser Leu Ala Cys Glu Lys Ile Arg Ser Leu Thr 1850
1855 1860Ser Ser Lys Thr Ala Thr Ile Gly Ser Arg Phe
Lys Gln Ala Ser 1865 1870 1875Ser Pro
Gln Glu Ile Pro Ile Arg Asp Asp Gly Phe Pro Ile Lys 1880
1885 1890Gly Cys Asp Asp Thr Leu Val Val Gly Leu
Ala Val Cys Trp Gly 1895 1900 1905Gly
Arg Asp Ala Tyr Tyr Phe Ser Leu Gln Lys Glu Gln Lys His 1910
1915 1920Ser Glu Ile Ser Ala Ser Leu Val Pro
Pro Ser Leu Asp Pro Ser 1925 1930
1935Leu Thr Leu Lys Asp Arg Met Trp Tyr Leu Gln Ser Cys Leu Arg
1940 1945 1950Lys Glu Ser Asp Lys Glu
Cys Ser Val Val Ile Tyr Asp Phe Ile 1955 1960
1965Gln Ser Tyr Lys Ile Leu Leu Leu Ser Cys Gly Ile Ser Leu
Glu 1970 1975 1980Gln Ser Tyr Glu Asp
Pro Lys Val Ala Cys Trp Leu Leu Asp Pro 1985 1990
1995Asp Ser Gln Glu Pro Thr Leu His Ser Ile Val Thr Ser
Phe Leu 2000 2005 2010Pro His Glu Leu
Pro Leu Leu Glu Gly Met Glu Thr Ser Gln Gly 2015
2020 2025Ile Gln Ser Leu Gly Leu Asn Ala Gly Ser Glu
His Ser Gly Arg 2030 2035 2040Tyr Arg
Ala Ser Val Glu Ser Ile Leu Ile Phe Asn Ser Met Asn 2045
2050 2055Gln Leu Asn Ser Leu Leu Gln Lys Glu Asn
Leu Gln Asp Val Phe 2060 2065 2070Arg
Lys Val Glu Met Pro Ser Gln Tyr Cys Leu Ala Leu Leu Glu 2075
2080 2085Leu Asn Gly Ile Gly Phe Ser Thr Ala
Glu Cys Glu Ser Gln Lys 2090 2095
2100His Ile Met Gln Ala Lys Leu Asp Ala Ile Glu Thr Gln Ala Tyr
2105 2110 2115Gln Leu Ala Gly His Ser
Phe Ser Phe Thr Ser Ser Asp Asp Ile 2120 2125
2130Ala Glu Val Leu Phe Leu Glu Leu Lys Leu Pro Pro Asn Arg
Glu 2135 2140 2145Met Lys Asn Gln Gly
Ser Lys Lys Thr Leu Gly Ser Thr Arg Arg 2150 2155
2160Gly Ile Asp Asn Gly Arg Lys Leu Arg Leu Gly Arg Gln
Phe Ser 2165 2170 2175Thr Ser Lys Asp
Val Leu Asn Lys Leu Lys Ala Leu His Pro Leu 2180
2185 2190Pro Gly Leu Ile Leu Glu Trp Arg Arg Ile Thr
Asn Ala Ile Thr 2195 2200 2205Lys Val
Val Phe Pro Leu Gln Arg Glu Lys Cys Leu Asn Pro Phe 2210
2215 2220Leu Gly Met Glu Arg Ile Tyr Pro Val Ser
Gln Ser His Thr Ala 2225 2230 2235Thr
Gly Arg Ile Thr Phe Thr Glu Pro Asn Ile Gln Asn Val Pro 2240
2245 2250Arg Asp Phe Glu Ile Lys Met Pro Thr
Leu Val Gly Glu Ser Pro 2255 2260
2265Pro Ser Gln Ala Val Gly Lys Gly Leu Leu Pro Met Gly Arg Gly
2270 2275 2280Lys Tyr Lys Lys Gly Phe
Ser Val Asn Pro Arg Cys Gln Ala Gln 2285 2290
2295Met Glu Glu Arg Ala Ala Asp Arg Gly Met Pro Phe Ser Ile
Ser 2300 2305 2310Met Arg His Ala Phe
Val Pro Phe Pro Gly Gly Ser Ile Leu Ala 2315 2320
2325Ala Asp Tyr Ser Gln Leu Glu Leu Arg Ile Leu Ala His
Leu Ser 2330 2335 2340His Asp Arg Arg
Leu Ile Gln Val Leu Asn Thr Gly Ala Asp Val 2345
2350 2355Phe Arg Ser Ile Ala Ala Glu Trp Lys Met Ile
Glu Pro Glu Ser 2360 2365 2370Val Gly
Asp Asp Leu Arg Gln Gln Ala Lys Gln Ile Cys Tyr Gly 2375
2380 2385Ile Ile Tyr Gly Met Gly Ala Lys Ser Leu
Gly Glu Gln Met Gly 2390 2395 2400Ile
Lys Glu Asn Asp Ala Ala Cys Tyr Ile Asp Ser Phe Lys Ser 2405
2410 2415Arg Tyr Thr Gly Ile Asn Gln Phe Met
Thr Glu Thr Val Lys Asn 2420 2425
2430Cys Lys Arg Asp Gly Phe Val Gln Thr Ile Leu Gly Arg Arg Arg
2435 2440 2445Tyr Leu Pro Gly Ile Lys
Asp Asn Asn Pro Tyr Arg Lys Ala His 2450 2455
2460Ala Glu Arg Gln Ala Ile Asn Thr Ile Val Gln Gly Ser Ala
Ala 2465 2470 2475Asp Ile Val Lys Ile
Ala Thr Val Asn Ile Gln Lys Gln Leu Glu 2480 2485
2490Thr Phe His Ser Thr Phe Lys Ser His Gly His Arg Glu
Gly Met 2495 2500 2505Leu Gln Ser Asp
Gln Thr Gly Leu Ser Arg Lys Arg Lys Leu Gln 2510
2515 2520Gly Met Phe Cys Pro Ile Arg Gly Gly Phe Phe
Ile Leu Gln Leu 2525 2530 2535His Asp
Glu Leu Leu Tyr Glu Val Ala Glu Glu Asp Val Val Gln 2540
2545 2550Val Ala Gln Ile Val Lys Asn Glu Met Glu
Ser Ala Val Lys Leu 2555 2560 2565Ser
Val Lys Leu Lys Val Lys Val Lys Ile Gly Ala Ser Trp Gly 2570
2575 2580Glu Leu Lys Asp Phe Asp Val 2585
2590382547PRTRattus norvegicus 38Met Ser Leu Pro Arg Arg Ser
Gly Lys Arg Arg Arg Ser Ser Ser Gly1 5 10
15Ser Asp Ser Phe Ser Phe Ser Gly Asp Gly Asp Ser Cys
Val Ser Pro 20 25 30Gln Leu
Leu Cys Arg Pro Val Leu Ser Pro Pro Pro Gly Leu Gly Arg 35
40 45Gly Arg Arg Leu Ala Gly Thr Gly Thr Cys
Lys Gln Arg Val Ser Asp 50 55 60Asp
Gln Ile Asp Gln Leu Leu Leu Ala Asn Trp Gly Leu Pro Lys Ala65
70 75 80Val Leu Glu Lys Tyr His
Asn Phe Gly Val Lys Lys Met Phe Glu Trp 85
90 95Gln Ala Glu Cys Leu Leu Leu Gly Gln Val Leu Glu
Gly Lys Asn Leu 100 105 110Val
Tyr Ser Ala Pro Thr Ser Ala Gly Lys Thr Leu Val Ala Glu Leu 115
120 125Leu Ile Leu Lys Arg Val Leu Glu Thr
Arg Lys Lys Ala Leu Phe Ile 130 135
140Leu Pro Phe Val Ser Val Ala Lys Glu Lys Lys Tyr Tyr Leu Gln Ser145
150 155 160Leu Phe Gln Glu
Val Gly Ile Lys Val Asp Gly Tyr Met Gly Ser Thr 165
170 175Ser Pro Thr Gly Arg Phe Ser Ser Leu Asp
Val Ala Val Cys Thr Ile 180 185
190Glu Arg Ala Asn Gly Leu Ile Asn Arg Leu Ile Glu Glu Asn Lys Met
195 200 205Asp Leu Leu Gly Thr Val Val
Val Asp Glu Leu His Met Leu Gly Asp 210 215
220Ser His Arg Gly Tyr Leu Leu Glu Leu Leu Leu Thr Lys Val Cys
Phe225 230 235 240Val Thr
Arg Lys Ser Ala Ser Cys Gln Ala Asp Ser Ala Ser Ala Leu
245 250 255Ala Cys Ala Val Gln Ile Val
Gly Met Ser Ala Thr Leu Pro Asn Leu 260 265
270Gln Leu Val Ala Ser Trp Leu Asn Ala Glu Leu Tyr His Thr
Asp Phe 275 280 285Arg Pro Val Pro
Leu Leu Glu Ser Ile Lys Val Gly Asn Ser Ile Tyr 290
295 300Asp Ser Ser Met Lys Leu Val Arg Glu Phe Gln Pro
Leu Leu Gln Val305 310 315
320Lys Gly Asp Glu Asp His Ile Val Ser Leu Cys Tyr Glu Thr Val Arg
325 330 335Asp Asn His Ser Val
Leu Val Phe Cys Pro Ser Lys Lys Trp Cys Glu 340
345 350Lys Val Ala Asp Ile Ile Ala Arg Glu Phe Tyr Asn
Leu His His Gln 355 360 365Pro Glu
Gly Leu Val Lys Ser Ser Glu Phe Pro Pro Val Ile Leu Asp 370
375 380Gln Lys Ser Leu Leu Glu Val Ile Asp Gln Leu
Lys Arg Ser Pro Ser385 390 395
400Gly Leu Asp Ser Val Leu Lys Asn Thr Val Pro Trp Gly Val Ala Phe
405 410 415His His Ala Gly
Leu Thr Phe Glu Glu Arg Asp Ile Ile Glu Gly Ala 420
425 430Phe Arg Gln Gly Leu Ile Arg Val Leu Ala Ala
Thr Ser Thr Leu Ser 435 440 445Ser
Gly Val Asn Leu Pro Ala Arg Arg Val Ile Ile Arg Thr Pro Val 450
455 460Phe Gly Gly Gln Pro Leu Asp Ile Leu Thr
Tyr Lys Gln Met Val Gly465 470 475
480Arg Ala Gly Arg Lys Gly Val Asp Thr Met Gly Glu Ser Ile Leu
Val 485 490 495Cys Lys Asn
Ser Glu Lys Ser Lys Gly Ile Ala Leu Leu Gln Gly Ser 500
505 510Leu Glu Pro Val His Ser Cys Leu Gln Ser
Gln Gly Glu Val Thr Ser 515 520
525Thr Met Ile Arg Ala Ile Leu Glu Ile Ile Val Ser Gly Val Ala Ser 530
535 540Thr Ser Gln Asp Met Gln Thr Tyr
Ala Ala Cys Thr Phe Leu Ala Ala545 550
555 560Asp Val Lys Glu Gly Lys Gln Gly Ile Gln Arg Asn
Arg Asp Asp Val 565 570
575Gln Arg Gly Ala Val Asp Ala Cys Val Thr Trp Leu Leu Glu Asn Glu
580 585 590Phe Ile Gln Ala Ala Glu
Pro Ser Asp Gly Thr Gly Gly Lys Val Tyr 595 600
605His Pro Thr His Leu Gly Ser Ala Thr Leu Ser Ser Ser Leu
Ser Pro 610 615 620Thr Asp Thr Leu Asp
Ile Phe Ala Asp Leu Gln Arg Ala Met Lys Gly625 630
635 640Phe Val Leu Glu Asn Asp Leu His Ile Val
Tyr Leu Val Thr Pro Val 645 650
655Phe Glu Asp Trp Thr Ser Ile Asp Trp Tyr Arg Phe Phe Cys Leu Trp
660 665 670Glu Lys Leu Pro Thr
Ser Met Lys Arg Val Ala Glu Leu Val Gly Val 675
680 685Glu Glu Gly Phe Leu Ala Arg Cys Val Lys Gly Lys
Val Val Ala Arg 690 695 700Thr Glu Arg
Gln His Arg Gln Met Ala Ile His Lys Arg Phe Phe Thr705
710 715 720Ser Leu Val Leu Leu Asp Leu
Ile Ser Glu Ile Pro Leu Lys Glu Ile 725
730 735Asn Gln Lys Tyr Gly Cys Asn Arg Gly Gln Ile Gln
Ser Leu Gln Gln 740 745 750Ser
Ala Ala Val Tyr Ala Gly Met Ile Thr Val Phe Ser Asn Arg Leu 755
760 765Gly Trp His Asn Met Glu Leu Leu Leu
Ser Gln Phe Gln Lys Arg Leu 770 775
780Thr Phe Gly Ile Gln Arg Glu Leu Cys Asp Leu Ile Arg Val Ser Ser785
790 795 800Leu Asn Ala Gln
Arg Ala Arg Phe Leu Tyr Ala Ser Gly Phe Leu Thr 805
810 815Val Ala Asp Leu Ala Arg Ala Asp Thr Val
Glu Val Glu Ala Ala Leu 820 825
830Lys Asp Ala Leu Pro Phe Lys Ser Ala Arg Lys Ala Val Asp Glu Glu
835 840 845Glu Glu Ala Ala Glu Glu Arg
Arg Ser Met Arg Thr Ile Trp Val Ala 850 855
860Gly Lys Ser Leu Ser Ala Arg Glu Ala Ala Ala Leu Ile Val Glu
Glu865 870 875 880Ala Lys
Val Ile Leu Gln Gln Asp Leu Ile Glu Met Gly Val Gln Trp
885 890 895Gly Pro His Ser Pro Leu Ser
Ser Ser Thr His Ser Leu Thr Ser Gly 900 905
910Ser Glu Val Lys Glu His Thr Phe Lys Ser Gln Thr Lys Ser
Ser His 915 920 925Lys Arg Leu Ala
Ser Lys Ser Arg Asn Ser Met Arg Val Ser Gly Ser 930
935 940Asn Gly Lys Gln Ser Pro Glu Ala Gly Gln Gly Leu
Asp Glu Cys Arg945 950 955
960Glu Arg Pro Asp Ser Leu Cys Lys Phe Gln Gly Asn His Glu Ile Gln
965 970 975Thr Pro Ser Val Tyr
Arg Ala Arg Lys Arg Thr Ser Leu Gly Val Asn 980
985 990Lys Glu Met Leu Arg Thr Ser Leu Lys Glu Gly Lys
Pro Ser Thr Lys 995 1000 1005Glu
Val Leu Gln Thr Leu Ser Phe Glu Lys Thr Arg Lys Ala Ala 1010
1015 1020Leu Ser Phe Ser Ser Glu Gln Ala Asn
Asn Ser Phe Pro Ser Gly 1025 1030
1035Arg Asp Arg Lys Tyr Arg Lys Lys Ser Trp Gly Ser Ser Pro Met
1040 1045 1050Ser Asp Ser Val Met His
Arg Asp Asp Leu Gln Gly Gln Thr Met 1055 1060
1065Cys Lys Ser Thr Leu Cys Glu Asp Pro Gln Lys Ser Leu Glu
Glu 1070 1075 1080Gln Asn Thr Glu Tyr
Arg Ser Pro Gly Leu Phe Ala Lys Asn Val 1085 1090
1095Ser Phe Cys Ala Lys Glu Lys Cys Asn Lys Thr Ser Phe
Pro Leu 1100 1105 1110Gln Met Gln Gln
Pro Cys Leu Arg Arg Lys Pro Glu Ser Gly Ala 1115
1120 1125Ala Val Asp His Ser Val Ala Val Ser Gln Asn
Lys Asn Val Val 1130 1135 1140Glu Gln
Pro Pro Gly Ala Pro Arg Asp Arg Arg Gly Leu Ala Ala 1145
1150 1155His Gly Arg Ala Glu Val Asn Glu Val Leu
Thr Glu Asn Gly Thr 1160 1165 1170Glu
Ser Gln Leu His Asp Thr His Pro Val Ser Gln Cys Leu Glu 1175
1180 1185Asn His Ser Glu Lys Gln Thr Asn Thr
Cys Thr Arg Gln Lys Thr 1190 1195
1200Leu Thr Glu Gly Gln Ala Gly Ile Ser His Val Thr Arg Gly Ser
1205 1210 1215Asn Asp Leu Thr Pro Ile
Arg Cys Glu Arg Leu Lys Leu Asn Ser 1220 1225
1230Lys Glu His Asp Ser Asn Pro Cys Pro Gln Ala Leu Gly Thr
Asn 1235 1240 1245Ala Gly Arg Thr Glu
Ala Pro Gln Ser Ser Glu Ala Leu Gly Gln 1250 1255
1260Ala Gly Gly Gln Cys Glu Asn Leu Leu Asn Ser Pro Gly
Ile Gln 1265 1270 1275Glu Lys Thr Ser
Ala His Ala Thr Asn Lys Thr Glu His Ser His 1280
1285 1290Val Ala Asn Gln Ala Phe Cys Asp Phe Gly Asp
Ser Leu Tyr Leu 1295 1300 1305Asp Thr
Gln Ser Glu Glu Ile Ile Glu Gln Met Ala Thr Lys Asn 1310
1315 1320Ala Thr Gln Gly Ala Glu Ala Ala Gly Ile
Thr Glu Glu Gly Ser 1325 1330 1335Ala
Thr Gln Asn Glu Pro His Ser Thr Thr Gly Gly Gln His Ile 1340
1345 1350Pro Gly Ala Ala Asn Thr Asp His Val
Asp Arg Lys Asn Thr Glu 1355 1360
1365Ser Val Lys Glu Asn Pro Glu Lys Asn Ile Asp Arg Arg Thr Pro
1370 1375 1380His Ser Leu Ile Phe His
Ser Pro Thr Pro Gln Gly Gly Asn Ser 1385 1390
1395Ala Cys Phe Lys Glu Asn Glu His Ser Val Thr Asp Ser Gln
Leu 1400 1405 1410Asn Ser Phe Leu Gln
Gly Leu Glu Thr Gln Asp Lys Pro Ile Ile 1415 1420
1425Pro Leu Ala Pro Gln Met Arg Thr Ser Thr Gly Val Glu
Glu Glu 1430 1435 1440Ser Leu Pro Glu
Thr Ser Leu Asn Met Ser Asp Ser Ile Leu Phe 1445
1450 1455Asp Ser Phe Gly Glu Asp Ser Phe Gly Gln Arg
Gln Ser Leu Asp 1460 1465 1470Val Lys
Ala Lys Gln Pro Leu Leu Ser Glu Met Thr Pro Asn His 1475
1480 1485Phe His Asn Pro Pro Tyr Pro Gln Glu Asp
Pro Val Met Thr Pro 1490 1495 1500His
Met Ser Glu Pro Gln Gly Thr Leu Glu Arg Met Ala Cys Leu 1505
1510 1515Ser Gly Glu Ser Ile Ile Phe Ser Glu
Ile Asp Ser Ala Gln Val 1520 1525
1530Ile Glu Ala Leu Asp Asn Met Ala Ala Phe Tyr Met Gln Glu Asn
1535 1540 1545Cys Asn Pro Ile Thr Leu
Lys Thr Glu Pro Arg Asp Leu Ala Ala 1550 1555
1560Leu Gly Asn Glu Cys Pro Gln Gly Glu Val Val Arg Gly Glu
Gln 1565 1570 1575His Glu Gly Ser Ser
Lys Pro Lys Phe Met Glu Ile Asn Gln Asp 1580 1585
1590Asn Ser Phe Thr Trp Ser Ala Ala Ser Phe Asn Leu Ser
Pro Glu 1595 1600 1605Leu Gln Arg Ile
Leu Asp Lys Val Ser Thr Pro Arg Glu Asn Glu 1610
1615 1620Glu Pro Glu Leu Met His Ala Asp Leu Ser Cys
Phe Glu Glu Asn 1625 1630 1635Ser Thr
Glu Ser His Glu Arg Gln Asp Met Asn Ser Asp Leu Gly 1640
1645 1650Thr Val Gln Arg Thr Ser Phe Leu Pro Ser
Asn Gly Val Lys Ser 1655 1660 1665Arg
Thr Glu Gly Leu Glu Ser Lys Ala Lys His Gly Gly Ala Ser 1670
1675 1680Ser Ala Leu Pro His Lys Ala Ala Ala
Asp Asp Asn Gly Leu Ile 1685 1690
1695Pro Pro Thr Pro Leu Pro Ala Ser Ala Ser Ala Ser Ala Ser Lys
1700 1705 1710Leu Ala Leu Pro Glu Ile
Leu Gly Thr Ser Val Lys His Gln Lys 1715 1720
1725Ala Ser Cys Leu Phe Asp Ser Pro Ser Asp Asn Gln Asn Gln
Asp 1730 1735 1740Leu Ser Gln Glu Leu
Arg Asp Ser Leu Lys Asp Ser Asp Gly Ser 1745 1750
1755Val Val Asp Thr Ser Phe Phe Leu Gln Ser Gln Asp Gly
Leu Leu 1760 1765 1770Leu Thr Gln Ala
Ser Cys Ser Ser Glu Ser Leu Ala Ile Ile Asp 1775
1780 1785Val Ala Ser Asp Gln Ile Leu Phe Gln Thr Phe
Val Lys Glu Trp 1790 1795 1800Gln Cys
Gln Lys Arg Phe Ser Ile Ser Leu Ala Cys Glu Lys Met 1805
1810 1815Thr Ser Ser Thr Ser Ser Lys Thr Ala Thr
Ile Gly Gly Arg Leu 1820 1825 1830Lys
Gln Val Asn Ser Pro Gln Glu Ala Ser Val Glu Asp Asp Gly 1835
1840 1845Phe Pro Val His Gly Ser Asp Cys Ala
Val Val Val Gly Leu Ala 1850 1855
1860Val Cys Trp Gly Gly Lys Asp Ala Tyr Tyr Leu Ser Leu Gln Lys
1865 1870 1875Glu Gln Lys Gln Ser Glu
Met Ser Pro Ser Leu Ala Pro Pro Pro 1880 1885
1890Leu Asp Ala Thr Leu Thr Val Lys Glu Arg Met Glu Tyr Leu
Gln 1895 1900 1905Ser Cys Leu Gln Lys
Lys Ser Asp Gln Glu Arg Ser Val Val Thr 1910 1915
1920Tyr Asp Phe Ile Gln Thr Tyr Lys Val Leu Leu Leu Ser
Cys Gly 1925 1930 1935Ile Ser Leu Glu
Pro Ser Tyr Glu Asp Pro Lys Val Ala Cys Trp 1940
1945 1950Leu Leu Asp Pro Asp Ser Lys Glu Pro Thr Leu
His Ser Ile Val 1955 1960 1965Thr Ser
Phe Leu Pro His Glu Leu Ala Leu Leu Glu Gly Ile Glu 1970
1975 1980Thr Gly Pro Gly Ile Gln Ser Leu Gly Leu
Asn Val Asn Thr Asp 1985 1990 1995His
Ser Gly Arg Tyr Arg Ala Ser Val Glu Ser Val Leu Ile Phe 2000
2005 2010Asn Ser Met Asn Gln Leu Asn Ser Met
Leu Gln Lys Glu Asn Leu 2015 2020
2025His Asp Ile Phe Cys Lys Val Glu Met Pro Ser Gln Tyr Cys Leu
2030 2035 2040Ala Leu Leu Glu Leu Asn
Gly Ile Gly Phe Ser Thr Ala Glu Cys 2045 2050
2055Glu Thr Gln Lys His Ile Met Gln Ala Lys Leu Asp Ala Ile
Glu 2060 2065 2070Thr Gln Ala Tyr Gln
Leu Ala Gly His Ser Phe Ser Phe Thr Ser 2075 2080
2085Ala Asp Asp Ile Ala Gln Val Leu Phe Leu Glu Leu Lys
Leu Pro 2090 2095 2100Pro Asn Gly Glu
Met Lys Thr Gln Gly Gly Arg Lys Thr Leu Gly 2105
2110 2115Ser Thr Arg Arg Gly Thr Glu Ser Asp Arg Lys
Leu Arg Leu Gly 2120 2125 2130Arg Arg
Phe Ser Thr Ser Lys Asp Ile Leu Asn Lys Leu Lys Asp 2135
2140 2145Leu His Pro Leu Pro Gly Leu Ile Leu Glu
Trp Arg Arg Ile Ser 2150 2155 2160Asn
Ala Ile Thr Lys Val Val Phe Pro Leu Gln Arg Glu Lys His 2165
2170 2175Leu Asn Pro Phe Leu Arg Met Glu Arg
Ile Tyr Pro Val Ser Gln 2180 2185
2190Ser His Thr Ala Thr Gly Arg Ile Thr Phe Thr Glu Pro Asn Ile
2195 2200 2205Gln Asn Val Pro Arg Asp
Phe Glu Ile Lys Met Pro Thr Leu Val 2210 2215
2220Arg Glu Ser Pro Pro Ser Gln Ala Ser Gly Lys Gly Gln Leu
Ala 2225 2230 2235Met Ala Arg Gln Asn
Gln Lys Val Tyr Gly Leu His Pro Gly Gln 2240 2245
2250Arg Thr Val Leu Glu Lys Thr Ser Asp Arg Gly Val Pro
Phe Ser 2255 2260 2265Val Ser Met Arg
His Ala Phe Val Pro Phe Pro Gly Gly Leu Ile 2270
2275 2280Leu Ala Ala Asp Tyr Ser Gln Leu Glu Leu Arg
Ile Leu Ala His 2285 2290 2295Leu Ser
Arg Asp Cys Arg Leu Ile Gln Val Leu Asn Ser Gly Ala 2300
2305 2310Asp Val Phe Arg Ser Ile Ala Ala Glu Trp
Lys Met Ile Glu Pro 2315 2320 2325Asp
Ala Val Gly Asp Asn Leu Arg Gln Gln Ala Lys Gln Ile Cys 2330
2335 2340Tyr Gly Ile Ile Tyr Gly Met Gly Ala
Lys Ser Leu Gly Glu Gln 2345 2350
2355Met Gly Ile Lys Glu Asn Asp Ala Ala Cys Tyr Ile Asp Ser Phe
2360 2365 2370Lys Ser Arg Tyr Lys Gly
Ile Asn His Phe Met Arg Asp Thr Val 2375 2380
2385Lys Asn Cys Arg Arg Asp Gly Phe Val Glu Thr Ile Leu Gly
Arg 2390 2395 2400Arg Arg Tyr Leu Pro
Gly Ile Lys Asp Asn Asn Pro Tyr His Lys 2405 2410
2415Ala His Ala Glu Arg Gln Ala Ile Asn Thr Thr Val Gln
Gly Ser 2420 2425 2430Ala Ala Asp Ile
Val Lys Val Ala Thr Val Asn Ile Gln Lys Gln 2435
2440 2445Leu Glu Thr Phe His Pro Thr Phe Lys Ser His
Gly His Arg Glu 2450 2455 2460Ser Met
Leu Gln Ser Asp Arg Ala Gly Leu Leu Pro Lys Arg Lys 2465
2470 2475Val Lys Gly Met Phe Cys Pro Met Arg Gly
Gly Phe Phe Ile Leu 2480 2485 2490Gln
Leu His Asp Glu Leu Leu Tyr Glu Val Ala Glu Glu Asp Val 2495
2500 2505Val Gln Val Ala Gln Ile Val Lys Asn
Glu Met Glu Cys Ala Ile 2510 2515
2520Lys Leu Ser Val Lys Leu Lys Val Lys Val Lys Ile Gly Ala Ser
2525 2530 2535Trp Gly Glu Leu Lys Asp
Phe Asp Val 2540 2545392620PRTGallus gallus 39Met Ala
Arg Arg Glu Asp Gly Gly Ala Thr Ala Asn Gly Val Ala Ala1 5
10 15Val Ser Ala Ala Gly Leu Gly Arg
Ala Ala Arg Ala Ala Pro Leu Gly 20 25
30Pro Ala Ala Pro Cys Arg Ala Val Leu Ser Pro Pro Pro Gly Leu
Glu 35 40 45Val Ser Leu Arg Cys
Ser Gly Ser Pro Gly Gly Gly Gly Ser Ala Gly 50 55
60Gln Cys Gln Gln Val Asn Val Pro Glu Asp Gln Ala Asp Lys
Leu Leu65 70 75 80Leu
Ala Ser Trp Gly Leu Pro Lys Ala Val Leu Glu Lys Tyr His Ser
85 90 95Leu Gly Val Val Gln Met Phe
Glu Trp Gln Ala Glu Cys Leu Met Leu 100 105
110Gly Gln Val Leu Glu Gly Lys Asn Leu Val Tyr Ser Ala Pro
Thr Ser 115 120 125Ala Gly Lys Thr
Leu Val Ala Glu Leu Leu Ile Leu Lys Arg Val Leu 130
135 140Glu Thr Arg Lys Lys Ala Leu Phe Ile Leu Pro Phe
Val Ser Val Ala145 150 155
160Lys Glu Lys Lys Cys Tyr Leu Gln Ala Leu Phe Gln Glu Val Asp Met
165 170 175Arg Val Gly Gly Tyr
Met Gly Ser Ile Ser Pro Ala Gly Arg Phe Ser 180
185 190Leu Leu Asp Val Ala Val Cys Thr Ile Glu Lys Ala
Asn Gly Leu Ile 195 200 205Asn Arg
Leu Ile Glu Glu Asn Gln Met Asp Ser Leu Gly Val Val Val 210
215 220Val Asp Glu Leu His Met Leu Gly Asp Ser His
Arg Gly Tyr Leu Leu225 230 235
240Glu Leu Leu Leu Thr Lys Val Arg Tyr Ile Thr Glu Lys Ala Ala Lys
245 250 255Arg Lys Thr Lys
Met Lys Ser Pro Gly Phe Gly Gly Ile Gln Val Val 260
265 270Gly Met Ser Ala Thr Leu Pro Asn Leu Gly Leu
Leu Ala Ser Trp Leu 275 280 285Asp
Ala Glu Leu Tyr Cys Thr Asp Phe Arg Pro Val Pro Leu Lys Glu 290
295 300Trp Val Lys Ile Gly Asn Asn Ile Tyr Asp
Ser Ser Met Asn Leu Val305 310 315
320Arg Glu Phe Gln Pro Lys Leu Gln Leu Lys Gly Asp Glu Asp His
Val 325 330 335Val Ser Leu
Cys Tyr Glu Thr Val Cys Asp Gly His Ser Val Leu Leu 340
345 350Phe Cys Pro Ser Lys Asn Trp Cys Glu Lys
Leu Ala Asp Ile Ile Ala 355 360
365Arg Glu Phe Tyr Ser Leu Gln Gln Ala Glu Ser Ser Ala Lys Asn Ser 370
375 380Ser Leu Ser Pro Val Val Val Asp
Arg Glu Gly Ile Asp Glu Val Leu385 390
395 400Asp Gln Leu Arg Arg Ser Leu Ser Gly Leu Asp Ser
Val Leu Gln Arg 405 410
415Thr Leu Pro Trp Gly Val Ala Phe His His Ala Gly Leu Thr Phe Asp
420 425 430Glu Arg Asp Ile Ile Glu
Gly Ala Phe Arg Gln Ser Thr Ile Arg Val 435 440
445Leu Ala Ala Thr Ser Thr Leu Ser Ser Gly Val Asn Leu Pro
Ala Arg 450 455 460Arg Val Ile Ile Arg
Thr Pro Met Phe Gly Gly Thr Leu Leu Asp Val465 470
475 480Leu Thr Tyr Lys Gln Met Ala Gly Arg Ala
Gly Arg Lys Gly Val Asp 485 490
495Thr Glu Gly Glu Ser Ile Leu Val Cys Lys Pro Ser Glu Arg Ser Lys
500 505 510Gly Thr Ala Leu Leu
Gln Gly Ser Leu Lys Pro Val Arg Ser Cys Leu 515
520 525Leu Arg Lys Glu Gly Glu Gly Val Ala Ser Ser Met
Lys Arg Ala Ile 530 535 540Leu Glu Ile
Ile Val Ser Gly Val Ala Asn Thr Pro Asp Asp Val Gln545
550 555 560Thr Tyr Ala Ser Cys Thr Leu
Leu Ala Ser Ser Leu Lys Asp Asn Lys 565
570 575Arg Glu Asn Glu Lys Glu Gln Asp Lys Val Gln Thr
Gly Pro Ile Glu 580 585 590Ala
Cys Ile Ala Trp Leu Leu Glu Asn Glu Phe Ile Gln Val Leu Glu 595
600 605Arg Ala Asp Asp Lys Lys Ala Lys Ile
Phe His Pro Thr His Leu Gly 610 615
620Ser Ala Thr Leu Ser Ser Ser Leu Ser Pro Thr Glu Ala Met Glu Ile625
630 635 640Phe Ser Asp Leu
Gln Arg Ala Met Lys Ser Phe Val Leu Glu Asn Asp 645
650 655Leu His Ile Val Tyr Leu Val Thr Pro Val
Tyr Glu Asp Trp Thr Thr 660 665
670Ile Asp Trp Tyr Gln Phe Phe Cys Leu Trp Glu Lys Leu Pro Ala Ser
675 680 685Met Lys Arg Val Ala Glu Leu
Val Gly Ile Glu Glu Gly Phe Leu Ala 690 695
700Arg Ser Val Lys Gly Lys Ile Thr Ala Lys Thr Glu Lys Gln Tyr
Arg705 710 715 720Gln Met
Ala Ile His Lys Arg Phe Phe Thr Ser Leu Ala Leu Leu Asp
725 730 735Leu Ile Ser Glu Val Pro Leu
Lys Asp Met Thr Lys Lys Tyr Gly Cys 740 745
750Ser Arg Gly Gln Leu Gln Ser Leu Gln Gln Ser Ala Ala Thr
Tyr Ala 755 760 765Gly Met Val Thr
Val Phe Cys Asn Arg Leu Gly Trp His Asn Met Glu 770
775 780Leu Leu Leu Ser Gln Phe Gln Ser Arg Leu Thr Phe
Gly Val His Arg785 790 795
800Glu Leu Cys Asp Leu Val Arg Val Ser Leu Leu Asn Ala Gln Arg Ala
805 810 815Arg Met Leu Tyr Asn
Ala Gly Phe Val Thr Val Ala Asp Leu Ala Lys 820
825 830Ala Ser Pro Gly Asp Val Ala Thr Ala Leu Lys Asn
Ser Val Pro Phe 835 840 845Lys Ser
Gly Arg Arg Ala Val Asp Glu Asp Glu Glu Ser Val Glu Glu 850
855 860Arg Arg Thr Val Arg Ser Ile Trp Met Ala Gly
Met Lys Gly Leu Thr865 870 875
880Glu Ser Glu Ala Ala Ser Leu Ile Val Glu Glu Ala Arg Glu Leu Leu
885 890 895His Gln Asp Leu
Ala Ala Met Gly Val Gln Trp Asn Pro Glu Ser Phe 900
905 910Leu Glu Thr Ser Ser Met Ile Ser Ser Glu Ser
Glu Met Glu Asp Arg 915 920 925Leu
His Lys Pro Asp Gly Glu Leu Ser Ser Glu Ser Ser Val Met Leu 930
935 940Asn Lys Lys Glu Cys Arg Val Gln Asn His
Lys Gly Leu Gly Ser Gln945 950 955
960Ala Gly Asn Leu Ser Asn Ile Lys Lys Gly Tyr Lys Arg Arg Leu
Ser 965 970 975Ser Ser Thr
Ala Ser Ser Arg Phe Glu Ser Glu Val Ile Tyr Arg Lys 980
985 990Gln Ala Gln Ala Asp Glu Arg Asn Asp Asp
Thr Val His Ser Ala Arg 995 1000
1005Lys Gln Pro Asn Met Ser Arg Gly Asn Glu Asn Val Lys Gly Ile
1010 1015 1020Leu Lys Val Glu Asn Lys
Ala Asp Ser Glu Arg Ala Ser Pro Glu 1025 1030
1035Val His Thr Glu Gln Gly Lys Thr Pro Thr Leu Ala Lys Met
Ser 1040 1045 1050Ser Ala Ser Arg Leu
Leu Arg Ser Glu Asp Thr Arg Leu Asn Gln 1055 1060
1065Thr Arg Asn Lys Asn Thr Ser Ser Lys Leu Gln Lys Ser
Leu Leu 1070 1075 1080Glu Asp Ser Ser
Met Val Ile Met Asp Ile Lys Lys Pro Ser Ala 1085
1090 1095Phe Leu Pro Ser Ile Ser Lys Gly Asn Leu Phe
Ser Asp Gln Asn 1100 1105 1110Asn Lys
Glu Cys Ile Glu Glu Val Ser Ala Thr His Lys Val Ser 1115
1120 1125Asn Ser Val Gln Met Arg Ala Asn Asn Val
Gly Thr Lys Gly Lys 1130 1135 1140Met
Glu Ser Ile Phe Thr Glu Leu Ser Asn Ser Asn Glu Asp Met 1145
1150 1155Pro Met Glu Arg Ala Gly Phe Gln Ala
Thr Ala Thr Leu Gln Ser 1160 1165
1170Ile Pro His Ile Asn Lys Glu Thr His Asp Thr Val Glu Ser Pro
1175 1180 1185Val Ile Pro Ser Arg Ala
Arg Ile Gln Arg Asn Lys Thr Thr Ala 1190 1195
1200Asp Lys Gln Asn Lys Ile Asn Lys Met Gln Thr Asp Val Ser
Phe 1205 1210 1215Ala Glu Leu Lys Val
Asp Asn Gln His Thr Ala Leu Asp Ala Gly 1220 1225
1230His Cys Asn Val Asn Thr Asn Cys Ser Gly Asn Val Cys
Val His 1235 1240 1245Lys Gly Ser Arg
Lys Gln Lys Ser Val Tyr Phe Cys Pro Ser Gly 1250
1255 1260Asp Lys Phe Tyr His Ala Gln Ile Gln Asn Gly
Gly Ile Asn Gly 1265 1270 1275Lys Lys
Ile Pro Asn Gly Lys Leu Leu Gln Asp Glu Ala Leu Gln 1280
1285 1290Lys Gly Asn Ser His Pro Lys Asp Phe Leu
Lys Asp Ser Leu Val 1295 1300 1305Lys
Ser Lys Ser Ile Cys Asp Ala Asp Asp Ile Gln Asn Gly Pro 1310
1315 1320Ser Ser Arg Leu Ile Cys Val Ser Met
Asp Phe Glu Asp Ser Phe 1325 1330
1335Gln Leu Asp Thr Gln Thr Glu Gly Ile Ile Lys Gln Glu Ala Ala
1340 1345 1350Ala Glu Ile Thr Arg Gln
Gln Gly Ile Gln Asp Pro Glu Leu Ser 1355 1360
1365Val Ala Pro Gln Gln Glu Ile Ser Met Asn Thr Ser Thr Leu
Gln 1370 1375 1380Ala Gly Asn Ala Thr
Gly Glu Arg Leu Asp Ala Thr Val Arg Lys 1385 1390
1395Leu Gly Leu Ser Ser Ile Ile Thr Thr Asn Asn Val Met
Lys Asn 1400 1405 1410Thr Asp His His
Cys Ser Asn Lys Val Leu Glu Ser Gly Asp Leu 1415
1420 1425Ser Val Gln Pro Val Ala Lys Glu Ile Ala Ser
Val Pro Val Leu 1430 1435 1440Lys Gly
Ser Asp Tyr Ser Val Thr Asp Ser Gln Leu Asn Ser Phe 1445
1450 1455Leu Gln Tyr Tyr His Thr Gln Asn Ser Val
Lys Gly Glu Ser Ala 1460 1465 1470Ser
Asn Ser Pro Asn Lys Ala Thr Cys Pro Leu Asp Arg Glu His 1475
1480 1485Phe Val Glu Asp Glu His His Pro Val
Met Glu Thr Ser Leu Asn 1490 1495
1500Thr Ser Asp Gly Leu Leu Phe Asp Asp Ser Phe Ser Asn Val Ser
1505 1510 1515Asp Leu Ser Ala Val Asn
Ile Met Glu Ala Asp Arg Lys Glu Pro 1520 1525
1530Glu Gly Arg Gln Gly Ala Ser Leu Pro Ala Gly Gly Leu Leu
Gln 1535 1540 1545Asn Leu Arg Pro Val
Gln Asn Lys Ser Tyr Val Ser Asp Asn Arg 1550 1555
1560Arg Glu His Glu Asp Pro Ala Gln Asn Asn Asp Thr Ser
Leu Val 1565 1570 1575Phe Ser Glu Leu
Ile Ala Glu Val Leu Asp His Ala Asn Ser Pro 1580
1585 1590Thr Phe Leu Gly Asp Leu Pro Cys Thr Ser His
Ser Gln Ser Lys 1595 1600 1605Leu Arg
Asn Met Glu Ile Cys Glu Asn Asp Ser Asn Pro Lys Asp 1610
1615 1620Leu Glu Val Asp His Gly Lys Lys Leu Gln
Cys Ser Gln Gln Met 1625 1630 1635Leu
Ala Lys Lys Thr His Pro Leu Ala Trp Thr Asn His Ser Phe 1640
1645 1650Glu Leu Ser Pro Gly Leu Gln Asp Val
Leu Asp Lys Trp Pro Ser 1655 1660
1665Pro Ser Gly Thr Gly Leu Ala Gln Val Asn Val Arg Ser Ser Cys
1670 1675 1680Leu Lys Glu Asn Leu Ala
Val Ser Phe Ala Asn Gln Glu Pro Asp 1685 1690
1695Ala Val Phe Glu Phe Asp His His Gln Leu Glu Pro Leu Pro
Ser 1700 1705 1710Cys Gln Asp Leu Lys
Asp Cys Cys Glu Val Lys Glu Asn Lys Thr 1715 1720
1725Arg Asp Leu Asp Ile Gln Lys Ser Asp Cys Val Thr Leu
Met Leu 1730 1735 1740Arg Gly Ser Asn
Arg Thr Ser Tyr Pro Pro Pro Asp Asn Cys Asn 1745
1750 1755Gly Phe Val Pro Pro Thr Pro Pro Lys Glu Leu
Phe Pro Lys Ser 1760 1765 1770Ser Val
Ser Phe Ser Glu Lys Ser Ala Arg Lys Arg Gln Ile Ala 1775
1780 1785Ser Met Asn Glu Glu Gln Leu Val Leu Pro
Gln His Asn Cys Lys 1790 1795 1800Thr
Asp Ala Glu Gln Gln Ile Val Glu Arg Val Ala Ser Thr Glu 1805
1810 1815Ala Asp Glu Ile Glu Asp Asp Ser Thr
Ile Asp Lys Asp Phe Ser 1820 1825
1830Leu Gln Leu Ser Gln Asp Val Phe Pro Leu Thr Pro Ser Ser Thr
1835 1840 1845Glu Gly Phe Thr Ile Val
Asp Val Ala Gly Asp Lys Thr Leu Phe 1850 1855
1860Gln Thr Phe Leu Ala Glu Trp Lys Glu Lys Ser Arg Phe Ser
Ile 1865 1870 1875Ser Val Ala Cys Glu
Arg Arg Lys Cys Leu Leu Leu Thr Lys Ser 1880 1885
1890Thr Ile Gly Gly Arg Phe Lys Gln Gly Asn Ser Pro Gln
Arg Met 1895 1900 1905Gln Val Lys Asp
Asp Gly Phe Pro Ile Gln His Cys Glu Asp Thr 1910
1915 1920Leu Val Val Gly Leu Ala Val Cys Trp Gly Gly
Lys Asp Ala Tyr 1925 1930 1935Tyr Ile
Ser Leu Gln Gln Met Gln Asp Gln Thr Glu Ile Cys Pro 1940
1945 1950Ser Leu Ala Pro Pro Pro Leu Asp Lys Asn
Leu Ser Val Thr Glu 1955 1960 1965Arg
Leu Arg His Leu Gln Leu Tyr Leu Gln Glu Lys Gln Glu Arg 1970
1975 1980Ser Leu Val Met Tyr Asn Phe Ile Gln
His Tyr Lys Thr Leu Val 1985 1990
1995Met Ala Cys Gly Ile Ser Leu Glu Gly Ser Phe Glu Asp Pro Lys
2000 2005 2010Val Ala Cys Trp Leu Leu
Asp Ser Gly Ser Lys Glu Cys Thr Leu 2015 2020
2025His Asn Met Val Thr Asn Phe Leu Pro Asn Glu Leu Pro Leu
Leu 2030 2035 2040Glu Gly Val Gly Thr
Gly Gln Gly Val Gln Ser Leu Gly Leu Ser 2045 2050
2055Ser Ser Glu Asp His Ser Gly Arg Tyr Arg Ala Ala Ile
Glu Ser 2060 2065 2070Val Leu Ile Phe
Asn Ile Met Asn Gln Leu His Ser Glu Leu Arg 2075
2080 2085Lys Glu Asn Leu Thr Asp Val Phe Ser Lys Val
Glu Met Pro Asn 2090 2095 2100His Tyr
Cys Leu Ala Leu Leu Glu Leu Asn Gly Ile Gly Phe Ser 2105
2110 2115Thr Ala Ala Tyr Glu Thr Gln Lys Gln Val
Met Gln Ala Lys Leu 2120 2125 2130Thr
Glu Ile Glu Thr Lys Ala Tyr Gln Leu Ala Gly His Ser Phe 2135
2140 2145Ser Leu Thr Ser Pro Asp Asp Val Ala
Glu Val Leu Phe Leu Glu 2150 2155
2160Leu Lys Leu Pro Gln Asn Gly Asp Val Lys Val Gln Gly Asn Lys
2165 2170 2175Lys Thr Leu Gly Tyr Thr
Arg Arg Thr Ser Ile Lys Gly Asn Arg 2180 2185
2190Val Arg Leu Ser Lys Gln Phe Ser Thr Thr Lys Asp Val Leu
Glu 2195 2200 2205Lys Leu Lys Pro Leu
His Pro Leu Pro Gly Leu Ile Leu Glu Trp 2210 2215
2220Arg Arg Ile Asn Ser Ala Ile Ser Lys Val Val Phe Pro
Leu Gln 2225 2230 2235Arg Glu Lys Arg
Phe Asn Ser Ala Leu Gly Met Glu Arg Ile Tyr 2240
2245 2250Pro Val Ser Gln Thr His Thr Ala Thr Gly Arg
Val Ser Phe Ala 2255 2260 2265Glu Pro
Asn Ile Gln Asn Val Pro Arg Asp Phe Glu Ile Glu Met 2270
2275 2280Pro Ile Val Val Glu Glu Ser Pro Pro Phe
Arg Thr His Val Tyr 2285 2290 2295Ser
Cys Ala Val Ser Arg Ser Leu Leu Asn Phe Glu Arg Gly Leu 2300
2305 2310Gly Arg Lys His Ser Ser Val Leu Pro
Ser Gly Val Asn Thr Trp 2315 2320
2325Thr Ala Asp Arg Thr Glu Arg Arg Gly Ile Pro Phe Phe Val Ser
2330 2335 2340Met Arg His Ala Phe Val
Pro Phe Pro Gly Gly Phe Ile Leu Ala 2345 2350
2355Ala Asp Tyr Cys Gln Leu Glu Leu Arg Ile Leu Ala His Phe
Ser 2360 2365 2370Arg Asp Cys Arg Leu
Ile Glu Ala Phe Asn Lys Gly Ala Asp Val 2375 2380
2385Phe Lys Ser Ile Ala Ala Glu Trp Lys Met Ile Asp Ser
Glu Ala 2390 2395 2400Val Gly Asp Ser
Thr Arg Gln Gln Ala Lys Gln Ile Cys Tyr Gly 2405
2410 2415Ile Ile Tyr Gly Ile Gly Ala Lys Ser Leu Gly
Glu Gln Met Gly 2420 2425 2430Ile Asp
Asp Asn Lys Ala Ala Asn Tyr Ile Glu Ser Phe Lys Ser 2435
2440 2445Arg Tyr Thr Gly Ile Gln Lys Phe Leu Lys
Glu Thr Val Ser Asn 2450 2455 2460Cys
Arg Arg Asp Gly Phe Val Gln Thr Ile Leu Gly Arg Arg Arg 2465
2470 2475Tyr Leu Pro Ala Ile Arg Asp Ser Asn
Pro Tyr Ile Lys Ala His 2480 2485
2490Ala Glu Arg Gln Ala Val Asn Thr Thr Val Gln Gly Ser Ala Ala
2495 2500 2505Asp Ile Val Lys Thr Ala
Thr Val Asn Ile Gln Arg Arg Leu Glu 2510 2515
2520Ala Leu Ser Ser Val Asn Lys Ser His Gly His Leu Glu Asn
Ser 2525 2530 2535Phe Gln Arg Asp Lys
Thr Gly Arg Leu Ser Arg Lys Arg Asn Arg 2540 2545
2550Glu Met Leu His Pro Ile Ser Gly Gly Phe Phe Ile Leu
Gln Leu 2555 2560 2565His Asp Glu Leu
Leu Tyr Glu Val Ala Glu Asp Asp Val Ile Gln 2570
2575 2580Val Ala Gln Ile Val Lys His Glu Met Glu Asn
Ala Val Lys Leu 2585 2590 2595Ser Val
Lys Leu Asn Val Lys Val Lys Ile Gly Pro Ser Trp Gly 2600
2605 2610Glu Leu Gln Asp Leu Glu Leu 2615
262040576PRTCanis familiaris 40Met Ala Tyr Pro Arg Pro Gly Tyr
Gln Glu Glu Ala Glu Lys Lys Arg1 5 10
15Ser Thr Ile Ser His Asp Phe Ile Gln Ser Tyr Lys Ile Leu
Leu Leu 20 25 30Ser Cys Gly
Ile Ser Leu Glu Gln Ser Tyr Glu Asp Pro Lys Val Ala 35
40 45Cys Trp Leu Leu Asp Pro Asp Ser Lys Glu Pro
Thr Leu His Ser Ile 50 55 60Val Ser
Ser Phe Leu Pro His Glu Leu Leu Leu Leu Glu Gly Ile Glu65
70 75 80Thr Gly Gln Gly Ile Gln Ser
Leu Gly Leu Asn Val Asn Thr Glu His 85 90
95Ser Gly Arg Tyr Arg Ala Ser Val Glu Ser Ile Leu Ala
Phe Asn Ala 100 105 110Met Asn
Gln Leu Asn Ser Leu Leu Lys Lys Glu Asn Leu Gln Asp Val 115
120 125Phe Cys Lys Val Glu Met Pro Ser Gln Tyr
Cys Leu Ala Leu Leu Glu 130 135 140Leu
Asn Gly Ile Gly Phe Ser Thr Thr Glu Cys Glu Ser Gln Lys His145
150 155 160Ile Met Gln Ala Lys Leu
Asp Ala Ile Glu Ile Gln Ala Tyr Gln Leu 165
170 175Ala Gly His Ser Phe Ser Phe Thr Ser Ser Asp Asp
Ile Ala Glu Asp 180 185 190Val
Leu Asn Lys Leu Lys Ala Leu His Pro Leu Pro Gly Leu Ile Leu 195
200 205Glu Trp Arg Arg Ile Thr Asn Ala Ile
Thr Lys Val Val Phe Pro Leu 210 215
220Gln Arg Glu Lys Arg Leu Asn Pro Phe Leu Gly Met Glu Arg Ile Tyr225
230 235 240Pro Val Ser Gln
Ser His Thr Ala Thr Gly Arg Ile Thr Phe Met Glu 245
250 255Pro Asn Ile Gln Asn Val Pro Arg Asp Phe
Glu Ile Lys Met Pro Ile 260 265
270Leu Val Gly Glu Ser Pro Pro Ser Gln Ala Leu Ala Lys Gly Leu Leu
275 280 285Pro Val Tyr Gly Arg Gly Arg
Gly Lys Arg Ser Cys Gly Pro Asn Ser 290 295
300Gly His Gln Ala Gln Val Glu Glu Arg Ala Ser Asp Gln Gly Met
Pro305 310 315 320Phe Ser
Val Ser Met Arg His Ala Phe Val Pro Phe Ser Gly Gly Leu
325 330 335Ile Leu Ala Ala Asp Tyr Ser
Gln Leu Glu Leu Arg Ile Leu Ala His 340 345
350Leu Ser His Asp Arg Arg Leu Ile Gln Val Leu Asn Thr Gly
Ala Asp 355 360 365Val Phe Arg Ser
Ile Ala Ala Glu Trp Lys Met Ile Glu Pro Glu Ser 370
375 380Val Gly Asp Asp Leu Arg Gln Gln Ala Lys Gln Ile
Cys Tyr Gly Ile385 390 395
400Ile Tyr Gly Met Gly Ala Lys Ser Leu Gly Glu Gln Met Gly Ile Lys
405 410 415Glu Asn Asp Ala Ala
Cys Tyr Ile Glu Ser Phe Lys Ser Arg Tyr Thr 420
425 430Gly Ile Asn His Phe Met Arg Glu Thr Val Lys Asn
Cys Lys Arg Asn 435 440 445Gly Phe
Val Gln Thr Ile Leu Gly Arg Arg Arg Tyr Leu Pro Gly Ile 450
455 460Asn Asp Asn Asn Pro Tyr His Lys Ala His Gly
Lys His Ser His Gly465 470 475
480Gln Tyr Ile Asn Asp Cys Asp Cys Ile Pro Ile Arg Pro Tyr Leu Gln
485 490 495Lys Gln Glu Leu
Ser Gln Ile Trp Pro Glu Gly Leu Pro Thr Ser Gly 500
505 510Pro Thr Val Pro Ser Leu Asn Ala Glu Arg Gln
Ala Ile Asn Thr Thr 515 520 525Val
Gln Gly Ser Ala Ala Asp Ile Val Lys Ile Ala Thr Val Asn Ile 530
535 540Gln Lys Gln Leu Glu Thr Leu His Ser Thr
Phe Lys Ser His Gly His545 550 555
560Arg Glu Gly Met Leu Gln Ser Glu Arg Thr Asp Thr Leu Lys Glu
Ser 565 570
575412544PRTMus musculus 41Met Ser Leu Pro Arg Arg Ser Arg Lys Arg Arg
Arg Ser Ser Ser Gly1 5 10
15Ser Asp Thr Phe Ser Gly Asp Gly Asp Ser Phe Val Ser Pro Gln Leu
20 25 30Arg Cys Gly Pro Val Leu Ser
Pro Pro Pro Gly Leu Gly Arg Gly Arg 35 40
45Arg Leu Thr Gly Thr Gly Thr Asn Lys Arg Arg Val Ser Asp Asp
Gln 50 55 60Ile Asp Gln Leu Leu Leu
Ala Asn Trp Gly Leu Pro Lys Ala Val Leu65 70
75 80Glu Lys Tyr His Ser Phe Gly Val Arg Lys Met
Phe Glu Trp Gln Ala 85 90
95Glu Cys Leu Leu Leu Gly His Val Leu Glu Gly Lys Asn Leu Val Tyr
100 105 110Ser Ala Pro Thr Ser Ala
Gly Lys Thr Leu Val Ala Glu Leu Leu Ile 115 120
125Leu Lys Arg Val Leu Glu Thr Arg Lys Lys Ala Leu Phe Ile
Leu Pro 130 135 140Phe Val Ser Val Ala
Lys Glu Lys Lys Cys Tyr Leu Gln Ser Leu Phe145 150
155 160Gln Glu Val Gly Leu Lys Val Asp Gly Tyr
Met Gly Ser Thr Ser Pro 165 170
175Thr Gly Gln Phe Ser Ser Leu Asp Ile Ala Val Cys Thr Ile Glu Arg
180 185 190Ala Asn Gly Leu Val
Asn Arg Leu Ile Glu Glu Asn Lys Met Asp Leu 195
200 205Leu Gly Met Val Val Val Asp Glu Leu His Met Leu
Gly Asp Ser His 210 215 220Arg Gly Tyr
Leu Leu Glu Leu Leu Leu Thr Lys Ile Cys Tyr Val Thr225
230 235 240Arg Lys Ser Ala Ser His Gln
Ala Glu Ser Ala Ser Thr Leu Ser Asn 245
250 255Ala Val Gln Ile Val Gly Met Ser Ala Thr Leu Pro
Asn Leu Gln Leu 260 265 270Val
Ala Ser Trp Leu Asn Ala Glu Leu Tyr His Thr Asp Phe Arg Pro 275
280 285Val Pro Leu Leu Glu Ser Ile Lys Ile
Gly Asn Ser Ile Tyr Asp Ser 290 295
300Ser Met Lys Leu Val Arg Glu Phe Gln Pro Leu Leu Gln Val Lys Gly305
310 315 320Asp Glu Asp His
Ile Val Ser Leu Cys Tyr Glu Thr Ile Gln Asp Asn 325
330 335His Ser Val Leu Ile Phe Cys Pro Ser Lys
Lys Trp Cys Glu Lys Val 340 345
350Ala Asp Ile Ile Ala Arg Glu Phe Tyr Asn Leu His His Gln Pro Glu
355 360 365Gly Leu Val Lys Ser Ser Glu
Phe Pro Pro Val Ile Leu Asp Gln Lys 370 375
380Ser Leu Leu Glu Val Met Asp Gln Leu Lys Arg Ser Pro Ser Gly
Leu385 390 395 400Asp Ser
Val Leu Lys Asn Thr Val Pro Trp Gly Val Ala Phe His His
405 410 415Ala Gly Leu Thr Phe Glu Glu
Arg Asp Ile Ile Glu Gly Ala Phe Arg 420 425
430Gln Gly Phe Ile Arg Val Leu Ala Ala Thr Ser Thr Leu Ser
Ser Gly 435 440 445Val Asn Leu Pro
Ala Arg Arg Val Ile Ile Arg Thr Pro Ile Phe Ser 450
455 460Gly Gln Pro Leu Asp Ile Leu Thr Tyr Lys Gln Met
Val Gly Arg Ala465 470 475
480Gly Arg Lys Gly Val Asp Thr Met Gly Glu Ser Ile Leu Val Cys Lys
485 490 495Asn Ser Glu Lys Ser
Lys Gly Ile Ala Leu Leu Gln Gly Ser Leu Glu 500
505 510Pro Val His Ser Cys Leu Gln Arg Gln Gly Glu Val
Thr Ala Ser Met 515 520 525Ile Arg
Ala Ile Leu Glu Ile Ile Val Gly Gly Val Ala Ser Thr Ser 530
535 540Gln Asp Met Gln Thr Tyr Ala Ala Cys Thr Phe
Leu Ala Ala Ala Ile545 550 555
560Gln Glu Gly Lys Gln Gly Met Gln Arg Asn Gln Asp Asp Ala Gln Leu
565 570 575Gly Ala Ile Asp
Ala Cys Val Thr Trp Leu Leu Glu Asn Glu Phe Ile 580
585 590Gln Val Ala Glu Pro Gly Asp Gly Thr Gly Gly
Lys Val Tyr His Pro 595 600 605Thr
His Leu Gly Ser Ala Thr Leu Ser Ser Ser Leu Ser Pro Thr Asp 610
615 620Thr Leu Asp Ile Phe Ala Asp Leu Gln Arg
Ala Met Lys Gly Phe Val625 630 635
640Leu Glu Asn Asp Leu His Ile Val Tyr Leu Val Thr Pro Val Phe
Glu 645 650 655Asp Trp Ile
Ser Ile Asp Trp Tyr Arg Phe Phe Cys Leu Trp Glu Lys 660
665 670Leu Pro Thr Ser Met Lys Arg Val Ala Glu
Leu Val Gly Val Glu Glu 675 680
685Gly Phe Leu Ala Arg Cys Val Lys Gly Lys Val Val Ala Arg Thr Glu 690
695 700Arg Gln His Arg Gln Met Ala Ile
His Lys Arg Phe Phe Thr Ser Leu705 710
715 720Val Leu Leu Asp Leu Ile Ser Glu Ile Pro Leu Lys
Asp Ile Asn Gln 725 730
735Lys Tyr Gly Cys Asn Arg Gly Gln Ile Gln Ser Leu Gln Gln Ser Ala
740 745 750Ala Val Tyr Ala Gly Met
Ile Thr Val Phe Ser Asn Arg Leu Gly Trp 755 760
765His Asn Met Glu Leu Leu Leu Ser Gln Phe Gln Lys Arg Leu
Thr Phe 770 775 780Gly Ile Gln Arg Glu
Leu Cys Asp Leu Ile Arg Val Ser Leu Leu Asn785 790
795 800Ala Gln Arg Ala Arg Phe Leu Tyr Ala Ser
Gly Phe Leu Thr Val Ala 805 810
815Asp Leu Ala Arg Ala Asp Ser Ala Glu Val Glu Val Ala Leu Lys Asn
820 825 830Ser Leu Pro Phe Lys
Ser Ala Arg Lys Ala Val Asp Glu Glu Glu Glu 835
840 845Ala Ala Glu Glu Arg Arg Ser Met Arg Thr Ile Trp
Val Thr Gly Lys 850 855 860Gly Leu Ser
Ala Arg Glu Ala Ala Ala Leu Ile Val Glu Glu Ala Lys865
870 875 880Met Ile Leu Gln Gln Asp Leu
Ile Glu Met Gly Val Arg Trp Asp Pro 885
890 895Lys Ser Pro Leu Ser Ser Ser Thr His Ser Arg Thr
Ser Thr Ser Glu 900 905 910Val
Lys Glu His Thr Phe Lys Ser Gln Thr Lys Ser Ser His Lys Arg 915
920 925Leu Ala Ser Met Gly Arg Asn Ser Ile
Arg Ala Ser Gly Ser Asn Asp 930 935
940Lys Pro Ser Pro Asp Ala Glu Arg Gly Ile Asp Asp Cys Ser Glu His945
950 955 960Ala Asp Ser Leu
Cys Lys Phe Gln Gly Asn Phe Glu Pro Gln Thr Pro 965
970 975Ser Ile Cys Thr Ala Arg Lys Arg Thr Ser
Leu Gly Ile Asn Lys Glu 980 985
990Met Leu Arg Lys Ser Leu Lys Glu Gly Lys Pro Ser Thr Lys Glu Val
995 1000 1005Leu Gln Thr Phe Ser Ser
Glu Lys Thr Arg Lys Thr Ala Leu Ser 1010 1015
1020Phe Ser Ser Glu Gln Val Asn Asn Thr Leu Pro Ser Gly Arg
Asp 1025 1030 1035Arg Lys Tyr Gln Lys
Lys Ser Trp Gly Ser Ser Pro Val Arg Asp 1040 1045
1050Ser Gly Met His Arg Gly Asp Leu Gln Gly Gln Thr Met
Cys Thr 1055 1060 1065Ser Ala Leu Cys
Glu Asp Ser Gln Lys Ser Leu Glu Glu Gln Asn 1070
1075 1080Ala Glu Phe Arg Ser Pro Gly Leu Phe Ala Lys
His Leu Pro Ser 1085 1090 1095Cys Ala
Lys Glu Lys Cys Lys Lys Pro Ser Leu Pro Leu Gln Arg 1100
1105 1110Gln Gln Ala Cys Ser Arg Arg Ser Thr Glu
Ser Cys Ala Ala Val 1115 1120 1125Gly
His Pro Ala Ala Gly Ser Ser Pro Ala Ala Ala Arg Asp Arg 1130
1135 1140Arg Gly Leu Ala Ala Arg Glu Thr Glu
Lys Gly Asn Glu Ala Leu 1145 1150
1155Thr Glu Asn Gly Gly Glu Ser Gln Leu Gln Asp Thr Tyr Pro Val
1160 1165 1170Ser Gln Tyr Leu Glu Tyr
His Ser Glu Lys His Thr Asn Thr Cys 1175 1180
1185Thr Arg Gln Lys Thr Leu Thr Glu Gly Gln Ala Gly Ser Ser
Tyr 1190 1195 1200Val Ala Arg Asp Ser
Asn Asp Ala Ala Pro Ile Lys Cys Glu Arg 1205 1210
1215Met Lys Leu Asn Ser Lys Asp Arg Asp Ser Asn Pro Cys
Arg Gln 1220 1225 1230Ala Leu Gly Ser
Tyr Thr Gly Arg Thr Glu Ala Leu Gln Ser Thr 1235
1240 1245Ala Lys Leu Gly Gln Ala Gly Gly Gln Cys Glu
Asn Leu Leu Asn 1250 1255 1260Ser Ser
Gly Val Gln Gly Lys Thr Gly Ala His Ala Thr Asn Arg 1265
1270 1275Thr Glu His Ser His Ala Ser Asn Pro Ala
Phe Cys Asp Phe Gly 1280 1285 1290Asp
Ser Leu Asp Leu Asp Thr Gln Ser Glu Glu Ile Ile Glu Gln 1295
1300 1305Met Ala Thr Glu Asn Thr Met Gln Gly
Ala Lys Ala Val Val Ile 1310 1315
1320Met Glu Glu Gly Ser Ala Met Gln Asn Lys Cys His Ser Thr Pro
1325 1330 1335Gly Asp Gln His Val Pro
Gly Ala Ala Asn Thr Asp His Val Asp 1340 1345
1350Ser Lys Lys Val Glu Ser Val Lys Ala Asn Thr Glu Lys Asn
Ile 1355 1360 1365Asn Arg Gly Ala Pro
Val Ser Leu Ile Phe His Thr Gln Gly Glu 1370 1375
1380Asn Gly Ala Cys Phe Lys Gly Asn Glu His Ser Val Thr
Asp Ser 1385 1390 1395Gln Leu Asn Ser
Phe Leu Gln Gly Phe Glu Thr Gln Glu Ile Val 1400
1405 1410Lys Pro Ile Ile Pro Leu Ala Pro Gln Met Arg
Thr Pro Thr Gly 1415 1420 1425Val Glu
Glu Glu Ser Leu Pro Glu Thr Ser Leu Asn Met Ser Asp 1430
1435 1440Ser Ile Leu Phe Asp Ser Phe Gly Glu Asp
Gly Phe Gly Gln Gly 1445 1450 1455Gln
Ser Pro Asp Ile Lys Ala Asn Gln Pro Leu Leu Ser Glu Met 1460
1465 1470Thr Pro Asn His Phe Ser Asn Pro Pro
His Pro Gln Glu Asp Pro 1475 1480
1485Val Met Thr Pro Thr Val Ser Glu Pro Gln Gly Thr Gln Gln Gln
1490 1495 1500Gly Val Cys Leu Ser Gly
Glu Ser Ile Ile Phe Ser Asp Ile Asp 1505 1510
1515Ser Ala Gln Val Ile Glu Ala Leu Asp Asn Met Ala Ala Phe
His 1520 1525 1530Val Gln Glu Asn Cys
Asn Ser Val Ala Leu Lys Thr Leu Glu Pro 1535 1540
1545Ser Asp Ser Ala Val Leu Gly Asn Glu Cys Pro Gln Gly
Lys Leu 1550 1555 1560Val Arg Gly Asp
Gln Asn Glu Gly Ser Pro Lys Pro Lys Leu Thr 1565
1570 1575Glu Thr Asn Gln Asp Asn Ser Phe Thr Trp Ser
Gly Ala Ser Phe 1580 1585 1590Asn Leu
Ser Pro Glu Leu Gln Arg Ile Leu Asp Lys Val Ser Ser 1595
1600 1605Pro Arg Glu Asn Glu Lys Pro Lys Met Ile
His Val Asn Leu Ser 1610 1615 1620Ser
Phe Glu Gly Asn Ser Lys Glu Ser His Glu Arg Glu Glu Ile 1625
1630 1635Asn Ser Asp Leu Gly Thr Val Gln Arg
Thr Ser Val Phe Pro Ser 1640 1645
1650Asn Glu Val Lys Asn Arg Thr Glu Gly Leu Glu Ser Lys Ala Arg
1655 1660 1665His Gly Gly Ala Ser Ser
Pro Leu Pro Arg Lys Glu Ser Ala Ala 1670 1675
1680Ala Asp Asp Asn Gly Leu Ile Pro Pro Thr Pro Val Pro Ala
Ser 1685 1690 1695Ala Ser Lys Val Ala
Phe Pro Glu Ile Leu Gly Thr Ser Val Lys 1700 1705
1710Arg Gln Lys Ala Ser Ser Ala Leu Gln Pro Gly Glu Ser
Cys Leu 1715 1720 1725Phe Gly Ser Pro
Ser Asp Asn Gln Asn Gln Asp Leu Ser Gln Glu 1730
1735 1740Leu Arg Asp Ser Leu Lys Asp Tyr Asp Gly Ser
Val Ala Asp Thr 1745 1750 1755Ser Phe
Phe Leu Gln Ser Gln Asp Gly Leu Leu Leu Thr Gln Ala 1760
1765 1770Ser Cys Ser Ser Glu Ser Leu Ala Ile Ile
Asp Val Ala Ser Asp 1775 1780 1785Gln
Ile Leu Phe Gln Thr Phe Val Lys Glu Trp Gln Cys Gln Lys 1790
1795 1800Arg Phe Ser Ile Ser Leu Ala Cys Glu
Lys Met Thr Ser Ser Met 1805 1810
1815Ser Ser Lys Thr Ala Thr Ile Gly Gly Lys Leu Lys Gln Val Ser
1820 1825 1830Leu Pro Gln Glu Ala Thr
Val Glu Asp Ala Gly Phe Pro Val Arg 1835 1840
1845Gly Cys Asp Gly Ala Val Val Val Gly Leu Ala Val Cys Trp
Gly 1850 1855 1860Ala Lys Asp Ala Tyr
Tyr Leu Ser Leu Gln Lys Glu Gln Lys Gln 1865 1870
1875Ser Glu Ile Ser Pro Ser Leu Ala Pro Pro Pro Leu Asp
Ala Thr 1880 1885 1890Leu Thr Val Lys
Glu Arg Met Glu Cys Leu Gln Ser Cys Leu Gln 1895
1900 1905Lys Lys Ser Asp Arg Glu Arg Ser Val Val Thr
Tyr Asp Phe Ile 1910 1915 1920Gln Thr
Tyr Lys Val Leu Leu Leu Ser Cys Gly Ile Ser Leu Glu 1925
1930 1935Pro Ser Tyr Glu Asp Pro Lys Val Ala Cys
Trp Leu Leu Asp Pro 1940 1945 1950Asp
Ser Lys Glu Pro Thr Leu His Ser Ile Val Thr Ser Phe Leu 1955
1960 1965Pro His Glu Leu Ala Leu Leu Glu Gly
Met Glu Thr Gly Pro Gly 1970 1975
1980Ile Gln Ser Leu Gly Leu Asn Val Asn Thr Glu His Ser Gly Arg
1985 1990 1995Tyr Arg Ala Ser Val Glu
Ser Val Leu Ile Phe Asn Ser Met Asn 2000 2005
2010Gln Leu Asn Ser Leu Leu Gln Lys Glu Asn Leu His Asp Ile
Phe 2015 2020 2025Cys Lys Val Glu Met
Pro Ser Gln Tyr Cys Leu Ala Leu Leu Glu 2030 2035
2040Leu Asn Gly Ile Gly Phe Ser Thr Ala Glu Cys Glu Ser
Gln Lys 2045 2050 2055His Val Met Gln
Ala Lys Leu Asp Ala Ile Glu Thr Gln Ala Tyr 2060
2065 2070Gln Leu Ala Gly His Ser Phe Ser Phe Thr Ser
Ala Asp Asp Ile 2075 2080 2085Ala Gln
Val Leu Phe Leu Glu Leu Lys Leu Pro Pro Asn Gly Glu 2090
2095 2100Met Lys Thr Gln Gly Ser Lys Lys Thr Leu
Gly Ser Thr Arg Arg 2105 2110 2115Gly
Asn Glu Ser Gly Arg Arg Met Arg Leu Gly Arg Gln Phe Ser 2120
2125 2130Thr Ser Lys Asp Ile Leu Asn Lys Leu
Lys Gly Leu His Pro Leu 2135 2140
2145Pro Gly Leu Ile Leu Glu Trp Arg Arg Ile Ser Asn Ala Ile Thr
2150 2155 2160Lys Val Val Phe Pro Leu
Gln Arg Glu Lys His Leu Asn Pro Leu 2165 2170
2175Leu Arg Met Glu Arg Ile Tyr Pro Val Ser Gln Ser His Thr
Ala 2180 2185 2190Thr Gly Arg Ile Thr
Phe Thr Glu Pro Asn Ile Gln Asn Val Pro 2195 2200
2205Arg Asp Phe Glu Ile Lys Met Pro Thr Leu Val Arg Glu
Ser Pro 2210 2215 2220Pro Ser Gln Ala
Pro Lys Gly Arg Phe Pro Met Ala Ile Gly Gln 2225
2230 2235Asp Lys Lys Val Tyr Gly Leu His Pro Gly His
Arg Thr Gln Met 2240 2245 2250Glu Glu
Lys Ala Ser Asp Arg Gly Val Pro Phe Ser Val Ser Met 2255
2260 2265Arg His Ala Phe Val Pro Phe Pro Gly Gly
Leu Ile Leu Ala Ala 2270 2275 2280Asp
Tyr Ser Gln Leu Glu Leu Arg Ile Leu Ala His Leu Ser Arg 2285
2290 2295Asp Cys Arg Leu Ile Gln Val Leu Asn
Thr Gly Ala Asp Val Phe 2300 2305
2310Arg Ser Ile Ala Ala Glu Trp Lys Met Ile Glu Pro Asp Ala Val
2315 2320 2325Gly Asp Asp Leu Arg Gln
His Ala Lys Gln Ile Cys Tyr Gly Ile 2330 2335
2340Ile Tyr Gly Met Gly Ala Lys Ser Leu Gly Glu Gln Met Gly
Ile 2345 2350 2355Lys Glu Asn Asp Ala
Ala Ser Tyr Ile Asp Ser Phe Lys Ser Arg 2360 2365
2370Tyr Lys Gly Ile Asn His Phe Met Arg Asp Thr Val Lys
Asn Cys 2375 2380 2385Arg Lys Asn Gly
Phe Val Glu Thr Ile Leu Gly Arg Arg Arg Tyr 2390
2395 2400Leu Pro Gly Ile Lys Asp Asp Asn Pro Tyr His
Lys Ala His Ala 2405 2410 2415Glu Arg
Gln Ala Ile Asn Thr Thr Val Gln Gly Ser Ala Ala Asp 2420
2425 2430Ile Val Lys Ile Ala Thr Val Asn Ile Gln
Lys Gln Leu Glu Thr 2435 2440 2445Phe
Arg Ser Thr Phe Lys Ser His Gly His Arg Glu Ser Met Leu 2450
2455 2460Gln Asn Asp Arg Thr Gly Leu Leu Pro
Lys Arg Lys Leu Lys Gly 2465 2470
2475Met Phe Cys Pro Met Arg Gly Gly Phe Phe Ile Leu Gln Leu His
2480 2485 2490Asp Glu Leu Leu Tyr Glu
Val Ala Glu Glu Asp Val Val Gln Val 2495 2500
2505Ala Gln Ile Val Lys Asn Glu Met Glu Cys Ala Ile Lys Leu
Ser 2510 2515 2520Val Lys Leu Lys Val
Lys Val Lys Ile Gly Ala Ser Trp Gly Glu 2525 2530
2535Leu Lys Asp Phe Asp Val 2540429DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
42tacagctat
9439DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 43agtcgactt
9449DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 44agtcgactg
9459DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
45agtcgatta
9469DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 46agtcgacta
9479DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 47agtcgactc
9489DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
48agtcgattg
9499DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 49agtaggctt
9509DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 50agtaggctg
9519DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
51agtaggtta
9529DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 52agtaggcta
9539DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 53agtaggctc
9549DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
54agtaggttg
9559DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 55agtcgtctt
9569DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 56agtcgtctg
9579DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
57agtcgttta
9589DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 58agtcgtcta
9599DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 59agtcgtctc
9609DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
60agtcgtttg
9619DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 61agtagactt
9629DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 62agtagactg
9639DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
63agtagatta
9649DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 64agtagacta
9659DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 65agtagactc
9669DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
66agtagattg
9679DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 67agtcggctt
9689DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 68agtcggctg
9699DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
69agtcggtta
9709DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 70agtcggcta
9719DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 71agtcggctc
9729DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
72agtcggttg
9739DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 73agtcgcctt
9749DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 74agtcgcctg
9759DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
75agtcgctta
9769DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 76agtcgccta
9779DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 77agtcgcctc
9789DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
78agtcgcttg
9799DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 79tcacgactt
9809DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 80tcacgactg
9819DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
81tcacgatta
9829DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 82tcacgacta
9839DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 83tcacgactc
9849DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
84tcacgattg
9859DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 85tcaaggctt
9869DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 86tcaaggctg
9879DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
87tcaaggtta
9889DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 88tcaaggcta
9899DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 89tcaaggctc
9909DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
90tcaaggttg
9919DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 91tcacgtctt
9929DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 92tcacgtctg
9939DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
93tcacgttta
9949DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 94tcacgtcta
9959DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 95tcacgtctc
9969DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
96tcacgtttg
9979DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 97tcaagactt
9989DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 98tcaagactg
9999DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
99tcaagatta
91009DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 100tcaagacta
91019DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 101tcaagactc
91029DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
102tcaagattg
91039DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 103tcacggctt
91049DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 104tcacggctg
91059DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
105tcacggtta
91069DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 106tcacggcta
91079DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 107tcacggctc
91089DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
108tcacggttg
91099DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 109tcacgcctt
91109DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 110tcacgcctg
91119DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
111tcacgctta
91129DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 112tcacgccta
91139DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 113tcacgcctc
91149DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
114tcacgcttg
91159DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 115agccgactt
91169DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 116agccgactg
91179DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
117agccgatta
91189DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 118agccgacta
91199DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 119agccgactc
91209DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
120agccgattg
91219DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 121agcaggctt
91229DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 122agcaggctg
91239DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
123agcaggtta
91249DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 124agcaggcta
91259DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 125agcaggctc
91269DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
126agcaggttg
91279DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 127agccgtctt
91289DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 128agccgtctg
91299DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
129agccgttta
91309DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 130agccgtcta
91319DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 131agccgtctc
91329DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
132agccgtttg
91339DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 133agcagactt
91349DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 134agcagactg
91359DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
135agcagatta
91369DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 136agcagacta
91379DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 137agcagactc
91389DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
138agcagattg
91399DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 139agccggctt
91409DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 140agccggctg
91419DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
141agccggtta
91429DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 142agccggcta
91439DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 143agccggctc
91449DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
144agccggttg
91459DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 145agccgcctt
91469DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 146agccgcctg
91479DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
147agccgctta
91489DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 148agccgccta
91499DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 149agccgcctc
91509DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
150agccgcttg
91519DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 151tcgcgactt
91529DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 152tcgcgactg
91539DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
153tcgcgatta
91549DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 154tcgcgacta
91559DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 155tcgcgactc
91569DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
156tcgcgattg
91579DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 157tcgaggctt
91589DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 158tcgaggctg
91599DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
159tcgaggtta
91609DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 160tcgaggcta
91619DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 161tcgaggctc
91629DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
162tcgaggttg
91639DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 163tcgcgtctt
91649DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 164tcgcgtctg
91659DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
165tcgcgttta
91669DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 166tcgcgtcta
91679DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 167tcgcgtctc
91689DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
168tcgcgtttg
91699DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 169tcgagactt
91709DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 170tcgagactg
91719DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
171tcgagatta
91729DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 172tcgagacta
91739DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 173tcgagactc
91749DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
174tcgagattg
91759DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 175tcgcggctt
91769DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 176tcgcggctg
91779DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
177tcgcggtta
91789DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 178tcgcggcta
91799DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 179tcgcggctc
91809DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
180tcgcggttg
91819DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 181tcgcgcctt
91829DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 182tcgcgcctg
91839DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
183tcgcgctta
91849DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 184tcgcgccta
91859DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 185tcgcgcctc
91869DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
186tcgcgcttg
91879DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 187tcccgactt
91889DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 188tcccgactg
91899DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
189tcccgatta
91909DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 190tcccgacta
91919DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 191tcccgactc
91929DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
192tcccgattg
91939DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 193tccaggctt
91949DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 194tccaggctg
91959DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
195tccaggtta
91969DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 196tccaggcta
91979DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 197tccaggctc
91989DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
198tccaggttg
91999DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 199tcccgtctt
92009DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 200tcccgtctg
92019DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
201tcccgttta
92029DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 202tcccgtcta
92039DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 203tcccgtctc
92049DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
204tcccgtttg
92059DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 205tccagactt
92069DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 206tccagactg
92079DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
207tccagatta
92089DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 208tccagacta
92099DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 209tccagactc
92109DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
210tccagattg
92119DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 211tcccggctt
92129DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 212tcccggctg
92139DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
213tcccggtta
92149DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 214tcccggcta
92159DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 215tcccggctc
92169DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
216tcccggttg
92179DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 217tcccgcctt
92189DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 218tcccgcctg
92199DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
219tcccgctta
92209DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 220tcccgccta
92219DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 221tcccgcctc
92229DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
222tcccgcttg
92239DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 223tctcgactt
92249DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 224tctcgactg
92259DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
225tctcgatta
92269DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 226tctcgacta
92279DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 227tctcgactc
92289DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
228tctcgattg
92299DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 229tctaggctt
92309DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 230tctaggctg
92319DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
231tctaggtta
92329DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 232tctaggcta
92339DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 233tctaggctc
92349DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
234tctaggttg
92359DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 235tctcgtctt
92369DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 236tctcgtctg
92379DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
237tctcgttta
92389DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 238tctcgtcta
92399DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 239tctcgtctc
92409DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
240tctcgtttg
92419DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 241tctagactt
92429DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 242tctagactg
92439DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
243tctagatta
92449DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 244tctagacta
92459DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 245tctagactc
92469DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
246tctagattg
92479DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 247tctcggctt
92489DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 248tctcggctg
92499DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
249tctcggtta
92509DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 250tctcggcta
92519DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 251tctcggctc
92529DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
252tctcggttg
92539DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 253tctcgcctt
92549DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 254tctcgcctg
92559DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
255tctcgctta
92569DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 256tctcgccta
92579DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 257tctcgcctc
92589DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
258tctcgcttg
92599DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 259agtaggctt
92609DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 260agtaggctg
92619DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
261agtaggtta
92629DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 262agtaggcta
92639DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 263agcaggctt
92649DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
264agcaggctg
92659DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 265agcaggtta
92669DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 266agcaggcta
92679DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
267agcaggttg
92689DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 268agtaggttg
92696DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 269aactac
62706DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
270aacaac
62716DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 271tactac
62726DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 272tacaac
62736DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
273agctac
62746DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 274agcagc
62756DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 275tacagc
627632DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
276gactacctcg agccagctta ggctacacag ag
3227735DNAArtificial SequenceDescription of Artificial Sequence Synthetic
primer 277gtagtcgaat tcccacatgt cttacatggt atatg
3527832DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 278gactacgaat tctcctgagg
acacagtgat ag 3227936DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
279gtagtcgcgg ccgcctagtt cctagctact tcttta
3628052DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 280aattcaggtg ctggggtagg gagcaggtgc tacactgcag
accaggtgct gc 5228152DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 281ggccgcagca
cctggtctgc agtgtagcac ctgctcccta ccccagcacc tg 52282767DNAMus
sp. 282ccagcttagg ctacacagag aaactatcta aaaaataatt actaactact taataggaga
60ttggatgtta agatctggtc actaagaggc agaattgaga ttcgaagcca gtattttcta
120cctggtatgt tttaaattgc agtaaggatc taagtgtaga tatataataa taagattcta
180ttgatctctg caacaacaga gagtgttaga tttgtttgga aaaaaatatt atcagccaac
240atcttctacc atttcagtat agcacagagt acccacccat atctccccac ccatccccca
300taccagactg gttattgatt ttcatggtga ctggcctgag aagattaaaa aaagtaatgc
360taccttattg ggagtgtccc atggaccaag atagcaactg tcatagctac cgtcacactg
420ctttgatcaa gaagaccctt tgaggaactg aaaacagaac cttaggcaca tctgttgctt
480tcgctcccat cctcctccaa cagcctgggt ggtgcactcc acaccctttc aagtttccaa
540agcctcatac acctgctccc taccccagca cctggccaag gctgtatcca gcactgggat
600gaaaatgata ccccacctcc atcttgtttg atattactct atctcaagcc ccaggttagt
660ccccagtccc aatgcttttg cacagtcaaa actcaacttg gaataatcag tatccttgaa
720gagttctgat atggtcactg ggcccatata ccatgtaaga catgtgg
7672831251DNAMus sp. 283tcctgaggac acagtgatag gaacagagcc actaatctga
agagaacaga gatgtgacag 60actacactaa tgtgagaaaa acaaggaaag ggtgacttat
tggagatttc agaaataaaa 120tgcatttatt attatattcc cttattttaa ttttctatta
gggaattaga aagggcataa 180actgctttat ccagtgttat attaaaagct taatgtatat
aatcttttag aggtaaaatc 240tacagccagc aaaagtcatg gtaaatattc tttgactgaa
ctctcactaa actcctctaa 300attatatgtc atattaactg gttaaattaa tataaatttg
tgacatgacc ttaactggtt 360aggtaggata tttttcttca tgcaaaaata tgactaataa
taatttagca caaaaatatt 420tcccaatact ttaattctgt gatagaaaaa tgtttaactc
agctactata atcccataat 480tttgaaaact atttattagc ttttgtgttt gacccttccc
tagccaaagg caactattta 540aggacccttt aaaactcttg aaactacttt agagtcatta
agttatttaa ccacttttaa 600ttactttaaa atgatgtcaa ttccctttta actattaatt
tattttaagg ggggaaaggc 660tgctcataat tctattgttt ttcttggtaa agaactctca
gttttcgttt ttactacctc 720tgtcacccaa gagttggcat ctcaacagag gggactttcc
gagaggccat ctggcagttg 780cttaagatca gaagtgaagt ctgccagttc ctcccaggca
ggtggcccag attacagttg 840acctgttctg gtgtggctaa aaattgtccc atgtggttac
aaaccattag accagggtct 900gatgaattgc tcagaatatt tctggacacc caaatacaga
ccctggctta aggccctgtc 960catacagtag gtttagcttg gctacaccaa aggaagccat
acagaggcta ataccagagt 1020attcttggaa gagacaggag aaaatgaaag ccagtttctg
ctcttacctt atgtgcttgt 1080gttcagactc ccaaacatca ggagtgtcag ataaactggt
ctgaatctct gtctgaagca 1140tggaactgaa aagaatgtag tttcagggaa gaaaggcaat
agaaggaagc ctgagaatat 1200cttcaaaggg tcagactcaa tttactttct aaagaagtag
ctaggaacta g 125128467DNAHomo sapiens 284acagtgggag agaaggggcc
agggtataaa aagggcccac aagagaccag ctcaaggatt 60ccaaggc
6728557PRTLactococcus
lactis 285Met Ser Thr Lys Asp Phe Asn Leu Asp Leu Val Ser Val Ser Lys
Lys1 5 10 15Asp Ser Gly
Ala Ser Pro Arg Ile Thr Ser Ile Ser Leu Cys Thr Pro 20
25 30Gly Cys Lys Thr Gly Ala Leu Met Gly Cys
Asn Met Lys Thr Ala Thr 35 40
45Cys His Cys Ser Ile His Val Ser Lys 50
55286418PRTLactococcus lactis 286Met Arg Ile Met Met Asn Lys Lys Asn Ile
Lys Arg Asn Val Glu Lys1 5 10
15Ile Ile Ala Gln Trp Asp Glu Arg Thr Arg Lys Asn Lys Glu Asn Phe
20 25 30Asp Phe Gly Glu Leu Thr
Leu Ser Thr Gly Leu Pro Gly Ile Ile Leu 35 40
45Met Leu Ala Glu Leu Lys Asn Lys Asp Asn Ser Lys Ile Tyr
Gln Lys 50 55 60Lys Ile Asp Asn Tyr
Ile Glu Tyr Ile Val Ser Lys Leu Ser Thr Tyr65 70
75 80Gly Leu Leu Thr Gly Ser Leu Tyr Ser Gly
Ala Ala Gly Ile Ala Leu 85 90
95Ser Ile Leu His Leu Arg Glu Asp Asp Glu Lys Tyr Lys Asn Leu Leu
100 105 110Asp Ser Leu Asn Arg
Tyr Ile Glu Tyr Phe Val Arg Glu Lys Ile Glu 115
120 125Gly Phe Asn Leu Glu Asn Ile Thr Pro Pro Asp Tyr
Asp Val Ile Glu 130 135 140Gly Leu Ser
Gly Ile Leu Ser Tyr Leu Leu Leu Ile Asn Asp Glu Gln145
150 155 160Tyr Asp Asp Leu Lys Ile Leu
Ile Ile Asn Phe Leu Ser Asn Leu Thr 165
170 175Lys Glu Asn Asn Gly Leu Ile Ser Leu Tyr Ile Lys
Ser Glu Asn Gln 180 185 190Met
Ser Gln Ser Glu Ser Glu Met Tyr Pro Leu Gly Cys Leu Asn Met 195
200 205Gly Leu Ala His Gly Leu Ala Gly Val
Gly Cys Ile Leu Ala Tyr Ala 210 215
220His Ile Lys Gly Tyr Ser Asn Glu Ala Ser Leu Ser Ala Leu Gln Lys225
230 235 240Ile Ile Phe Ile
Tyr Glu Lys Phe Glu Leu Glu Arg Lys Lys Gln Phe 245
250 255Leu Trp Lys Asp Gly Leu Val Ala Asp Glu
Leu Lys Lys Glu Lys Val 260 265
270Ile Arg Glu Ala Ser Phe Ile Arg Asp Ala Trp Cys Tyr Gly Gly Pro
275 280 285Gly Ile Ser Leu Leu Tyr Leu
Tyr Gly Gly Leu Ala Leu Asp Asn Asp 290 295
300Tyr Phe Val Asp Lys Ala Glu Lys Ile Leu Glu Ser Ala Met Gln
Arg305 310 315 320Lys Leu
Gly Ile Asp Ser Tyr Met Ile Cys His Gly Tyr Ser Gly Leu
325 330 335Ile Glu Ile Cys Ser Leu Phe
Lys Arg Leu Leu Asn Thr Lys Lys Phe 340 345
350Asp Ser Tyr Met Glu Glu Phe Asn Val Asn Ser Glu Gln Ile
Leu Glu 355 360 365Glu Tyr Gly Asp
Glu Ser Gly Thr Gly Phe Leu Glu Gly Ile Ser Gly 370
375 380Cys Ile Leu Val Leu Ser Lys Phe Glu Tyr Ser Ile
Asn Phe Thr Tyr385 390 395
400Trp Arg Gln Ala Leu Leu Leu Phe Asp Asp Phe Leu Lys Gly Gly Lys
405 410 415Arg
Lys287993PRTLactococcus lactis 287Met Ile Lys Ser Ser Phe Lys Ala Gln Pro
Phe Leu Val Arg Asn Thr1 5 10
15Ile Leu Ser Pro Asn Asp Lys Arg Ser Phe Thr Glu Tyr Thr Gln Val
20 25 30Ile Glu Thr Val Ser Lys
Asn Lys Val Phe Leu Glu Gln Leu Leu Leu 35 40
45Ala Asn Pro Lys Leu Tyr Asn Val Met Gln Lys Tyr Asn Ala
Gly Leu 50 55 60Leu Lys Lys Lys Arg
Val Lys Lys Leu Phe Glu Ser Ile Tyr Lys Tyr65 70
75 80Tyr Lys Arg Ser Tyr Leu Arg Ser Thr Pro
Phe Gly Leu Phe Ser Glu 85 90
95Thr Ser Ile Gly Val Phe Ser Lys Ser Ser Gln Tyr Lys Leu Met Gly
100 105 110Lys Thr Thr Lys Gly
Ile Arg Leu Asp Thr Gln Trp Leu Ile Arg Leu 115
120 125Val His Lys Met Glu Val Asp Phe Ser Lys Lys Leu
Ser Phe Thr Arg 130 135 140Asn Asn Ala
Asn Tyr Lys Phe Gly Asp Arg Val Phe Gln Val Tyr Thr145
150 155 160Ile Asn Ser Ser Glu Leu Glu
Glu Val Asn Ile Lys Tyr Thr Asn Val 165
170 175Tyr Gln Ile Ile Ser Glu Phe Cys Glu Asn Asp Tyr
Gln Lys Tyr Glu 180 185 190Asp
Ile Cys Glu Thr Val Thr Leu Cys Tyr Gly Asp Glu Tyr Arg Glu 195
200 205Leu Ser Glu Gln Tyr Leu Gly Ser Leu
Ile Val Asn His Tyr Leu Ile 210 215
220Ser Asn Leu Gln Lys Asp Leu Leu Ser Asp Phe Ser Trp Asp Thr Phe225
230 235 240Leu Thr Lys Val
Glu Ala Ile Asp Glu Asp Lys Lys Tyr Ile Ile Pro 245
250 255Leu Lys Lys Val Gln Lys Phe Ile Gln Glu
Tyr Ser Glu Ile Glu Ile 260 265
270Gly Glu Gly Ile Glu Lys Leu Lys Glu Ile Tyr Gln Glu Met Ser Gln
275 280 285Ile Leu Glu Asn Asp Asn Tyr
Ile Gln Ile Asp Leu Ile Ser Asp Ser 290 295
300Glu Ile Asn Phe Asp Val Lys Gln Lys Gln Gln Leu Glu His Leu
Ala305 310 315 320Glu Phe
Leu Gly Asn Thr Thr Lys Ser Val Arg Arg Thr Tyr Leu Asp
325 330 335Asp Tyr Lys Asp Lys Phe Ile
Glu Lys Tyr Gly Val Asp Gln Glu Val 340 345
350Gln Ile Thr Glu Leu Phe Asp Ser Thr Phe Gly Ile Gly Ala
Pro Tyr 355 360 365Asn Tyr Asn His
Pro Arg Asn Asp Phe Tyr Glu Ser Glu Pro Ser Thr 370
375 380Leu Tyr Tyr Ser Glu Glu Glu Arg Glu Lys Tyr Leu
Ser Met Tyr Val385 390 395
400Glu Ala Val Lys Asn His Asn Val Ile Asn Leu Asp Asp Leu Glu Ser
405 410 415His Tyr Gln Lys Met
Asp Leu Glu Lys Lys Ser Glu Leu Gln Gly Leu 420
425 430Glu Leu Phe Leu Asn Leu Ala Lys Glu Tyr Glu Lys
Asp Ile Phe Ile 435 440 445Leu Gly
Asp Ile Val Gly Asn Asn Asn Leu Gly Gly Ala Ser Gly Arg 450
455 460Phe Ser Ala Leu Ser Pro Glu Leu Thr Ser Tyr
His Arg Thr Ile Val465 470 475
480Asp Ser Val Glu Arg Glu Asn Glu Asn Lys Glu Ile Thr Ser Cys Glu
485 490 495Ile Val Phe Leu
Pro Glu Asn Ile Arg His Ala Asn Val Met His Thr 500
505 510Ser Ile Met Arg Arg Lys Val Leu Pro Phe Phe
Thr Ser Thr Ser His 515 520 525Asn
Glu Val Gln Leu Thr Asn Ile Tyr Ile Gly Ile Asp Glu Lys Glu 530
535 540Lys Phe Tyr Ala Arg Asp Ile Ser Thr Gln
Glu Val Leu Lys Phe Tyr545 550 555
560Ile Thr Ser Met Tyr Asn Lys Thr Leu Phe Ser Asn Glu Leu Arg
Phe 565 570 575Leu Tyr Glu
Ile Ser Leu Asp Asp Lys Phe Gly Asn Leu Pro Trp Glu 580
585 590Leu Ile Tyr Arg Asp Phe Asp Tyr Ile Pro
Arg Leu Val Phe Asp Glu 595 600
605Ile Val Ile Ser Pro Ala Lys Trp Lys Ile Trp Gly Arg Asp Val Asn 610
615 620Asn Lys Met Thr Ile Arg Glu Leu
Ile Gln Ser Lys Glu Ile Pro Lys625 630
635 640Glu Phe Tyr Ile Val Asn Gly Asp Asn Lys Val Tyr
Leu Ser Gln Glu 645 650
655Asn Pro Leu Asp Met Glu Ile Leu Glu Ser Ala Ile Lys Lys Ser Ser
660 665 670Lys Arg Lys Asp Phe Ile
Glu Leu Gln Glu Tyr Phe Glu Asp Glu Asn 675 680
685Ile Ile Asn Lys Gly Gln Lys Gly Arg Val Ala Asp Val Val
Val Pro 690 695 700Phe Ile Arg Thr Arg
Ala Leu Gly Asn Glu Gly Arg Ala Phe Ile Arg705 710
715 720Glu Lys Arg Val Ser Val Glu Arg Arg Glu
Lys Leu Pro Phe Asn Glu 725 730
735Trp Leu Tyr Leu Lys Leu Tyr Ile Ser Ile Asn Arg Gln Asn Glu Phe
740 745 750Leu Leu Ser Tyr Leu
Pro Asp Ile Gln Lys Ile Val Ala Asn Leu Gly 755
760 765Gly Lys Leu Phe Phe Leu Arg Tyr Thr Asp Pro Lys
Pro His Ile Arg 770 775 780Leu Arg Ile
Lys Cys Ser Asp Leu Phe Leu Ala Tyr Gly Ser Ile Leu785
790 795 800Glu Ile Leu Lys Arg Ser Gln
Lys Asn Arg Ile Met Ser Thr Phe Asp 805
810 815Ile Ser Ile Tyr Asp Gln Glu Val Glu Arg Tyr Gly
Gly Phe Asp Thr 820 825 830Leu
Glu Leu Ser Glu Ala Ile Phe Cys Ala Asp Ser Lys Ile Ile Pro 835
840 845Asn Leu Leu Thr Leu Ile Lys Asp Thr
Asn Asn Asp Trp Lys Val Asp 850 855
860Asp Val Ser Ile Leu Val Asn Tyr Leu Tyr Leu Lys Cys Phe Phe Gln865
870 875 880Asn Asp Asn Lys
Lys Ile Leu Asn Phe Leu Asn Leu Val Ser Pro Lys 885
890 895Lys Val Lys Glu Asn Val Asn Glu Lys Ile
Glu His Tyr Leu Lys Leu 900 905
910Leu Lys Val Asp Asn Leu Gly Asp Gln Ile Phe Tyr Asp Lys Asn Phe
915 920 925Lys Glu Leu Lys His Ala Ile
Lys Asn Leu Phe Leu Lys Met Ile Ala 930 935
940Gln Asp Phe Glu Leu Gln Lys Val Tyr Ser Ile Ile Asp Ser Ile
Ile945 950 955 960His Val
His Asn Asn Arg Leu Ile Gly Ile Glu Arg Asp Lys Glu Lys
965 970 975Leu Ile Tyr Tyr Thr Leu Gln
Arg Leu Phe Val Ser Glu Glu Tyr Met 980 985
990Lys288682PRTLactococcus lactis 288Met Lys Lys Ile Leu Gly
Phe Leu Phe Ile Val Cys Ser Leu Gly Leu1 5
10 15Ser Ala Thr Val His Gly Glu Thr Thr Asn Ser Gln
Gln Leu Leu Ser 20 25 30Asn
Asn Ile Asn Thr Glu Leu Ile Asn His Asn Ser Asn Ala Ile Leu 35
40 45Ser Ser Thr Glu Gly Ser Thr Thr Asp
Ser Ile Asn Leu Gly Ala Gln 50 55
60Ser Pro Ala Val Lys Ser Thr Thr Arg Thr Glu Leu Asp Val Thr Gly65
70 75 80Ala Ala Lys Thr Leu
Leu Gln Thr Ser Ala Val Gln Lys Glu Met Lys 85
90 95Val Ser Leu Gln Glu Thr Gln Val Ser Ser Glu
Phe Ser Lys Arg Asp 100 105
110Ser Val Thr Asn Lys Glu Ala Val Pro Val Ser Lys Asp Glu Leu Leu
115 120 125Glu Gln Ser Glu Val Val Val
Ser Thr Ser Ser Ile Gln Lys Asn Lys 130 135
140Ile Leu Asp Asn Lys Lys Lys Arg Ala Asn Phe Val Thr Ser Ser
Pro145 150 155 160Leu Ile
Lys Glu Lys Pro Ser Asn Ser Lys Asp Ala Ser Gly Val Ile
165 170 175Asp Asn Ser Ala Ser Pro Leu
Ser Tyr Arg Lys Ala Lys Glu Val Val 180 185
190Ser Leu Arg Gln Pro Leu Lys Asn Gln Lys Val Glu Ala Gln
Pro Leu 195 200 205Leu Ile Ser Asn
Ser Ser Glu Lys Lys Ala Ser Val Tyr Thr Asn Ser 210
215 220His Asp Phe Trp Asp Tyr Gln Trp Asp Met Lys Tyr
Val Thr Asn Asn225 230 235
240Gly Glu Ser Tyr Ala Leu Tyr Gln Pro Ser Lys Lys Ile Ser Val Gly
245 250 255Ile Ile Asp Ser Gly
Ile Met Glu Glu His Pro Asp Leu Ser Asn Ser 260
265 270Leu Gly Asn Tyr Phe Lys Asn Leu Val Pro Lys Gly
Gly Phe Asp Asn 275 280 285Glu Glu
Pro Asp Glu Thr Gly Asn Pro Ser Asp Ile Val Asp Lys Met 290
295 300Gly His Gly Thr Glu Val Ala Gly Gln Ile Thr
Ala Asn Gly Asn Ile305 310 315
320Leu Gly Val Ala Pro Gly Ile Thr Val Asn Ile Tyr Arg Val Phe Gly
325 330 335Glu Asn Leu Ser
Lys Ser Glu Trp Val Ala Arg Ala Ile Arg Arg Ala 340
345 350Ala Asp Asp Gly Asn Lys Val Ile Asn Ile Ser
Ala Gly Gln Tyr Leu 355 360 365Met
Ile Ser Gly Ser Tyr Asp Asp Gly Thr Asn Asp Tyr Gln Glu Tyr 370
375 380Leu Asn Tyr Lys Ser Ala Ile Asn Tyr Ala
Thr Ala Lys Gly Ser Ile385 390 395
400Val Val Ala Ala Leu Gly Asn Asp Ser Leu Asn Ile Gln Asp Asn
Gln 405 410 415Thr Met Ile
Asn Phe Leu Lys Arg Phe Arg Ser Ile Lys Val Pro Gly 420
425 430Lys Val Val Asp Ala Pro Ser Val Phe Glu
Asp Val Ile Ala Val Gly 435 440
445Gly Ile Asp Gly Tyr Gly Asn Ile Ser Asp Phe Ser Asn Ile Gly Ala 450
455 460Asp Ala Ile Tyr Ala Pro Ala Gly
Thr Thr Ala Asn Phe Lys Lys Tyr465 470
475 480Gly Gln Asp Lys Phe Val Ser Gln Gly Tyr Tyr Leu
Lys Asp Trp Leu 485 490
495Phe Thr Thr Ala Asn Thr Gly Trp Tyr Gln Tyr Val Tyr Gly Asn Ser
500 505 510Phe Ala Thr Pro Lys Val
Ser Gly Ala Leu Ala Leu Val Val Asp Lys 515 520
525Tyr Gly Ile Lys Asn Pro Asn Gln Leu Lys Arg Phe Leu Leu
Met Asn 530 535 540Ser Pro Glu Val Asn
Gly Asn Arg Val Leu Asn Ile Val Asp Leu Leu545 550
555 560Asn Gly Lys Asn Lys Ala Phe Ser Leu Asp
Thr Asp Lys Gly Gln Asp 565 570
575Asp Ala Ile Asn His Lys Ser Met Glu Asn Leu Lys Glu Ser Arg Asp
580 585 590Thr Met Lys Gln Glu
Gln Asp Lys Glu Ile Gln Arg Asn Thr Asn Asn 595
600 605Asn Phe Ser Ile Lys Asn Asp Phe His Asn Ile Ser
Lys Glu Val Ile 610 615 620Ser Val Asp
Tyr Asn Ile Asn Gln Lys Met Ala Asn Asn Arg Asn Ser625
630 635 640Arg Gly Ala Val Ser Val Arg
Ser Gln Glu Ile Leu Pro Val Thr Gly 645
650 655Asp Gly Glu Asp Phe Leu Pro Ala Leu Gly Ile Val
Cys Ile Ser Ile 660 665 670Leu
Gly Ile Leu Lys Arg Lys Thr Lys Asn 675
680289600PRTLactococcus lactis 289Met Asp Glu Val Lys Glu Phe Thr Ser Lys
Gln Phe Phe Tyr Thr Leu1 5 10
15Leu Thr Leu Pro Ser Thr Leu Lys Leu Ile Phe Gln Leu Glu Lys Arg
20 25 30Tyr Ala Ile Tyr Leu Ile
Val Leu Asn Ala Ile Thr Ala Phe Val Pro 35 40
45Leu Ala Ser Leu Phe Ile Tyr Gln Asp Leu Ile Asn Ser Val
Leu Gly 50 55 60Ser Gly Arg His Leu
Ile Asn Ile Ile Ile Ile Tyr Phe Ile Val Gln65 70
75 80Val Ile Thr Thr Val Leu Gly Gln Leu Glu
Ser Tyr Val Ser Gly Lys 85 90
95Phe Asp Met Arg Leu Ser Tyr Ser Ile Asn Met Arg Leu Met Arg Thr
100 105 110Thr Ser Ser Leu Glu
Leu Ser Asp Tyr Glu Gln Ala Asp Met Tyr Asn 115
120 125Ile Ile Glu Lys Val Thr Gln Asp Ser Thr Tyr Lys
Pro Phe Gln Leu 130 135 140Phe Asn Ala
Ile Ile Val Glu Leu Ser Ser Phe Ile Ser Leu Leu Ser145
150 155 160Ser Leu Phe Phe Ile Gly Thr
Trp Asn Ile Gly Val Ala Ile Leu Leu 165
170 175Leu Ile Val Pro Val Leu Ser Leu Val Leu Phe Leu
Arg Val Gly Gln 180 185 190Leu
Glu Phe Leu Ile Gln Trp Gln Arg Ala Ser Ser Glu Arg Glu Thr 195
200 205Trp Tyr Ile Val Tyr Leu Leu Thr His
Asp Phe Ser Phe Lys Glu Ile 210 215
220Lys Leu Asn Asn Ile Ser Asn Tyr Phe Ile His Lys Phe Gly Lys Leu225
230 235 240Lys Lys Gly Phe
Ile Asn Gln Asp Leu Ala Ile Ala Arg Lys Lys Thr 245
250 255Tyr Phe Asn Ile Phe Leu Asp Phe Ile Leu
Asn Leu Ile Asn Ile Leu 260 265
270Thr Ile Phe Ala Met Ile Leu Ser Val Arg Ala Gly Lys Leu Leu Ile
275 280 285Gly Asn Leu Val Ser Leu Ile
Gln Ala Ile Ser Lys Ile Asn Thr Tyr 290 295
300Ser Gln Thr Met Ile Gln Asn Ile Tyr Ile Ile Tyr Asn Thr Ser
Leu305 310 315 320Phe Met
Glu Gln Leu Phe Glu Phe Leu Lys Arg Glu Ser Val Val His
325 330 335Lys Lys Ile Glu Asp Thr Glu
Ile Cys Asn Gln His Ile Gly Thr Val 340 345
350Lys Val Ile Asn Leu Ser Tyr Val Tyr Pro Asn Ser Asn Ala
Phe Ala 355 360 365Leu Lys Asn Ile
Asn Leu Ser Phe Glu Lys Gly Glu Leu Thr Ala Ile 370
375 380Val Gly Lys Asn Gly Ser Gly Lys Ser Thr Leu Val
Lys Ile Ile Ser385 390 395
400Gly Leu Tyr Gln Pro Thr Met Gly Ile Ile Gln Tyr Asp Lys Met Arg
405 410 415Ser Ser Leu Met Pro
Glu Glu Phe Tyr Gln Lys Asn Ile Ser Val Leu 420
425 430Phe Gln Asp Phe Val Lys Tyr Glu Leu Thr Ile Arg
Glu Asn Ile Gly 435 440 445Leu Ser
Asp Leu Ser Ser Gln Trp Glu Asp Glu Lys Ile Ile Lys Val 450
455 460Leu Asp Asn Leu Gly Leu Asp Phe Leu Lys Thr
Asn Asn Gln Tyr Val465 470 475
480Leu Asp Thr Gln Leu Gly Asn Trp Phe Gln Glu Gly His Gln Leu Ser
485 490 495Gly Gly Gln Trp
Gln Lys Ile Ala Leu Ala Arg Thr Phe Phe Lys Lys 500
505 510Ala Ser Ile Tyr Ile Leu Asp Glu Pro Ser Ala
Ala Leu Asp Pro Val 515 520 525Ala
Glu Lys Glu Ile Phe Asp Tyr Phe Val Ala Leu Ser Glu Asn Asn 530
535 540Ile Ser Ile Phe Ile Ser His Ser Leu Asn
Ala Ala Arg Lys Ala Asn545 550 555
560Lys Ile Val Val Met Lys Asp Gly Gln Val Glu Asp Val Gly Ser
His 565 570 575Asp Val Leu
Leu Arg Arg Cys Gln Tyr Tyr Gln Glu Leu Tyr Tyr Ser 580
585 590Glu Gln Tyr Glu Asp Asn Asp Glu
595 60029015PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 290Asn Phe Asp Phe Gly Glu Leu
Thr Leu Ser Thr Gly Leu Pro Gly1 5 10
152911683DNAArtificial SequenceDescription of Artificial
Sequence Synthetic construct 291agatctgctt gaatccgcgg ataagaggac
tagtattcgt ctcactaggg agagctcacc 60accatgaaca agttgctgtg ctgcgcgctc
gtgtttctgg acatctccat taagtggacc 120acccaggacg tgcagcttca ggagtcagga
cctagcctcg tgaaaccttc tcagactctg 180tccctcacct gttctgtcac tggcgactcc
atcaccagtg attactggag ctggatccgg 240aaattcccag ggaatagact tgagtacatg
gggtacgtaa gctacagtgg tagcacttac 300tacaatccat ctctcaaaag tcgaatctcc
atcacccgag acacatccaa gaaccagtac 360tacctggatt tgaattctgt gactactgag
gacacagcca catattactg tgcaaactgg 420gacggtgatt actggggcca agggactctg
gtcactgtct ctgcagccaa aacgacaccc 480ccatctgtct atccactggc ccctggatct
gctgcccaaa ctaactccat ggtgaccctg 540ggatgcctgg tcaagggcta tttccctgag
ccagtgacag tgacctggaa ctctggatcc 600ctgtccagcg gtgtgcacac cttcccagct
gtcctgcagt ctgacctcta cactctgagc 660agctcagtga ctgtcccctc cagccctcgg
cccagcgaga ccgtcacctg caacgttgcc 720cacccggcca gcagcaccaa ggtggacaag
aaaattgtgc ccagggattg tggttgtaag 780ccttgcatat gtacagtccc agaagtatca
tctgtcttca tcttcccccc aaagcccaag 840gatgtgctca ccattactct gactcctaag
gtcacgtgtg ttgtggtaga catcagcaag 900gatgatcccg aggtccagtt cagctggttt
gtagatgatg tggaggtgca cacagctcag 960acgcaacccc gggaggagca gttcaacagc
actttccgct cagtcagtga acttcccatc 1020atgcaccagg actggctcaa tggcaaggag
ttcaaatgca gggtcaacag tgcagctttc 1080cctgccccca tcgagaaaac catctccaaa
accaaaggca gaccgaaggc tccacaggtg 1140tacaccattc cacctcccaa ggagcagatg
gccaaggata aagtcagtct gacctgcatg 1200ataacagact tcttccctga agacattact
gtggagtggc agtggaatgg gcagccagcg 1260gagaactaca agaacactca gcccatcatg
aacacgaatg gctcttactt cgtctacagc 1320aagctcaatg tgcagaagag caactgggag
gcaggaaata ctttcacctg ctctgtgtta 1380catgagggcc tgcacaacca ccatactgag
aagagcctct cccactctcc tggtaaactc 1440gagcctcctc catccactgt ctccaacatg
gcgaccgttg ctgttctggt tgtccttgga 1500gctgcaatag tcactggagc tgtggtggct
tttgtgatga agatgagaag gagaaacaca 1560ggtggaaaag gaggggacta tgctctggct
ccaggctccc agacctctga tctgtctctc 1620ccagattgta aagtgatggt tcatgaccct
cattctctag cgtgaggccg gccaaggcgc 1680gcc
1683292533PRTArtificial
SequenceDescription of Artificial Sequence Synthetic construct
292Met Asn Lys Leu Leu Cys Cys Ala Leu Val Phe Leu Asp Ile Ser Ile1
5 10 15Lys Trp Thr Thr Gln Asp
Val Gln Leu Gln Glu Ser Gly Pro Ser Leu 20 25
30Val Lys Pro Ser Gln Thr Leu Ser Leu Thr Cys Ser Val
Thr Gly Asp 35 40 45Ser Ile Thr
Ser Asp Tyr Trp Ser Trp Ile Arg Lys Phe Pro Gly Asn 50
55 60Arg Leu Glu Tyr Met Gly Tyr Val Ser Tyr Ser Gly
Ser Thr Tyr Tyr65 70 75
80Asn Pro Ser Leu Lys Ser Arg Ile Ser Ile Thr Arg Asp Thr Ser Lys
85 90 95Asn Gln Tyr Tyr Leu Asp
Leu Asn Ser Val Thr Thr Glu Asp Thr Ala 100
105 110Thr Tyr Tyr Cys Ala Asn Trp Asp Gly Asp Tyr Trp
Gly Gln Gly Thr 115 120 125Leu Val
Thr Val Ser Ala Ala Lys Thr Thr Pro Pro Ser Val Tyr Pro 130
135 140Leu Ala Pro Gly Ser Ala Ala Gln Thr Asn Ser
Met Val Thr Leu Gly145 150 155
160Cys Leu Val Lys Gly Tyr Phe Pro Glu Pro Val Thr Val Thr Trp Asn
165 170 175Ser Gly Ser Leu
Ser Ser Gly Val His Thr Phe Pro Ala Val Leu Gln 180
185 190Ser Asp Leu Tyr Thr Leu Ser Ser Ser Val Thr
Val Pro Ser Ser Pro 195 200 205Arg
Pro Ser Glu Thr Val Thr Cys Asn Val Ala His Pro Ala Ser Ser 210
215 220Thr Lys Val Asp Lys Lys Ile Val Pro Arg
Asp Cys Gly Cys Lys Pro225 230 235
240Cys Ile Cys Thr Val Pro Glu Val Ser Ser Val Phe Ile Phe Pro
Pro 245 250 255Lys Pro Lys
Asp Val Leu Thr Ile Thr Leu Thr Pro Lys Val Thr Cys 260
265 270Val Val Val Asp Ile Ser Lys Asp Asp Pro
Glu Val Gln Phe Ser Trp 275 280
285Phe Val Asp Asp Val Glu Val His Thr Ala Gln Thr Gln Pro Arg Glu 290
295 300Glu Gln Phe Asn Ser Thr Phe Arg
Ser Val Ser Glu Leu Pro Ile Met305 310
315 320His Gln Asp Trp Leu Asn Gly Lys Glu Phe Lys Cys
Arg Val Asn Ser 325 330
335Ala Ala Phe Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly
340 345 350Arg Pro Lys Ala Pro Gln
Val Tyr Thr Ile Pro Pro Pro Lys Glu Gln 355 360
365Met Ala Lys Asp Lys Val Ser Leu Thr Cys Met Ile Thr Asp
Phe Phe 370 375 380Pro Glu Asp Ile Thr
Val Glu Trp Gln Trp Asn Gly Gln Pro Ala Glu385 390
395 400Asn Tyr Lys Asn Thr Gln Pro Ile Met Asn
Thr Asn Gly Ser Tyr Phe 405 410
415Val Tyr Ser Lys Leu Asn Val Gln Lys Ser Asn Trp Glu Ala Gly Asn
420 425 430Thr Phe Thr Cys Ser
Val Leu His Glu Gly Leu His Asn His His Thr 435
440 445Glu Lys Ser Leu Ser His Ser Pro Gly Lys Leu Glu
Pro Pro Pro Ser 450 455 460Thr Val Ser
Asn Met Ala Thr Val Ala Val Leu Val Val Leu Gly Ala465
470 475 480Ala Ile Val Thr Gly Ala Val
Val Ala Phe Val Met Lys Met Arg Arg 485
490 495Arg Asn Thr Gly Gly Lys Gly Gly Asp Tyr Ala Leu
Ala Pro Gly Ser 500 505 510Gln
Thr Ser Asp Leu Ser Leu Pro Asp Cys Lys Val Met Val His Asp 515
520 525Pro His Ser Leu Ala
530293728DNAMus musculus 293gagctcacca caatgaacaa gttgctgtgc tgcgcgctcg
tgtttctgga catctccatt 60aagtggacca cccaggatat tgtgctaact cagtctccag
ccaccctgtc tgtgactcca 120ggaaatagcg tcagtctttc ctgcagggcc agccaaagta
ttggcaacaa cctacactgg 180tatcaacaaa aatcacatga gtctccaagg cttctcatca
agtatgcttc ccagtccatc 240tctgggatcc cctccaggtt cagtggcagt ggatcaggga
cagatttcac tctcagtatc 300aacagtgtgg agactgaaga ttttggaatg tatttctgtc
aacagagtaa cagctggcct 360tacacgttcg gaggggggac caagctggaa ataaaacggg
ctgatgctgc accaactgta 420tccatcttcc caccatccag tgagcagtta acatctggag
gtgcctcagt cgtgtgcttc 480ttgaacaact tctaccccaa agacatcaat gtcaagtgga
agattgatgg cagtgaacga 540caaaatggcg tcctgaacag ttggactgat caggacagca
aagacagcac ctacagcatg 600agcagcaccc tcacgttgac caaggacgag tatgaacgac
ataacagcta tacctgtgag 660gccactcaca agacatcaac ttcacccatt gtcaagagct
tcaacaggaa tgagtgttga 720ggcgcgcc
728294133PRTAspergillus
terreusMOD_RES(133)..(133)Variable amino acid 294Met Ala Lys Pro Leu Ser
Gln Glu Glu Ser Thr Leu Ile Glu Arg Ala1 5
10 15Thr Ala Thr Ile Asn Ser Ile Pro Ile Ser Glu Asp
Tyr Ser Val Ala 20 25 30Ser
Ala Ala Leu Ser Ser Asp Gly Arg Ile Phe Thr Gly Val Asn Val 35
40 45Tyr His Phe Thr Gly Gly Pro Cys Ala
Glu Leu Val Val Leu Gly Thr 50 55
60Ala Ala Ala Ala Ala Ala Gly Asn Leu Thr Cys Ile Val Ala Ile Gly65
70 75 80Asn Glu Asn Arg Gly
Ile Leu Ser Pro Cys Gly Arg Cys Arg Gln Val 85
90 95Leu Leu Asp Leu His Pro Gly Ile Lys Ala Ile
Val Lys Asp Ser Asp 100 105
110Gly Gln Pro Thr Ala Val Gly Ile Arg Glu Leu Leu Pro Ser Gly Tyr
115 120 125Val Trp Glu Gly Xaa
130295399DNAArtificial SequenceDescription of Artificial Sequence
Synthetic construct 295atggccaagc ccctctctca agaggagtcc accctcattg
agagagccac tgccacaatc 60aactccatcc ccatctctga ggactactcc gtcgcctccg
ccgccctctc gtcagacggg 120agaatcttca ctggggtcaa tgtctatcat tttactgggg
ggccctgtgc cgagctcgtc 180gtcctcggga cagccgccgc cgccgccgcc gggaacctca
cttgtatcgt cgccataggg 240aatgagaaca gggggatcct ctccccctgc gggagatgcc
gacaggtcct cctcgacctc 300caccccggga tcaaagccat agtcaaggac tcagacgggc
agcccacagc cgtcgggatt 360cgagagctcc tcccctctgg gtatgtctgg gaggggtaa
399296399DNAArtificial SequenceDescription of
Artificial Sequence Synthetic construct 296atggctaaac ctcttagcca
ggaagaaagt accttgattg aacgtgcaac tgctacaatc 60aacagcatac ccatatctga
agactactct gttgccagtg cagctttaag ttcagacggt 120aggattttta caggtgtgaa
tgtttaccac tttactgggg gaccttgtgc agagttggta 180gtactaggta cagctgcagc
tgcagcagct ggcaacctaa cctgtattgt agcaatcggt 240aatgaaaaca ggggcatact
aagcccctgc ggtagatgca ggcaagtact gttagatctg 300catcctggca tcaaagcaat
agttaaggac agtgatgggc agccaactgc agttggtatt 360agggaactac tgccctctgg
ttatgtatgg gagggctaa
3992971038DNAUnknownDescription of Unknown Hygromycin gene sequence
297atgaaaaagc ctgaactcac cgccacgtct gtcgagaagt ttctgatcga aaagttcgac
60agcgtctccg acctgatgca gctctcggag ggcgaagaat ctcgtgcttt cagcttcgat
120gtaggagggc gtggatatgt cctgcgggta aatagctgcg ccgatggttt ctacaaagat
180cgttatgttt atcggcactt tgcatcggcc gcgctcccga ttccggaagt gcttgacatt
240ggggaattca gcgagagcct gacctattgc atctcccgcc gtgcacaggg tgtcacgttg
300caagacctgc ctgaaaccga actgcccgct gttctccagc cggtcgcgga ggctatggat
360gcgatcgctg cggccgatct tagccagacg agcgggttcg gcccattcgg accgcaagga
420atcggtcaat acactacatg gcgtgatttc atatgcgcga ttgctgatcc ccatgtgtat
480cactggcaaa ctgtgatgga cgacaccgtc agtgcgtccg tcgcgcaggc tctcgatgag
540ctgatgcttt gggccgagga ctgccccgaa gtccggcacc tcgtgcacgc ggatttcggc
600tccaacaatg tcctgacgga caatggccgc ataacagcgg tcattgactg gagcgaggcg
660atgttcgggg attcccaata cgaggtcgcc aacatcttct tctggaggcc gtggttggct
720tgtatggagc agcagacgcg ctacttcgag cggaggcatc cggagcttgc aggatcgccg
780cgcctccggg cgtatatgct ccgcattggt cttgaccaac tctatcagag cttggttgac
840ggcaatttcg atgatgcagc ttgggcgcag ggtcgatgcg acgcaatcgt ccgatccgga
900gccgggactg tcgggcgtac acaaatcgcc cgcagaagcg cggccgtctg gaccgatggc
960tgtgtagaag tactcgccga tagtggaaac cgacgcccca gcactcgtgg ggatcgggag
1020atgggggagg ctaactga
10382981038DNAArtificial SequenceDescription of Artificial Sequence
Synthetic construct 298atgaaaaagc ctgaactcac cgccacgtct gtcgagaagt
ttctgattga gaaattcgac 60tctgtctctg acctcatgca gctctctgag ggggaggagt
ctagggcttt cagctttgac 120gtagggggaa gaggatatgt cctgagagtc aatagctgcg
ccgatggttt ctacaaagac 180agatatgtct acagacattt cgcatccgcc gccctcccaa
tccctgaggt gcttgacatt 240ggggaattct cagagagcct gacctattgc atctcccgga
gagcccaggg tgtgactctt 300caagacctgc ctgaaacaga gctccctgcc gttctccagc
ccgtcgcaga ggccatggat 360gcaatcgccg ccgcagacct cagccagacc tcggggtttg
ggccatttgg gccccaaggg 420ataggccaat acactacatg gagggatttt atatgcgcta
ttgctgaccc ccatgtgtat 480cactggcaaa ctgtgatgga cgacacagtc tcagcctcag
tcgcccaggc cctggacgag 540ctgatgcttt gggccgagga ctgccccgaa gtcagacatc
tcgtccatgc cgactttggg 600tcaaacaatg tcctgacgga caatgggaga atcactgccg
tcattgactg gagtgaggcc 660atgtttgggg actcccaata cgaggtcgcc aacatcttct
tctggaggcc atggctcgct 720tgtatggagc agcagacccg ttactttgag aggaggcacc
cagagcttgc agggtcccct 780agactcaggg cctatatgct caggataggg cttgaccaac
tctatcagag cttggttgac 840ggcaattttg acgatgcagc ttgggcccaa gggagatgtg
acgccatcgt caggagtggg 900gccgggactg tggggagaac acaaatcgcc aggaggtcag
cggccgtctg gactgatggg 960tgtgtagaag tcttagccga ctctgggaac aggagaccca
gcacaagggg ggacagggag 1020atgggggagg ctaactga
10382991038DNAArtificial SequenceDescription of
Artificial Sequence Synthetic construct 299atgaaaaagc ctgaacttac
tgctacaagt gttgagaagt ttctgatcga aaagttcgac 60tctgtatccg acctgatgca
gctctcggag ggcgaagaaa gcagagcttt cagcttcgat 120gtaggaggta gaggttatgt
gctaagggta aatagttgtg cagatggttt ctacaaagat 180aggtatgtgt acagacactt
tgcaagtgct gctctcccta taccagaagt gcttgacatt 240ggggaattca gcgagagcct
gacctattgc ataagtaggc gtgcacaggg tgttaccctg 300caagacctgc ctgaaaccga
actgccagca gttttacaac ctgttgccga ggctatggat 360gcaattgcag cagctgatct
tagccaaacc agtgggttcg gcccattcgg accgcaagga 420attgggcagt acactacatg
gcgtgatttc atatgtgcta ttgctgatcc ccatgtgtat 480cactggcaaa ctgtgatgga
tgatactgtc tctgcatcag ttgcccaggc tctcgatgag 540ctgatgcttt gggctgagga
ctgccccgaa gttaggcacc ttgtgcatgc agatttcggc 600tccaacaatg tcctaacaga
taatggtagg attactgctg tcattgactg gagcgaggct 660atgttcgggg attcccagta
tgaagtagct aacatcttct tctggaggcc gtggttggct 720tgtatggagc agcagacaag
gtacttcgag cggaggcatc cggagcttgc aggttcccct 780aggctccggg cttacatgct
ccgcattggt cttgaccaac tctatcagag cttggttgac 840ggcaactttg atgatgcagc
ttgggcacag ggcaggtgtg atgccatagt acgatccgga 900gctggcactg ttggcagaac
acaaatagct cgcagaagtg ctgctgtctg gaccgatggc 960tgtgtagaag tgttggcaga
tagtggcaac aggcgcccca gtacaagagg ggatcgggag 1020atgggggagg ctaactga
1038300703DNAUnknownDescription of Unknown Teal Fluorescent Protein
sequence 300atggtctcta agggcgaaga gaccactatg ggcgtgatca agcccgacat
gaaaattaaa 60ctgaagatgg aaggtaacgt gaacggccac gcctttgtga tagagggcga
gggggaaggg 120aaaccatcga tggtaccaat acaatcaatc tggaggtgaa ggaaggtgct
ccccttccct 180tttcctacga catcctgaca acagcttttg cctatggtaa ccgggccttc
accaagtacc 240cggacgacat ccccaattac tcaagcagtc attcccggag gggtatagtt
gggaacgcac 300tatgaccttc gaggataagg ggattgtcaa ggtcaagagc gacataagca
tggaggaaga 360ttcgtttatc tatgagatac acctgaaggg tgaaatttcc cccccaacgg
ccccgttatg 420cagaaaaaga ccaccgggtg ggacgcctcc acggagcgaa tgtacgtccg
cgatggggtg 480ctcaagggcg acgtaaaaca caaactgctg ctggaaggcg gcgggcccac
cgtgttgact 540tcaagacgat ttatcgtgcc aagaaggccg tcaaacttcc cgactaccac
ttcgtagatc 600acagaatcga gatactcaac catgacaagg attacaacaa ggtgaccgtc
tatgagagcc 660cgtggctaga aactccaccg atgggatgga cgagttatat aaa
703301703DNAArtificial SequenceDescription of Artificial
Sequence Synthetic construct 301atggtttcca aaggggagga aacaacaatg
ggtgttataa aaccggacat gaagattaag 60ctgaaaatgg aaggcaatgt taatgggcat
gcttttgtga tagaggggga aggtgagggt 120aagccctcga tggtacaaac actatcaacc
tagaggtgaa ggaaggtgca ccgctgccat 180tttcctatga tatcctcacc actgcctttg
catacggcaa cagggccttt accaagtacc 240ctgatgacat tcccaactac tcaagcagag
ttttcctgag gggtatagct gggagagaac 300catgacgttt gaggataaag ggattgttaa
ggtcaagtct gacatcagca tggaagagga 360tagctttata tacgaaatcc acctgaaggg
ggaaatttcc ctcctaacgg ccctgtgatg 420cagaaaaaaa ctaccggttg ggatgccagt
acagaacgaa tgtatgtacg tgacggagta 480ctcaaaggcg atgtaaagca taaactgctg
cttgaaggtg ggggccccat agagttgact 540ttaagacaat ttatagggcc aaaaaagctg
taaaattgcc cgactaccat tttgtagatc 600atcggatcga aattcttaac catgacaagg
actataacaa agtgactgta tatgagagtc 660agttgctcgc aacagtactg atggaatgga
tgaattgtac aag 703302703DNAArtificial
SequenceDescription of Artificial Sequence Synthetic construct
302atggtctcta agggagaaga gaccactatg ggagtcatca agcccgacat gaaaattaaa
60ctgaagatgg aaggtaatgt caatggccac gcctttgtga tagagggaga gggggaaggg
120aaaccattga tgggaccaat acaatcaatc tggaggtgaa ggaaggtgct ccccttccct
180tttcctacga catcctgaca acagcttttg cctatgggaa cagggccttc accaagtacc
240ccgacgacat ccccaattac tcaagcagtc cttccccgag gggtatagtt gggaaaggac
300tatgaccttt gaggacaagg ggattgtcaa ggtcaagagc gacataagca tggaggaaga
360ctcttttatc tatgagatac acctgaaggg tgaaatttcc cccccaatgg gcccgttatg
420cagaaaaaga ccaccgggtg ggacgcctcc acggagagaa tgtacgtcag ggacggggtg
480ctcaagggag atgtcaaaca caaactgctg ctggaaggtg gggggcccac agagtcgact
540tcaagacgat ttatagagcc aagaaggccg tcaaactccc agactaccac tttgtggacc
600acagaatcga gatactcaac catgacaagg attacaacaa ggtgaccgtc tatgagagcc
660cgtggctaga aactccactg acgggatgga cgagttatat aaa
703303198PRTHomo sapiens 303Met Asp Ser Leu Leu Met Asn Arg Arg Lys Phe
Leu Tyr Gln Phe Lys1 5 10
15Asn Val Arg Trp Ala Lys Gly Arg Arg Glu Thr Tyr Leu Cys Tyr Val
20 25 30Val Lys Arg Arg Asp Ser Ala
Thr Ser Phe Ser Leu Asp Phe Gly Tyr 35 40
45Leu Arg Asn Lys Asn Gly Cys His Val Glu Leu Leu Phe Leu Arg
Tyr 50 55 60Ile Ser Asp Trp Asp Leu
Asp Pro Gly Arg Cys Tyr Arg Val Thr Trp65 70
75 80Phe Thr Ser Trp Ser Pro Cys Tyr Asp Cys Ala
Arg His Val Ala Asp 85 90
95Phe Leu Arg Gly Asn Pro Asn Leu Ser Leu Arg Ile Phe Thr Ala Arg
100 105 110Leu Tyr Phe Cys Glu Asp
Arg Lys Ala Glu Pro Glu Gly Leu Arg Arg 115 120
125Leu His Arg Ala Gly Val Gln Ile Val Ile Met Thr Phe Lys
Asp Tyr 130 135 140Phe Tyr Cys Trp Asn
Thr Phe Val Glu Asn His Glu Arg Thr Phe Lys145 150
155 160Ala Trp Glu Gly Leu His Glu Asn Ser Val
Arg Leu Ser Arg Gln Leu 165 170
175Arg Arg Ile Leu Leu Pro Leu Tyr Glu Val Asp Asp Leu Arg Asp Ala
180 185 190Phe Arg Thr Leu Gly
Leu 195304198PRTMus musculus 304Met Asp Ser Leu Leu Met Lys Gln
Lys Lys Phe Leu Tyr His Phe Lys1 5 10
15Asn Val Arg Trp Ala Lys Gly Arg His Glu Thr Tyr Leu Cys
Tyr Val 20 25 30Val Lys Arg
Arg Asp Ser Ala Thr Ser Phe Ser Leu Asp Phe Gly Tyr 35
40 45Leu Arg Asn Lys Ser Gly Cys His Val Glu Leu
Leu Phe Leu Arg Tyr 50 55 60Ile Ser
Asp Trp Asp Leu Asp Pro Gly Arg Cys Tyr Arg Val Thr Trp65
70 75 80Phe Thr Ser Trp Ser Pro Cys
Tyr Asp Cys Ala Arg His Val Ala Glu 85 90
95Phe Leu Arg Trp Asn Pro Asn Leu Ser Leu Arg Ile Phe
Thr Ala Arg 100 105 110Leu Tyr
Phe Cys Glu Asp Arg Lys Ala Glu Pro Glu Gly Leu Arg Arg 115
120 125Leu His Arg Ala Gly Val Gln Ile Gly Ile
Met Thr Phe Lys Asp Tyr 130 135 140Phe
Tyr Cys Trp Asn Thr Phe Val Glu Asn Arg Glu Arg Thr Phe Lys145
150 155 160Ala Trp Glu Gly Leu His
Glu Asn Ser Val Arg Leu Ser Arg Gln Leu 165
170 175Arg Arg Ile Leu Leu Pro Leu Tyr Glu Val Asp Asp
Leu Arg Asp Ala 180 185 190Phe
Arg Met Leu Gly Leu 195305198PRTCanis familiaris 305Met Asp Ser
Leu Leu Met Lys Gln Lys Lys Phe Leu Tyr His Phe Lys1 5
10 15Asn Val Arg Trp Ala Lys Gly Arg His
Glu Thr Tyr Leu Cys Tyr Val 20 25
30Val Lys Arg Arg Asp Ser Ala Thr Ser Phe Ser Leu Asp Phe Gly Tyr
35 40 45Leu Arg Asn Lys Ser Gly Cys
His Val Glu Leu Leu Phe Leu Arg Tyr 50 55
60Ile Ser Asp Trp Asp Leu Asp Pro Gly Arg Cys Tyr Arg Val Thr Trp65
70 75 80Phe Thr Ser Trp
Ser Pro Cys Tyr Asp Cys Ala Arg His Val Ala Asp 85
90 95Phe Leu Arg Gly Tyr Pro Asn Leu Ser Leu
Arg Ile Phe Ala Ala Arg 100 105
110Leu Tyr Phe Cys Glu Asp Arg Lys Ala Glu Pro Glu Gly Leu Arg Arg
115 120 125Leu His Arg Ala Gly Val Gln
Ile Ala Ile Met Thr Phe Lys Asp Tyr 130 135
140Phe Tyr Cys Trp Asn Thr Phe Val Glu Asn Arg Glu Arg Thr Phe
Lys145 150 155 160Ala Trp
Glu Gly Leu His Glu Asn Ser Val Arg Leu Ser Arg Gln Leu
165 170 175Arg Arg Ile Leu Leu Pro Leu
Tyr Glu Val Asp Asp Leu Arg Asp Ala 180 185
190Phe Arg Thr Leu Gly Leu 195306198PRTRattus
norvegicus 306Met Asp Ser Leu Leu Met Lys Gln Lys Lys Phe Leu Tyr His Phe
Lys1 5 10 15Asn Val Arg
Trp Ala Lys Gly Arg His Glu Thr Tyr Leu Cys Tyr Val 20
25 30Val Lys Arg Arg Asp Ser Ala Thr Ser Phe
Ser Leu Asp Phe Gly Tyr 35 40
45Leu Arg Asn Lys Ser Gly Cys His Val Glu Leu Leu Phe Leu Arg Tyr 50
55 60Ile Ser Asp Trp Asp Leu Asp Pro Gly
Arg Cys Tyr Arg Val Thr Trp65 70 75
80Phe Thr Ser Trp Ser Pro Cys Tyr Asp Cys Ala Arg His Val
Ala Glu 85 90 95Phe Leu
Arg Trp Asn Pro Asn Leu Ser Leu Arg Ile Phe Thr Ala Arg 100
105 110Leu Tyr Phe Cys Glu Asp Arg Lys Ala
Glu Pro Glu Gly Leu Arg Arg 115 120
125Leu His Arg Ala Gly Val Gln Ile Gly Ile Met Thr Phe Lys Asp Tyr
130 135 140Phe Tyr Cys Trp Asn Thr Phe
Val Glu Asn His Glu Arg Thr Phe Lys145 150
155 160Ala Trp Glu Gly Leu His Glu Asn Ser Val Arg Leu
Ser Arg Gln Leu 165 170
175Arg Arg Ile Leu Leu Pro Leu Tyr Glu Val Asp Asp Leu Arg Asp Ala
180 185 190Phe Arg Ile Leu Gly Leu
195307198PRTPan troglodytes 307Met Asp Ser Leu Leu Met Asn Arg Arg
Lys Phe Leu Tyr Gln Phe Lys1 5 10
15Asn Val Arg Trp Ala Lys Gly Arg Arg Glu Thr Tyr Leu Cys Tyr
Val 20 25 30Val Lys Arg Arg
Asp Ser Ala Thr Ser Phe Ser Leu Asp Phe Gly Tyr 35
40 45Leu Arg Asn Lys Asn Gly Cys His Val Glu Leu Leu
Phe Leu Arg Tyr 50 55 60Ile Ser Asp
Trp Asp Leu Asp Pro Gly Arg Cys Tyr Arg Val Thr Trp65 70
75 80Phe Thr Ser Trp Ser Pro Cys Tyr
Asp Cys Ala Arg His Val Ala Asp 85 90
95Phe Leu Arg Gly Asn Pro Asn Leu Ser Leu Arg Ile Phe Thr
Ala Arg 100 105 110Leu Tyr Phe
Cys Glu Asp Arg Lys Ala Glu Pro Glu Gly Leu Arg Arg 115
120 125Leu His Arg Ala Gly Val Gln Ile Ala Ile Met
Thr Phe Lys Asp Tyr 130 135 140Phe Tyr
Cys Trp Asn Thr Phe Val Glu Asn His Glu Arg Thr Phe Lys145
150 155 160Ala Trp Glu Gly Leu His Glu
Asn Ser Val Arg Leu Ser Arg Gln Leu 165
170 175Arg Arg Ile Leu Leu Pro Leu Tyr Glu Val Asp Asp
Leu Arg Asp Ala 180 185 190Phe
Arg Thr Leu Gly Leu 195308198PRTCanis sp. 308Met Asp Ser Leu Leu
Met Lys Gln Arg Lys Phe Leu Tyr His Phe Lys1 5
10 15Asn Val Arg Trp Ala Lys Gly Arg His Glu Thr
Tyr Leu Cys Tyr Val 20 25
30Val Lys Arg Arg Asp Ser Ala Thr Ser Phe Ser Leu Asp Phe Gly His
35 40 45Leu Arg Asn Lys Ser Gly Cys His
Val Glu Leu Leu Phe Leu Arg Tyr 50 55
60Ile Ser Asp Trp Asp Leu Asp Pro Gly Arg Cys Tyr Arg Val Thr Trp65
70 75 80Phe Thr Ser Trp Ser
Pro Cys Tyr Asp Cys Ala Arg His Val Ala Asp 85
90 95Phe Leu Arg Gly Tyr Pro Asn Leu Ser Leu Arg
Ile Phe Ala Ala Arg 100 105
110Leu Tyr Phe Cys Glu Asp Arg Lys Ala Glu Pro Glu Gly Leu Arg Arg
115 120 125Leu His Arg Ala Gly Val Gln
Ile Ala Ile Met Thr Phe Lys Asp Tyr 130 135
140Phe Tyr Cys Trp Asn Thr Phe Val Glu Asn Arg Glu Lys Thr Phe
Lys145 150 155 160Ala Trp
Glu Gly Leu His Glu Asn Ser Val Arg Leu Ser Arg Gln Leu
165 170 175Arg Arg Ile Leu Leu Pro Leu
Tyr Glu Val Asp Asp Leu Arg Asp Ala 180 185
190Phe Arg Thr Leu Gly Leu 195309594DNACanis sp.
309atggacagtt tactgatgaa acagcgcaaa ttcttatatc actttaagaa cgtccgctgg
60gccaaaggta gacatgagac ctacctgtgt tatgttgtga agaggcggga tagtgcaaca
120tctttttccc tggacttcgg ccacctccgt aataagtccg ggtgccacgt ggaactgctg
180ttcttgcgtt atattagcga ctgggacctg gacccagggc ggtgttatcg ggtgacttgg
240tttacctctt ggtccccctg ctatgattgt gcacgccatg tggctgattt tcttcgcggc
300tatccaaatc taagtctacg tatctttgca gcacggttat acttttgtga ggatcgcaag
360gcagagcccg agggtctgcg gcgcctacat agggctgggg tccagatcgc tattatgacc
420ttcaaggatt acttttattg ctggaataca tttgtcgaga acagggagaa aaccttcaag
480gcctgggagg gcctgcatga aaactccgtg agactgagca gacaactgcg aagaatcctg
540ttgcctctgt atgaggtcga cgacctaagg gacgctttcc gcaccctagg ctta
594310594DNAArtificial SequenceDescription of Artificial Sequence
Synthetic construct 310atggacagtt tactgatgaa acagcgcaag ttcctgtacc
actttaagaa tgttcggtgg 60gcaaaaggta ggcatgaaac ctacctgtgt tatgtagtta
aaaggcggga tagtgcaaca 120agctttagct tggacttcgg gcaccttcgt aacaaaagcg
gctgccatgt tgaactgctg 180ttcttgaggt acattagcga ctgggacctg gacccaggta
gatgctaccg agtaacttgg 240tttactagtt ggagcccatg ctatgattgt gcaaggcatg
tagcagattt tcttcgcggc 300tatccaaacc taagccttag aatctttgca gcaaggttgt
acttttgtga ggatcgcaag 360gcagagcccg aggggctacg ccggctgcat agggctggag
tacaaatagc tattatgacc 420ttcaaggatt acttttactg ttggaataca tttgttgaga
acagggagaa aaccttcaaa 480gcctgggagg gtttgcatga aaactcagta aggttaagca
ggcaactgcg aagaatacta 540ctacctctgt atgaggttga cgacctaagg gatgccttcc
gtaccctagg ctta 594311594DNAArtificial SequenceDescription of
Artificial Sequence Synthetic construct 311atggactccc tcctcatgaa
acagaggaag tttctctacc atttcaaaaa tgtcaggtgg 60gccaagggga gacatgagac
ttatctctgt tatgtcgtca agagacggga ctcagccacg 120agtttctccc tcgactttgg
gcatctcaga aacaagtcgg ggtgccatgt cgagctcctc 180ttcctcagat acatctcaga
ctgggacctc gaccccggga ggtgctatag agtcacctgg 240tttacctcct ggtccccctg
ctacgactgt gcccgacatg tcgccgactt cctcaggggg 300taccccaatc tctccctcag
aatattcgcc gccagactct atttctgtga ggacaggaag 360gccgagcccg aggggctcag
gagactccac agggccgggg tccagatcgc cattatgaca 420ttcaaagact acttctactg
ctggaacaca tttgtcgaga atagggagaa gacttttaag 480gcctgggagg ggctccatga
gaattcggtc agactctctc gccaactcag gagaattctc 540ctccccctct atgaggtcga
cgacctcagg gacgccttca ggaccctcgg gctc 594312597DNACanis
familiaris 312atggacagcc tcctgatgaa gcagaggaag tttctttacc atttcaagaa
tgtccgctgg 60gcgaagggtc gccatgagac ttacttgtgc tacgtggtga agcggcggga
tagtgccacc 120tccttttctc tggactttgg tcaccttcga aacaagtcgg gctgccacgt
ggagctgctc 180ttcctccgct acatctccga ctgggacctg gaccccggcc ggtgctaccg
cgtcacctgg 240ttcacgtcct ggagcccctg ctacgactgc gcgcggcacg tggcggactt
cctgcgcggg 300taccccaacc tcagcctcag gatcttcgcc gcgcgcctct acttctgcga
ggaccgcaag 360gcggagcccg aggggctgcg gcggctgcac cgggcgggcg tccagatcgc
catcatgacc 420ttcaaggatt atttttattg ctggaatact tttgtggaaa atcgtgaaaa
aactttcaaa 480gcctgggagg ggttgcacga aaattccgtt cgactatcca gacagcttcg
acgcattctt 540ttgcccctgt atgaggttga tgacttacga gatgcatttc gtactttggg
actttga 597313597DNAArtificial SequenceDescription of Artificial
Sequence Synthetic construct 313atggacagcc tcctgatgaa gcagaggaag
tttctttacc atttcaagaa tgtccgctgg 60gccaagggga gacatgagac ttacttgtgc
tatgtggtca agagaaggga tagtgccacc 120tccttttctc tggactttgg tcacttgagg
aataagtcgg gctgtcatgt cgagctgctc 180ttcctccgct acatctccga ctgggacctg
gaccccggga gatgctatag agtcacctgg 240ttcacgtcct ggagcccctg ctacgactgc
gccagacatg tcgccgactt cctgaggggg 300tatcccaacc tcagcctcag gatcttcgcc
gcccgtctct acttctgcga ggaccgtaag 360gccgagcccg aggggctgag gagactccac
agggccggag tccagatcgc catcatgacc 420ttcaaggatt atttttattg ctggaatact
tttgtggaga atagggaaaa aactttcaaa 480gcctgggagg ggctccatga gaattctgtc
agactcagta gacagctcag gagaattctt 540ttgcccctgt atgaggttga tgaccttaga
gacgcattta ggacactggg actttga 597314597DNAHomo sapiens
314atggacagcc tcttgatgaa ccggaggaag tttctttacc aattcaaaaa tgtccgctgg
60gctaagggtc gccgtgagac ctacctgtgc tacgtagtga agaggcgtga cagtgctaca
120tccttttcac tggactttgg ttatcttcgc aataagaacg gctgccacgt ggaattgctc
180ttcctccgct acatctcgga ctgggaccta gaccctggcc gctgctaccg cgtcacctgg
240ttcacctcct ggagcccctg ctacgactgt gcccgacatg tggccgactt tctgcgaggg
300aaccccaacc tcagtctgag gatcttcacc gcgcgcctct acttctgtga ggaccgcaag
360gctgagcccg aggggctgcg gcggctgcac cgcgccgggg tgcaaatagc catcatgacc
420ttcaaagatt atttttactg ctggaatact tttgtagaaa accatgaaag aactttcaaa
480gcctgggaag ggctgcatga aaattcagtt cgtctctcca gacagcttcg acgcatcctt
540ttgcccctgt atgaggttga tgacttacga gacgcatttc gtactttggg actttga
597315597DNAMus musculus 315atggacagcc ttctgatgaa gcaaaagaag tttctttacc
atttcaaaaa tgtccgctgg 60gccaagggac gccatgagac ctacctctgc tacgtggtga
agaggagaga tagtgccacc 120tcctgctcac tggacttcgg ccaccttcgc aacaagtctg
gctgccacgt ggaattgttg 180ttcctacgct acatctcaga ctgggacctg gacccgggcc
ggtgttaccg cgtcacctgg 240ttcacctcct ggagcccgtg ctatgactgt gcccggcacg
tggctgagtt tctgagatgg 300aaccctaacc tcagcctgag gattttcacc gcgcgcctct
acttctgtga agaccgcaag 360gctgagcctg aggggctgcg gagactgcac cgcgctgggg
tccagatcgg gatcatgacc 420ttcaaagact atttttactg ctggaataca tttgtagaaa
atcgtgaaag aactttcaaa 480gcctgggaag ggctacatga aaattctgtc cggctaacca
gacaacttcg acgcatcctt 540ttgcccttgt acgaagtcga tgacttgcga gatgcatttc
gtatgttggg attttga 597316713PRTUnknownDescription of Unknown Pol
eta sequence 316Met Ala Thr Gly Gln Asp Arg Val Val Ala Leu Val Asp Met
Asp Cys1 5 10 15Phe Phe
Val Gln Val Glu Gln Arg Gln Asn Pro His Leu Arg Asn Lys 20
25 30Pro Cys Ala Val Val Gln Tyr Lys Ser
Trp Lys Gly Gly Gly Ile Ile 35 40
45Ala Val Ser Tyr Glu Ala Arg Ala Phe Gly Val Thr Arg Ser Met Trp 50
55 60Ala Asp Asp Ala Lys Lys Leu Cys Pro
Asp Leu Leu Leu Ala Gln Val65 70 75
80Arg Glu Ser Arg Gly Lys Ala Asn Leu Thr Lys Tyr Arg Glu
Ala Ser 85 90 95Val Glu
Val Met Glu Ile Met Ser Arg Phe Ala Val Ile Glu Arg Ala 100
105 110Ser Ile Asp Glu Ala Tyr Val Asp Leu
Thr Ser Ala Val Gln Glu Arg 115 120
125Leu Gln Lys Leu Gln Gly Gln Pro Ile Ser Ala Asp Leu Leu Pro Ser
130 135 140Thr Tyr Ile Glu Gly Leu Pro
Gln Gly Pro Thr Thr Ala Glu Glu Thr145 150
155 160Val Gln Lys Glu Gly Met Arg Lys Gln Gly Leu Phe
Gln Trp Leu Asp 165 170
175Ser Leu Gln Ile Asp Asn Leu Thr Ser Pro Asp Leu Gln Leu Thr Val
180 185 190Gly Ala Val Ile Val Glu
Glu Met Arg Ala Ala Ile Glu Arg Glu Thr 195 200
205Gly Phe Gln Cys Ser Ala Gly Ile Ser His Asn Lys Val Leu
Ala Lys 210 215 220Leu Ala Cys Gly Leu
Asn Lys Pro Asn Arg Gln Thr Leu Val Ser His225 230
235 240Gly Ser Val Pro Gln Leu Phe Ser Gln Met
Pro Ile Arg Lys Ile Arg 245 250
255Ser Leu Gly Gly Lys Leu Gly Ala Ser Val Ile Glu Ile Leu Gly Ile
260 265 270Glu Tyr Met Gly Glu
Leu Thr Gln Phe Thr Glu Ser Gln Leu Gln Ser 275
280 285His Phe Gly Glu Lys Asn Gly Ser Trp Leu Tyr Ala
Met Cys Arg Gly 290 295 300Ile Glu His
Asp Pro Val Lys Pro Arg Gln Leu Pro Lys Thr Ile Gly305
310 315 320Cys Ser Lys Asn Phe Pro Gly
Lys Thr Ala Leu Ala Thr Arg Glu Gln 325
330 335Val Gln Trp Trp Leu Leu Gln Leu Ala Gln Glu Leu
Glu Glu Arg Leu 340 345 350Thr
Lys Asp Arg Asn Asp Asn Asp Arg Val Ala Thr Gln Leu Val Val 355
360 365Ser Ile Arg Val Gln Gly Asp Lys Arg
Leu Ser Ser Leu Arg Arg Cys 370 375
380Cys Ala Leu Thr Arg Tyr Asp Ala His Lys Met Ser His Asp Ala Phe385
390 395 400Thr Val Ile Lys
Asn Cys Asn Thr Ser Gly Ile Gln Thr Glu Trp Ser 405
410 415Pro Pro Leu Thr Met Leu Phe Leu Cys Ala
Thr Lys Phe Ser Ala Ser 420 425
430Ala Pro Ser Ser Ser Thr Asp Ile Thr Ser Phe Leu Ser Ser Asp Pro
435 440 445Ser Ser Leu Pro Lys Val Pro
Val Thr Ser Ser Glu Ala Lys Thr Gln 450 455
460Gly Ser Gly Pro Ala Val Thr Ala Thr Lys Lys Ala Thr Thr Ser
Leu465 470 475 480Glu Ser
Phe Phe Gln Lys Ala Ala Glu Arg Gln Lys Val Lys Glu Ala
485 490 495Ser Leu Ser Ser Leu Thr Ala
Pro Thr Gln Ala Pro Met Ser Asn Ser 500 505
510Pro Ser Lys Pro Ser Leu Pro Phe Gln Thr Ser Gln Ser Thr
Gly Thr 515 520 525Glu Pro Phe Phe
Lys Gln Lys Ser Leu Leu Leu Lys Gln Lys Gln Leu 530
535 540Asn Asn Ser Ser Val Ser Ser Pro Gln Gln Asn Pro
Trp Ser Asn Cys545 550 555
560Lys Ala Leu Pro Asn Ser Leu Pro Thr Glu Tyr Pro Gly Cys Val Pro
565 570 575Val Cys Glu Gly Val
Ser Lys Leu Glu Glu Ser Ser Lys Ala Thr Pro 580
585 590Ala Glu Met Asp Leu Ala His Asn Ser Gln Ser Met
His Ala Ser Ser 595 600 605Ala Ser
Lys Ser Val Leu Glu Val Thr Gln Lys Ala Thr Pro Asn Pro 610
615 620Ser Leu Leu Ala Ala Glu Asp Gln Val Pro Cys
Glu Lys Cys Gly Ser625 630 635
640Leu Val Pro Val Trp Asp Met Pro Glu His Met Asp Tyr His Phe Ala
645 650 655Leu Glu Leu Gln
Lys Ser Phe Leu Gln Pro His Ser Ser Asn Pro Gln 660
665 670Val Val Ser Ala Val Ser His Gln Gly Lys Arg
Asn Pro Lys Ser Pro 675 680 685Leu
Ala Cys Thr Asn Lys Arg Pro Arg Pro Glu Gly Met Gln Thr Leu 690
695 700Glu Ser Phe Phe Lys Pro Leu Thr His705
7103172139DNAUnknownDescription of Unknown Pol eta sequence
317atggccaccg ggcaggacag agtagtagcc ctggttgata tggattgttt cttcgtgcaa
60gtggagcaaa gacagaaccc acaccttcgg aataaaccgt gtgctgtggt gcagtataaa
120tcttggaagg gcggtggtat tatcgcagtg tcatacgaag cccgagcctt cggcgtaact
180cgatccatgt gggcagacga cgccaagaaa ctctgtcctg acctgctcct cgcccaggtg
240agggagagtc ggggcaaagc caatctgact aaatatagag aagccagtgt ggaggtgatg
300gagattatgt ctcgcttcgc cgtaattgaa cgggcctcta tcgacgaagc atacgttgat
360ttgacctccg ctgttcagga gcgactgcag aaactacaag gccagccaat ctcagccgac
420ctgctcccga gcacttatat tgaaggctta ccacagggac ccaccacagc cgaggaaaca
480gtacagaaag agggcatgcg aaaacagggc ttatttcagt ggctcgattc actacaaatc
540gataacctca cgtccccaga ccttcaatta accgtcgggg ccgtcattgt ggaagaaatg
600cgtgccgcta tcgaacggga gacgggtttc cagtgcagtg cagggatcag tcacaacaag
660gtgttagcca agttggcctg cggcctgaac aagcctaacc gacagaccct ggtctcccac
720gggtcggtcc cccagctttt ctcacagatg cccattcgca agattcgatc cttaggaggt
780aagctgggcg ccagcgtaat agaaatcctg ggcatcgagt acatgggcga gctgacacag
840ttcaccgaga gccagctgca gtcgcacttc ggtgaaaaga acggcagctg gctttatgca
900atgtgtcgtg gtattgagca tgaccctgtc aaaccacgtc agttacccaa gaccatcggc
960tgctctaaaa attttccagg caaaacagcg ttggccaccc gcgaacaggt ccagtggtgg
1020ctgctgcagc tcgcgcagga gctcgaggaa cgcctgacca aggacaggaa cgacaacgat
1080cgtgttgcca cccagctcgt cgtatcaatc cgtgttcagg gtgacaagag actctcatcc
1140ttacgtcgat gctgtgcctt gacacggtac gacgcccata aaatgtcaca tgatgccttc
1200actgtgataa agaactgtaa cacttctggc atccagaccg agtggagccc gccgctgacc
1260atgttgttct tgtgtgcaac caagttcagc gctagtgctc catcctctag cactgacatc
1320accagctttc tttcgtcaga cccaagctct ttaccaaaag tgccagtgac atcatctgaa
1380gctaagaccc aggggagcgg ccccgccgtg acagctacta agaaagcaac tacgtcactg
1440gagagtttct ttcaaaaagc cgctgaacgc cagaaggtga aggaagcctc cttgagtagt
1500ctgaccgccc caactcaggc tccaatgagt aattccccct ccaagccatc cctcccattc
1560caaacaagtc aatccaccgg cactgagccg ttcttcaagc agaagtctct gttgctgaaa
1620caaaagcaac taaacaattc ttctgtcagc agcccccagc agaatccctg gtcgaactgc
1680aaagcactgc ctaatagctt gcctacagaa tacccagggt gcgtgcctgt ttgtgaaggg
1740gttagcaagc tggaagagtc gagtaaggct actcctgcag agatggacct agcccacaat
1800tcccagtcaa tgcacgcttc cagcgcaagt aagagcgtgc tggaggtgac ccagaaggct
1860acgccaaatc cttccctgtt ggccgccgaa gatcaggtgc cctgcgaaaa atgtggcagc
1920ctagtgcctg tgtgggacat gccagaacac atggattatc actttgcgct ggaactgcag
1980aagtctttcc tgcagcctca ctcttccaat ccacaggttg tgtccgccgt tagccaccag
2040ggcaagcgca accccaagtc tccactggca tgtactaaca aacgtccacg tcccgagggg
2100atgcagaccc tggagtcctt ctttaaacct ctgacgcat
21393182139DNAArtificial SequenceDescription of Artificial Sequence
Synthetic construct 318atggccacgg ggcaggacag ggtcgtcgcc ctcgtcgaca
tggactgctt ctttgtccaa 60gtcgagcaga gacaaaaccc ccacctccgg aacaagccct
gtgcagtcgt ccaatacaag 120tcttggaagg ggggggggat tatagccgtc tcatatgagg
cccgagcctt cggggtcacc 180cgctccatgt gggccgacga cgccaagaaa ctctgtcccg
acctcctcct cgcccaagtc 240agggagagtc gggggaaggc caatctcact aaatataggg
aggcctctgt cgaggtcatg 300gagattatgt ctcgcttcgc cgtcattgag agagcctcga
ttgacgaggc ctatgtcgac 360ctcacctcgg ccgtccaaga gagactccag aagctccagg
ggcagcccat ctcagccgac 420ctcctcccct cgacttatat tgaggggctc ccccaggggc
ccacaacagc cgaggagact 480gtccagaaag aggggatgag aaagcagggg ctctttcagt
ggctcgactc tctccaaatc 540gacaacctca cctcccccga cctccaactc accgtcgggg
ccgtcatagt cgaggagatg 600agggccgcca tagagagaga gacggggttc cagtgctctg
ccgggatctc tcataacaag 660gtcctcgcca agctcgcctg tgggctcaat aagcccaacc
gacagactct cgtctcccac 720gggtcggtcc cccagctctt cagtcagatg cccattcgca
agattcgctc cctcgggggg 780aaattggggg cctccgtcat tgagatcctc gggattgagt
acatggggga gctcacacag 840ttcaccgaga gccagctcca gagccacttc ggggagaaga
acgggagctg gctctacgcc 900atgtgtcggg ggatagagca tgaccccgtc aagccccgtc
agctccccaa gaccatcggg 960tgctcaaaaa atttccccgg gaagactgcc ctcgccaccc
gggagcaggt ccagtggtgg 1020ctcctccaac tcgcccagga gctcgaggag agactcacca
aggacaggaa cgacaatgac 1080agggtcgcca cccaactcgt cgtctccatc agagtccagg
gggacaagag actctcctcc 1140ctccgccggt gctgtgccct gacgagatac gacgcccata
aaatgagtca tgacgccttc 1200acagtcataa agaactgtaa cacctctggg atccagaccg
agtggagccc ccccctgacc 1260atgctcttcc tctgtgccac aaagttctcg gcctctgccc
cctcctcctc cactgacatc 1320acctctttcc tctcgtcaga cccctcctct ctccccaagg
tccccgtcac ctcctcagag 1380gccaagactc aggggtctgg gcccgccgtc acagccacta
agaaagccac cacctccctc 1440gagagtttct ttcaaaaagc cgccgagaga cagaaggtca
aggaggcctc cctctcctct 1500ctcacggccc ccactcaagc ccccatgtcc aactccccct
ccaagccctc cctccccttc 1560cagacctctc agtccacagg gactgagccc ttcttcaagc
agaagtctct cctcctcaaa 1620caaaagcaac tcaataactc ctcagtctcc tccccccagc
agaatccctg gtcgaactgc 1680aaagccctcc ccaactctct ccccacagag taccccgggt
gtgtccccgt ctgtgagggg 1740gtctctaagt tagaggagtc gagtaaggcc acccccgccg
agatggacct cgcccacaat 1800tcccagtcaa tgcacgcctc ctccgcctcc aagtctgtcc
tcgaggtcac ccagaaggcc 1860acccccaacc cctccctcct cgccgccgag gaccaagtcc
cctgtgagaa atgtgggtct 1920ctcgtccccg tctgggacat gcccgagcac atggactacc
actttgccct cgagctccaa 1980aagtcctttc tccagcccca ctcctcaaat ccccaggtgg
tctccgccgt ctctcaccag 2040gggaagagga accccaagtc ccccctcgcc tgcactaaca
agagaccccg ccccgagggg 2100atgcagactc tcgagtcctt cttcaagccc ctcacgcat
21393192139DNAArtificial SequenceDescription of
Artificial Sequence Synthetic construct 319atggctactg ggcaggatag
agtagttgca ctggttgaca tggactgttt ttttgtacaa 60gtagaacagc ggcagaaccc
tcatctgcgg aacaagccgt gtgctgttgt acaatacaaa 120agttggaagg gtggtggcat
catagctgtt agttacgagg cacgtgcatt tggtgtaacc 180agaagtatgt gggctgacga
tgctaagaaa ctctgccctg atctgctgtt agcacaagtt 240cgcgaaagca gaggtaaagc
aaacctaacc aagtacagag aggctagtgt agaggttatg 300gaaataatga gtaggtttgc
agttattgaa agagcaagta ttgacgaggc ttatgttgat 360cttacctcag cagtacaaga
aaggttacaa aagttgcaag ggcagccaat tagtgctgat 420ctgctgccta gtacctacat
agaagggttg ccccagggtc ctacaactgc tgaggaaact 480gtacaaaagg aaggcatgag
gaagcagggc ttgtttcagt ggctggatag tttacagatc 540gataacctaa ccagcccaga
tctgcagctt actgttggtg cagttattgt tgaagaaatg 600cgggctgcaa tagagagaga
aactggtttc cagtgcagtg caggcatatc gcacaacaaa 660gtacttgcta agctggcttg
tggcttaaac aaacctaaca ggcaaacatt ggtaagccac 720ggttcagtac ctcagttgtt
tagccaaatg cctattagaa agattcgaag ccttggcggt 780aagttaggtg cttcggttat
agaaatactg ggtatagagt acatggggga gcttacccag 840tttactgaaa gccagctgca
aagccatttc ggtgaaaaaa atggcagttg gctgtatgct 900atgtgtagag gcatcgagca
cgatcctgta aagcctcggc agctgcctaa aaccataggc 960tgcagtaaaa actttcccgg
taaaacagca ttagctacca gggaacaagt acaatggtgg 1020ctgctgcagc ttgcccagga
acttgaagaa aggttaacca aagatcggaa cgataatgat 1080agggtagcaa cacaactagt
agtaagtatt cgagtacagg gagataagcg gctcagtagc 1140cttagacgat gttgtgctct
aacaaggtac gatgcacaca agatgagcca cgatgctttt 1200actgttataa agaactgtaa
cacctctggc atacaaacag agtggagccc gcccctaact 1260atgctgttcc tttgtgcaac
taagttctct gcttctgcac ccagtagcag tactgatata 1320acaagttttc tgagcagcga
cccaagtagt ttaccaaaag tacctgtaac tagtagcgaa 1380gctaaaacac agggcagtgg
accagcagtt acagctacta aaaaggctac tacaagcctc 1440gaaagcttct ttcaaaaggc
agccgagcgg caaaaggtta aggaagcaag cttaagtagt 1500ttaacagctc ctacccaagc
tcctatgagc aacagcccaa gtaagccgag tttaccattt 1560caaaccagcc agagtaccgg
tacagaacct ttctttaaac aaaaaagttt gctgcttaaa 1620cagaagcagc tgaacaacag
ctctgttagt tcaccacaac agaacccttg gagcaactgt 1680aaagctctac caaacagttt
accaacagaa tacccaggtt gtgtacctgt ttgtgaagga 1740gtaagcaagc ttgaggaaag
cagtaaggct accccagcag agatggatct agctcataac 1800agccagagca tgcatgccag
ctcagccagt aaatcagtac tagaagttac acaaaaggct 1860acaccaaacc caagcctgtt
ggcagctgaa gaccaggtac cctgcgagaa gtgtggtagc 1920cttgtacctg tatgggacat
gcctgagcac atggattacc attttgctct tgaactgcag 1980aaaagcttct tacagcccca
tagtagtaac cctcaagttg tatcagcagt aagccaccag 2040ggcaagagga atccgaagag
ccccctagca tgtacaaaca aaaggccacg gcctgaaggc 2100atgcaaacac tggagagctt
cttcaagcct ttaacacat 21393202590PRTArtificial
SequenceDescription of Artificial Sequence Pol theta sequence 320Met
Asn Leu Leu Arg Arg Ser Gly Lys Arg Arg Arg Ser Glu Ser Gly1
5 10 15Ser Asp Ser Phe Ser Gly Ser
Gly Gly Asp Ser Ser Ala Ser Pro Gln 20 25
30Phe Leu Ser Gly Ser Val Leu Ser Pro Pro Pro Gly Leu Gly
Arg Cys 35 40 45Leu Lys Ala Ala
Ala Ala Gly Glu Cys Lys Pro Thr Val Pro Asp Tyr 50 55
60Glu Ile Asp Lys Leu Leu Leu Ala Asn Trp Gly Leu Pro
Lys Ala Val65 70 75
80Leu Glu Lys Tyr His Ser Phe Gly Val Lys Lys Met Phe Glu Trp Gln
85 90 95Ala Glu Cys Leu Leu Leu
Gly Gln Val Leu Glu Gly Lys Asn Leu Val 100
105 110Tyr Ser Ala Pro Thr Ser Ala Gly Lys Thr Leu Val
Ala Glu Leu Leu 115 120 125Ile Leu
Lys Arg Val Leu Glu Met Arg Lys Lys Ala Leu Phe Ile Leu 130
135 140Pro Phe Val Ser Val Ala Lys Glu Lys Lys Tyr
Tyr Leu Gln Ser Leu145 150 155
160Phe Gln Glu Val Gly Ile Lys Val Asp Gly Tyr Met Gly Ser Thr Ser
165 170 175Pro Ser Arg His
Phe Ser Ser Leu Asp Ile Ala Val Cys Thr Ile Glu 180
185 190Arg Ala Asn Gly Leu Ile Asn Arg Leu Ile Glu
Glu Asn Lys Met Asp 195 200 205Leu
Leu Gly Met Val Val Val Asp Glu Leu His Met Leu Gly Asp Ser 210
215 220His Arg Gly Tyr Leu Leu Glu Leu Leu Leu
Thr Lys Ile Cys Tyr Ile225 230 235
240Thr Arg Lys Ser Ala Ser Cys Gln Ala Asp Leu Ala Ser Ser Leu
Ser 245 250 255Asn Ala Val
Gln Ile Val Gly Met Ser Ala Thr Leu Pro Asn Leu Glu 260
265 270Leu Val Ala Ser Trp Leu Asn Ala Glu Leu
Tyr His Thr Asp Phe Arg 275 280
285Pro Val Pro Leu Leu Glu Ser Val Lys Val Gly Asn Ser Ile Tyr Asp 290
295 300Ser Ser Met Lys Leu Val Arg Glu
Phe Glu Pro Met Leu Gln Val Lys305 310
315 320Gly Asp Glu Asp His Val Val Ser Leu Cys Tyr Glu
Thr Ile Cys Asp 325 330
335Asn His Ser Val Leu Leu Phe Cys Pro Ser Lys Lys Trp Cys Glu Lys
340 345 350Leu Ala Asp Ile Ile Ala
Arg Glu Phe Tyr Asn Leu His His Gln Ala 355 360
365Glu Gly Leu Val Lys Pro Ser Glu Cys Pro Pro Val Ile Leu
Glu Gln 370 375 380Lys Glu Leu Leu Glu
Val Met Asp Gln Leu Arg Arg Leu Pro Ser Gly385 390
395 400Leu Asp Ser Val Leu Gln Lys Thr Val Pro
Trp Gly Val Ala Phe His 405 410
415His Ala Gly Leu Thr Phe Glu Glu Arg Asp Ile Ile Glu Gly Ala Phe
420 425 430Arg Gln Gly Leu Ile
Arg Val Leu Ala Ala Thr Ser Thr Leu Ser Ser 435
440 445Gly Val Asn Leu Pro Ala Arg Arg Val Ile Ile Arg
Thr Pro Ile Phe 450 455 460Gly Gly Arg
Pro Leu Asp Ile Leu Thr Tyr Lys Gln Met Val Gly Arg465
470 475 480Ala Gly Arg Lys Gly Val Asp
Thr Val Gly Glu Ser Ile Leu Ile Cys 485
490 495Lys Asn Ser Glu Lys Ser Lys Gly Ile Ala Leu Leu
Gln Gly Ser Leu 500 505 510Lys
Pro Val Arg Ser Cys Leu Gln Arg Arg Glu Gly Glu Glu Val Thr 515
520 525Gly Ser Met Ile Arg Ala Ile Leu Glu
Ile Ile Val Gly Gly Val Ala 530 535
540Ser Thr Ser Gln Asp Met His Thr Tyr Ala Ala Cys Thr Phe Leu Ala545
550 555 560Ala Ser Met Lys
Glu Gly Lys Gln Gly Ile Gln Arg Asn Gln Glu Ser 565
570 575Val Gln Leu Gly Ala Ile Glu Ala Cys Val
Met Trp Leu Leu Glu Asn 580 585
590Glu Phe Ile Gln Ser Thr Glu Ala Ser Asp Gly Thr Glu Gly Lys Val
595 600 605Tyr His Pro Thr His Leu Gly
Ser Ala Thr Leu Ser Ser Ser Leu Ser 610 615
620Pro Ala Asp Thr Leu Asp Ile Phe Ala Asp Leu Gln Arg Ala Met
Lys625 630 635 640Gly Phe
Val Leu Glu Asn Asp Leu His Ile Leu Tyr Leu Val Thr Pro
645 650 655Met Phe Glu Asp Trp Thr Thr
Ile Asp Trp Tyr Arg Phe Phe Cys Leu 660 665
670Trp Glu Lys Leu Pro Thr Ser Met Lys Arg Val Ala Glu Leu
Val Gly 675 680 685Val Glu Glu Gly
Phe Leu Ala Arg Cys Val Lys Gly Lys Val Val Ala 690
695 700Arg Thr Glu Arg Gln His Arg Gln Met Ala Ile His
Lys Arg Phe Phe705 710 715
720Thr Ser Leu Val Leu Leu Asp Leu Ile Ser Glu Val Pro Leu Arg Glu
725 730 735Ile Asn Gln Lys Tyr
Gly Cys Asn Arg Gly Gln Ile Gln Ser Leu Gln 740
745 750Gln Ser Ala Ala Val Tyr Ala Gly Met Ile Thr Val
Phe Ser Asn Arg 755 760 765Leu Gly
Trp His Asn Met Glu Leu Leu Leu Ser Gln Phe Gln Lys Arg 770
775 780Leu Thr Phe Gly Ile Gln Arg Glu Leu Cys Asp
Leu Val Arg Val Ser785 790 795
800Leu Leu Asn Ala Gln Arg Ala Arg Val Leu Tyr Ala Ser Gly Phe His
805 810 815Thr Val Ala Asp
Leu Ala Arg Ala Asn Ile Val Glu Val Glu Val Ile 820
825 830Leu Lys Asn Ala Val Pro Phe Lys Ser Ala Arg
Lys Ala Val Asp Glu 835 840 845Glu
Glu Glu Ala Val Glu Glu Arg Arg Asn Met Arg Thr Ile Trp Val 850
855 860Thr Gly Arg Lys Gly Leu Thr Glu Arg Glu
Ala Ala Ala Leu Ile Val865 870 875
880Glu Glu Ala Arg Met Ile Leu Gln Gln Asp Leu Val Glu Met Gly
Val 885 890 895Gln Trp Asn
Pro Cys Ala Leu Leu His Ser Ser Thr Cys Ser Leu Thr 900
905 910His Ser Glu Ser Glu Val Lys Glu His Thr
Phe Ile Ser Gln Thr Lys 915 920
925Ser Ser Tyr Lys Lys Leu Thr Ser Lys Asn Lys Ser Asn Thr Ile Phe 930
935 940Ser Asp Ser Tyr Ile Lys His Ser
Pro Asn Ile Val Gln Asp Leu Asn945 950
955 960Lys Ser Arg Glu His Thr Ser Ser Phe Asn Cys Asn
Phe Gln Asn Gly 965 970
975Asn Gln Glu His Gln Thr Cys Ser Ile Phe Arg Ala Arg Lys Arg Ala
980 985 990Ser Leu Asp Ile Asn Lys
Glu Lys Pro Gly Ala Ser Gln Asn Glu Gly 995 1000
1005Lys Thr Ser Asp Lys Lys Val Val Gln Thr Phe Ser
Gln Lys Thr 1010 1015 1020Lys Lys Ala
Pro Leu Asn Phe Asn Ser Glu Lys Met Ser Arg Ser 1025
1030 1035Phe Arg Ser Trp Lys Arg Arg Lys His Leu Lys
Arg Ser Arg Asp 1040 1045 1050Ser Ser
Pro Leu Lys Asp Ser Gly Ala Cys Arg Ile His Leu Gln 1055
1060 1065Gly Gln Thr Leu Ser Asn Pro Ser Leu Cys
Glu Asp Pro Phe Thr 1070 1075 1080Leu
Asp Glu Lys Lys Thr Glu Phe Arg Asn Ser Gly Pro Phe Ala 1085
1090 1095Lys Asn Val Ser Leu Ser Gly Lys Glu
Lys Asp Asn Lys Thr Ser 1100 1105
1110Phe Pro Leu Gln Ile Lys Gln Asn Cys Ser Trp Asn Ile Thr Leu
1115 1120 1125Thr Asn Asp Asn Phe Val
Glu His Ile Val Thr Gly Ser Gln Ser 1130 1135
1140Lys Asn Val Thr Cys Gln Ala Thr Ser Val Val Ser Glu Lys
Gly 1145 1150 1155Arg Gly Val Ala Val
Glu Ala Glu Lys Ile Asn Glu Val Leu Ile 1160 1165
1170Gln Asn Gly Ser Lys Asn Gln Asn Val Tyr Met Lys His
His Asp 1175 1180 1185Ile His Pro Ile
Asn Gln Tyr Leu Arg Lys Gln Ser His Glu Gln 1190
1195 1200Thr Ser Thr Ile Thr Lys Gln Lys Asn Ile Ile
Glu Arg Gln Met 1205 1210 1215Pro Cys
Glu Ala Val Ser Ser Tyr Ile Asn Arg Asp Ser Asn Val 1220
1225 1230Thr Ile Asn Cys Glu Arg Ile Lys Leu Asn
Thr Glu Glu Asn Lys 1235 1240 1245Pro
Ser His Phe Gln Ala Leu Gly Asp Asp Ile Ser Arg Thr Val 1250
1255 1260Ile Pro Ser Glu Val Leu Pro Ser Ala
Gly Ala Phe Ser Lys Ser 1265 1270
1275Glu Gly Gln His Glu Asn Phe Leu Asn Ile Ser Arg Leu Gln Glu
1280 1285 1290Lys Thr Gly Thr Tyr Thr
Thr Asn Lys Thr Lys Asn Asn His Val 1295 1300
1305Ser Asp Leu Gly Leu Val Leu Cys Asp Phe Glu Asp Ser Phe
Tyr 1310 1315 1320Leu Asp Thr Gln Ser
Glu Lys Ile Ile Gln Gln Met Ala Thr Glu 1325 1330
1335Asn Ala Lys Leu Gly Ala Lys Asp Thr Asn Leu Ala Ala
Gly Ile 1340 1345 1350Met Gln Lys Ser
Leu Val Gln Gln Asn Ser Met Asn Ser Phe Gln 1355
1360 1365Lys Glu Cys His Ile Pro Phe Pro Ala Glu Gln
His Pro Leu Gly 1370 1375 1380Ala Thr
Lys Ile Asp His Leu Asp Leu Lys Thr Val Gly Thr Met 1385
1390 1395Lys Gln Ser Ser Asp Ser His Gly Val Asp
Ile Leu Thr Pro Glu 1400 1405 1410Ser
Pro Ile Phe His Ser Pro Ile Leu Leu Glu Glu Asn Gly Leu 1415
1420 1425Phe Leu Lys Lys Asn Glu Val Ser Val
Thr Asp Ser Gln Leu Asn 1430 1435
1440Ser Phe Leu Gln Gly Tyr Gln Thr Gln Glu Thr Val Lys Pro Val
1445 1450 1455Ile Leu Leu Ile Pro Gln
Lys Arg Thr Pro Thr Gly Val Glu Gly 1460 1465
1470Glu Cys Leu Pro Val Pro Glu Thr Ser Leu Asn Met Ser Asp
Ser 1475 1480 1485Leu Leu Phe Asp Ser
Phe Ser Asp Asp Tyr Leu Val Lys Glu Gln 1490 1495
1500Leu Pro Asp Met Gln Met Lys Glu Pro Leu Pro Ser Glu
Val Thr 1505 1510 1515Ser Asn His Phe
Ser Asp Ser Leu Cys Leu Gln Glu Asp Leu Ile 1520
1525 1530Lys Lys Ser Asn Val Asn Glu Asn Gln Asp Thr
His Gln Gln Leu 1535 1540 1545Thr Cys
Ser Asn Asp Glu Ser Ile Ile Phe Ser Glu Met Asp Ser 1550
1555 1560Val Gln Met Val Glu Ala Leu Asp Asn Val
Asp Ile Phe Pro Val 1565 1570 1575Gln
Glu Lys Asn His Thr Val Val Ser Pro Arg Ala Leu Glu Leu 1580
1585 1590Ser Asp Pro Val Leu Asp Glu His His
Gln Gly Asp Gln Asp Gly 1595 1600
1605Gly Asp Gln Asp Glu Arg Ala Glu Lys Ser Lys Leu Thr Gly Thr
1610 1615 1620Arg Gln Asn His Ser Phe
Ile Trp Ser Gly Ala Ser Phe Asp Leu 1625 1630
1635Ser Pro Gly Leu Gln Arg Ile Leu Asp Lys Val Ser Ser Pro
Leu 1640 1645 1650Glu Asn Glu Lys Leu
Lys Ser Met Thr Ile Asn Phe Ser Ser Leu 1655 1660
1665Asn Arg Lys Asn Thr Glu Leu Asn Glu Glu Gln Glu Val
Ile Ser 1670 1675 1680Asn Leu Glu Thr
Lys Gln Val Gln Gly Ile Ser Phe Ser Ser Asn 1685
1690 1695Asn Glu Val Lys Ser Lys Ile Glu Met Leu Glu
Asn Asn Ala Asn 1700 1705 1710His Asp
Glu Thr Ser Ser Leu Leu Pro Arg Lys Glu Ser Asn Ile 1715
1720 1725Val Asp Asp Asn Gly Leu Ile Pro Pro Thr
Pro Ile Pro Thr Ser 1730 1735 1740Ala
Ser Lys Leu Thr Phe Pro Gly Ile Leu Glu Thr Pro Val Asn 1745
1750 1755Pro Trp Lys Thr Asn Asn Val Leu Gln
Pro Gly Glu Ser Tyr Leu 1760 1765
1770Phe Gly Ser Pro Ser Asp Ile Lys Asn His Asp Leu Ser Pro Gly
1775 1780 1785Ser Arg Asn Gly Phe Lys
Asp Asn Ser Pro Ile Ser Asp Thr Ser 1790 1795
1800Phe Ser Leu Gln Leu Ser Gln Asp Gly Leu Gln Leu Thr Pro
Ala 1805 1810 1815Ser Ser Ser Ser Glu
Ser Leu Ser Ile Ile Asp Val Ala Ser Asp 1820 1825
1830Gln Asn Leu Phe Gln Thr Phe Ile Lys Glu Trp Arg Cys
Lys Lys 1835 1840 1845Arg Phe Ser Ile
Ser Leu Ala Cys Glu Lys Ile Arg Ser Leu Thr 1850
1855 1860Ser Ser Lys Thr Ala Thr Ile Gly Ser Arg Phe
Lys Gln Ala Ser 1865 1870 1875Ser Pro
Gln Glu Ile Pro Ile Arg Asp Asp Gly Phe Pro Ile Lys 1880
1885 1890Gly Cys Asp Asp Thr Leu Val Val Gly Leu
Ala Val Cys Trp Gly 1895 1900 1905Gly
Arg Asp Ala Tyr Tyr Phe Ser Leu Gln Lys Glu Gln Lys His 1910
1915 1920Ser Glu Ile Ser Ala Ser Leu Val Pro
Pro Ser Leu Asp Pro Ser 1925 1930
1935Leu Thr Leu Lys Asp Arg Met Trp Tyr Leu Gln Ser Cys Leu Arg
1940 1945 1950Lys Glu Ser Asp Lys Glu
Cys Ser Val Val Ile Tyr Asp Phe Ile 1955 1960
1965Gln Ser Tyr Lys Ile Leu Leu Leu Ser Cys Gly Ile Ser Leu
Glu 1970 1975 1980Gln Ser Tyr Glu Asp
Pro Lys Val Ala Cys Trp Leu Leu Asp Pro 1985 1990
1995Asp Ser Gln Glu Pro Thr Leu His Ser Ile Val Thr Ser
Phe Leu 2000 2005 2010Pro His Glu Leu
Pro Leu Leu Glu Gly Met Glu Thr Ser Gln Gly 2015
2020 2025Ile Gln Ser Leu Gly Leu Asn Ala Gly Ser Glu
His Ser Gly Arg 2030 2035 2040Tyr Arg
Ala Ser Val Glu Ser Ile Leu Ile Phe Asn Ser Met Asn 2045
2050 2055Gln Leu Asn Ser Leu Leu Gln Lys Glu Asn
Leu Gln Asp Val Phe 2060 2065 2070Arg
Lys Val Glu Met Pro Ser Gln Tyr Cys Leu Ala Leu Leu Glu 2075
2080 2085Leu Asn Gly Ile Gly Phe Ser Thr Ala
Glu Cys Glu Ser Gln Lys 2090 2095
2100His Ile Met Gln Ala Lys Leu Asp Ala Ile Glu Thr Gln Ala Tyr
2105 2110 2115Gln Leu Ala Gly His Ser
Phe Ser Phe Thr Ser Ser Asp Asp Ile 2120 2125
2130Ala Glu Val Leu Phe Leu Glu Leu Lys Leu Pro Pro Asn Arg
Glu 2135 2140 2145Met Lys Asn Gln Gly
Ser Lys Lys Thr Leu Gly Ser Thr Arg Arg 2150 2155
2160Gly Ile Asp Asn Gly Arg Lys Leu Arg Leu Gly Arg Gln
Phe Ser 2165 2170 2175Thr Ser Lys Asp
Val Leu Asn Lys Leu Lys Ala Leu His Pro Leu 2180
2185 2190Pro Gly Leu Ile Leu Glu Trp Arg Arg Ile Thr
Asn Ala Ile Thr 2195 2200 2205Lys Val
Val Phe Pro Leu Gln Arg Glu Lys Cys Leu Asn Pro Phe 2210
2215 2220Leu Gly Met Glu Arg Ile Tyr Pro Val Ser
Gln Ser His Thr Ala 2225 2230 2235Thr
Gly Arg Ile Thr Phe Thr Glu Pro Asn Ile Gln Asn Val Pro 2240
2245 2250Arg Asp Phe Glu Ile Lys Met Pro Thr
Leu Val Gly Glu Ser Pro 2255 2260
2265Pro Ser Gln Ala Val Gly Lys Gly Leu Leu Pro Met Gly Arg Gly
2270 2275 2280Lys Tyr Lys Lys Gly Phe
Ser Val Asn Pro Arg Cys Gln Ala Gln 2285 2290
2295Met Glu Glu Arg Ala Ala Asp Arg Gly Met Pro Phe Ser Ile
Ser 2300 2305 2310Met Arg His Ala Phe
Val Pro Phe Pro Gly Gly Ser Ile Leu Ala 2315 2320
2325Ala Asp Tyr Ser Gln Leu Glu Leu Arg Ile Leu Ala His
Leu Ser 2330 2335 2340His Asp Arg Arg
Leu Ile Gln Val Leu Asn Thr Gly Ala Asp Val 2345
2350 2355Phe Arg Ser Ile Ala Ala Glu Trp Lys Met Ile
Glu Pro Glu Ser 2360 2365 2370Val Gly
Asp Asp Leu Arg Gln Gln Ala Lys Gln Ile Cys Tyr Gly 2375
2380 2385Ile Ile Tyr Gly Met Gly Ala Lys Ser Leu
Gly Glu Gln Met Gly 2390 2395 2400Ile
Lys Glu Asn Asp Ala Ala Cys Tyr Ile Asp Ser Phe Lys Ser 2405
2410 2415Arg Tyr Thr Gly Ile Asn Gln Phe Met
Thr Glu Thr Val Lys Asn 2420 2425
2430Cys Lys Arg Asp Gly Phe Val Gln Thr Ile Leu Gly Arg Arg Arg
2435 2440 2445Tyr Leu Pro Gly Ile Lys
Asp Asn Asn Pro Tyr Arg Lys Ala His 2450 2455
2460Ala Glu Arg Gln Ala Ile Asn Thr Ile Val Gln Gly Ser Ala
Ala 2465 2470 2475Asp Ile Val Lys Ile
Ala Thr Val Asn Ile Gln Lys Gln Leu Glu 2480 2485
2490Thr Phe His Ser Thr Phe Lys Ser His Gly His Arg Glu
Gly Met 2495 2500 2505Leu Gln Ser Asp
Gln Thr Gly Leu Ser Arg Lys Arg Lys Leu Gln 2510
2515 2520Gly Met Phe Cys Pro Ile Arg Gly Gly Phe Phe
Ile Leu Gln Leu 2525 2530 2535His Asp
Glu Leu Leu Tyr Glu Val Ala Glu Glu Asp Val Val Gln 2540
2545 2550Val Ala Gln Ile Val Lys Asn Glu Met Glu
Ser Ala Val Lys Leu 2555 2560 2565Ser
Val Lys Leu Lys Val Lys Val Lys Ile Gly Ala Ser Trp Gly 2570
2575 2580Glu Leu Lys Asp Phe Asp Val 2585
25903217770DNAArtificial SequenceDescription of Artificial
Sequence Pol theta sequence 321atgaacctgc tgagaagatc cggcaaaagg
aggagaagcg agtccgggtc tgattccttc 60agcggctccg gtggggactc cagcgcttct
cctcagttcc tatccggctc agtcctgtcc 120ccgccgcccg ggctggggcg atgtctgaag
gcggcagccg ccggcgaatg caaaccgaca 180gtgcctgact acgagatcga caagttactc
ctggcaaatt ggggtctgcc caaggccgtg 240ttagagaaat accattcctt tggtgtgaaa
aaaatgttcg agtggcaagc agagtgtttg 300ctgttggggc aggtgttgga ggggaagaac
ctcgtgtaca gtgctccgac ttctgccggt 360aagactctgg ttgccgagct gctgattctt
aaaagggtcc tggagatgag gaaaaaagcc 420ttgtttattc tgcccttcgt cagcgttgca
aaggagaaaa aatactatct gcagtctctc 480ttccaagagg tcggaatcaa ggtggacggt
tacatgggtt ctacctctcc atctcggcat 540ttctcaagtc tagacatcgc cgtgtgtacc
atcgagcgcg ctaatggact gatcaatcgc 600cttatcgagg agaacaaaat ggacttgctg
ggcatggtag tggtagacga actgcatatg 660ctgggcgaca gtcaccgtgg atacctgctc
gaactgctac tgactaagat ttgttacata 720actcgaaaat ccgcttcttg tcaggctgac
ctcgcaagtt ccttgagcaa tgctgtccag 780atcgtgggca tgtccgctac actgcctaat
cttgagttgg tggctagctg gttaaacgct 840gaactgtacc acaccgattt taggccagtc
cccctgctag aatctgtcaa ggtgggcaac 900tctatttatg attcttctat gaaactggtc
cgcgaattcg agcccatgct gcaggtgaaa 960ggtgacgaag atcatgtcgt tagtctttgc
tatgaaacca tctgcgacaa tcacagcgtg 1020ctactctttt gcccctcaaa gaagtggtgt
gaaaagttgg ctgatataat tgcccgggag 1080ttttataatc tgcatcacca ggccgagggt
ctagtgaaac caagcgagtg cccccccgtt 1140attctggaac agaaggaatt actcgaggtt
atggatcagc taagaaggct gccgagcggg 1200cttgattccg tcctgcagaa gaccgtgccc
tggggcgtcg cctttcacca cgcaggtctc 1260acattcgagg agagagacat aatagagggc
gccttccgcc aaggcctgat cagggtgctg 1320gccgccactt caactcttag ctcaggggtc
aatctacccg ctcggagggt gatcatccgc 1380actcctattt ttggcggcag gcccctggat
atcctgactt acaagcaaat ggtcggacgc 1440gccggccgga agggggtcga caccgtcgga
gaaagtatct taatttgtaa aaattctgag 1500aaaagcaagg gcattgcgct gctacagggc
tccctcaaac ccgtacgctc atgtctgcag 1560cggcgcgaag gagaagaggt taccggaagc
atgattagag ctatattgga aataatagtg 1620ggcggggtgg cttcaacatc acaggacatg
catacatatg ctgcgtgcac attccttgct 1680gcctccatga aggagggcaa gcagggcatc
cagcgaaacc aagagtcggt gcagctgggg 1740gccattgagg cctgcgtcat gtggctgctg
gagaatgaat ttatccaatc aacagaggca 1800agtgatggaa ctgagggcaa ggtataccat
ccaacccact taggcagcgc aacactgtct 1860tcttctctga gccccgccga tacccttgat
atattcgcag atttgcagcg cgcgatgaag 1920gggttcgtgc tggaaaacga tctgcacata
ctttatcttg ttaccccaat gttcgaggac 1980tggaccacaa tcgattggta taggtttttt
tgcctgtggg aaaaactgcc cacgtcaatg 2040aaaagggtcg ccgagctggt tggggtggag
gaaggcttcc tggcccggtg cgttaaaggg 2100aaggtggtag ctcgaactga gagacagcac
cgacaaatgg caattcataa gcgctttttt 2160acaagtttgg tcctgctcga cctcatcagt
gaagtacctc tgagagagat caaccagaaa 2220tatgggtgta atagggggca gatacagtct
ctgcagcaga gcgctgcagt gtacgcaggc 2280atgatcacag tcttctccaa tcgccttgga
tggcacaata tggagttgct cctctcccag 2340tttcaaaaac ggctgacctt tggcatccag
cgggagctct gcgatctagt tagggtgtca 2400cttctgaacg cccagcgggc tcgggtgctc
tatgcttctg gtttccatac ggttgcagac 2460ctcgcgcgcg ccaatatcgt cgaagtcgag
gtgatcctga aaaatgccgt accattcaag 2520tccgcccgca aagccgtcga tgaggaagag
gaagccgttg aggaacgacg aaacatgaga 2580accatttggg taacagggcg taagggcctc
acagagagag aggccgccgc ccttatcgtc 2640gaagaggcac ggatgatatt acagcaggac
ttggtggaaa tgggggttca atggaacccc 2700tgcgcgctcc tacattccag tacttgctca
ttgacccata gcgaatccga ggttaaagag 2760cacacattca tttcccagac aaaatcttcc
tacaaaaaac ttacatctaa aaataaatcc 2820aacactatat tctctgactc gtatattaaa
cactccccta atatcgtgca agaccttaac 2880aaatctcggg agcacacgtc ttcgtttaat
tgcaatttcc agaacggcaa tcaggaacat 2940cagacctgtt ctattttcag ggccaggaag
agagctagct tagacatcaa taaagaaaag 3000cctggggcct cccagaatga gggtaagact
agcgataaga aggtggttca aacatttagc 3060cagaagacca agaaagctcc actcaatttt
aacagcgaga aaatgagccg atctttcaga 3120tcatggaaaa gacgtaagca cctgaaacgg
agcagagact cgtcaccgtt gaaggactct 3180ggggcatgtc gcattcacct gcaaggccaa
actttatcaa atccctcact ttgtgaggac 3240ccatttaccc ttgatgaaaa gaaaaccgag
ttcaggaact ccggcccctt tgccaaaaac 3300gtgagtctaa gcggcaaaga gaaagacaat
aagacctctt ttcccttgca gattaagcaa 3360aactgtagtt ggaatatcac tctcacgaat
gataacttcg ttgagcacat cgtgacaggg 3420agtcagagta aaaatgttac ctgccaagcc
acctctgtag tgagcgaaaa agggcggggg 3480gttgccgtgg aggccgagaa gattaacgag
gtcctgatac agaacggatc aaagaatcag 3540aatgtataca tgaaacatca tgatattcac
cccatcaacc agtatctgcg caagcagtca 3600cacgagcaaa cgtctacgat taccaagcag
aaaaacatca ttgaaaggca aatgccctgc 3660gaggcagtca gctcttatat taacagggac
tctaatgtaa ctattaattg tgagcgtatc 3720aagttgaaca ccgaggagaa taagccatca
catttccagg ccttgggtga cgatatctca 3780cgcaccgtga tccctagcga ggtgttacca
tctgcaggtg ctttctcaaa gtccgaaggc 3840cagcatgaga atttcctgaa catcagcagg
ctacaggaaa agacaggcac ttacaccacg 3900aacaaaacca agaacaatca tgtgagtgac
ctaggtctgg tcctgtgcga cttcgaagat 3960agtttctact tggacaccca gtccgagaaa
atcattcagc agatggccac ggagaatgct 4020aaactggggg ctaaggacac caatctggcc
gccggcatca tgcagaagtc actggtgcag 4080cagaacagca tgaatagttt tcaaaaggag
tgccatatcc catttcctgc agagcagcac 4140ccgttggggg ccaccaaaat agaccatttg
gatcttaaga ctgtgggcac aatgaagcag 4200tcatctgact cacacggcgt cgatatcctg
actcctgaaa gtccgatttt tcactcacca 4260atcctactgg aggagaacgg cttattcctg
aaaaagaatg aagtaagtgt cacagactcc 4320cagttgaact cctttctgca gggctatcag
acccaggaga ctgtgaaacc tgtgatcttg 4380ctcataccac agaagagaac tcccacgggt
gtcgaggggg agtgcctccc agttcccgaa 4440acgtctctca acatgagtga tagtttactt
tttgactcat ttagtgatga ttacctcgtg 4500aaagaacagc ttccagacat gcagatgaag
gagcctctcc ccagcgaggt gacatcaaac 4560cacttttcag attccttatg tcttcaggag
gacctgatca aaaagtctaa tgtaaacgaa 4620aatcaggaca cgcatcaaca actcacctgt
tctaatgatg agagcatcat attttccgag 4680atggactctg tccagatggt cgaagccctg
gacaacgtag atatctttcc cgtgcaggaa 4740aagaatcata ctgtcgtgtc gcctcgtgcc
cttgagttaa gtgaccccgt cttagacgag 4800caccaccagg gcgaccagga cggcggcgac
caggacgaaa gggctgagaa gagcaagctg 4860acgggcacac ggcagaacca ttccttcatt
tggtccggcg cctcatttga tttgtctccc 4920gggctccagc gcatcctcga caaagtgagt
tcccccctgg aaaacgaaaa acttaagagc 4980atgaccatca acttttcaag tctgaaccga
aagaataccg agttgaatga agaacaggaa 5040gttattagta atcttgaaac aaaacaagtg
caaggcatta gctttagctc aaataacgag 5100gtcaagagca aaatcgagat gttagagaat
aacgcaaatc acgacgagac gtcctcccta 5160ctgccccgga aagagtctaa tatcgtggat
gacaacggac tgattccccc tacacctatc 5220cctacctcag cctctaagct taccttcccc
ggcatccttg aaaccccagt gaacccgtgg 5280aaaaccaata acgttctgca gcctggcgag
agttatttat ttggcagccc gtccgatatt 5340aaaaaccatg atctgtcccc gggttcccga
aatggcttca aggacaacag cccaatcagc 5400gacacaagct tttcgttgca attgtctcag
gacgggctcc agctcactcc tgctagttcc 5460agttctgaat ctttgagcat aatagacgtt
gctagcgatc aaaacctctt tcagacgttc 5520attaaagagt ggcgctgcaa aaaacggttc
tccatatccc tcgcctgcga gaaaattcga 5580agcttaacgt cttccaagac agccaccatc
gggagtcgct ttaagcaagc ctcttctccc 5640caggaaatcc ctatccgtga cgatggcttt
cctattaaag gttgtgatga cactctagtg 5700gtgggcctgg ccgtctgttg gggaggccga
gacgcctact atttctctct gcagaaagaa 5760cagaagcaca gtgaaattag tgcctccctg
gtccccccat cccttgatcc ctcactcacc 5820ctgaaggatc gaatgtggta cctgcagagt
tgcttgcgta aagaaagcga taaggagtgt 5880agcgtggtca tctacgattt tattcagtca
tacaaaatac tcctgctgag ttgtggaatc 5940agtttagagc agtcctatga ggatcccaag
gtggcctgct ggttgcttga ccccgattct 6000caggaaccta ccctgcatag catcgtaacc
agctttctac ctcatgaact gcctcttctg 6060gagggcatgg aaacaagcca gggcattcaa
tctctgggcc tcaacgctgg atctgagcac 6120agcggccgtt atagagccag cgtggaaagc
attcttattt tcaactccat gaatcagttg 6180aatagcctgc tccaaaaaga gaacctccaa
gacgtgttta ggaaggtcga aatgcctagc 6240cagtactgtc tggctctgct ggaactcaac
ggcatcgggt tttctacggc tgagtgtgag 6300tcccagaaac acataatgca agcgaagctg
gacgctattg aaacccaggc ttaccagcta 6360gctggacact cattctcctt tacttcaagc
gatgacatag ctgaggtgct ttttttagaa 6420cttaaattgc cccccaaccg ggaaatgaag
aaccaaggct ctaaaaaaac attagggtca 6480actcgcaggg gtatcgacaa tgggcgtaaa
ttgcggctgg ggcggcagtt ctctacgtca 6540aaggatgttt tgaacaaact gaaggctctg
caccccctcc ctgggctgat actggaatgg 6600aggcgtatca ccaacgctat cacgaaagtg
gtgtttcctc tgcaacgaga gaaatgtctg 6660aatccgttcc tgggtatgga gagaatttat
cctgtctcac agtcgcatac tgctacagga 6720agaattacct tcacggagcc aaacatccag
aatgtgccta gggacttcga aatcaagatg 6780cctacactgg tgggggagag ccctcctagt
caggctgtgg gaaaggggct gctaccgatg 6840ggtcggggta aatacaaaaa ggggttttca
gtgaacccac gttgtcaggc acagatggag 6900gaacgggctg ctgatcgggg tatgccattc
agcatatcca tgagacacgc gttcgtgcca 6960ttccccgggg gatcaatact ggcagcagat
tattcccagc tggagctccg tattttagca 7020catctgtccc acgaccgacg tctgatccag
gttcttaaca caggggccga cgtgttcaga 7080tccatcgctg ccgagtggaa aatgattgag
ccagagtcag tcggcgatga cctgcgtcag 7140caagccaagc agatatgcta tggtattatc
tacgggatgg gtgccaaatc cctcggggag 7200cagatgggca tcaaggagaa cgatgccgcc
tgctacattg actctttcaa gagccgctac 7260accgggataa atcagttcat gaccgaaact
gttaagaact gtaagcgaga cggctttgtg 7320caaacaattc ttggaagaag gaggtacctg
cccggtatta aggataacaa tccttatcgc 7380aaagctcacg ccgaacgcca ggccataaat
actatagtcc aaggctcagc tgccgatatt 7440gtcaaaatcg ccacggtcaa cattcagaaa
cagctggaaa catttcattc aactttcaag 7500tcgcacggcc accgggaggg catgctgcaa
tctgatcaga ccggccttag caggaagagg 7560aaactgcagg gcatgttctg tcccattcga
ggcgggttct tcattctgca gttacacgac 7620gaactgctgt acgaggtcgc tgaggaggac
gtcgtccagg tggcacagat cgtaaagaat 7680gagatggaat cggctgtgaa attatccgtg
aagcttaaag taaaggtgaa gataggcgcc 7740tcctgggggg aattgaagga tttcgacgtc
77703227770DNAArtificial
SequenceDescription of Artificial Sequence Synthetic construct
322atgaacctgc tgagaagatc cggcaaaagg aggagaagcg agtccgggtc tgattccttc
60agcggctccg gtggggactc cagcgcttct cctcagttcc tatccggctc agtcctgtcc
120ccgccgcccg ggctggggcg atgtctgaag gcggcagccg ccggcgaatg caaaccgaca
180gtgcctgact acgagatcga caagttactc ctggcaaatt ggggtctgcc caaggccgtg
240ttagagaaat accattcctt tggtgtgaaa aaaatgttcg agtggcaagc agagtgtttg
300ctgttggggc aggtgttgga ggggaagaac ctcgtgtaca gtgctccgac ttctgccggt
360aagactctgg ttgccgagct gctgattctt aaaagggtcc tggagatgag gaaaaaagcc
420ttgtttattc tgcccttcgt cagcgttgca aaggagaaaa aatactatct gcagtctctc
480ttccaagagg tcggaatcaa ggtggacggt tacatgggtt ctacctctcc atctcggcat
540ttctcaagtc tagacatcgc cgtgtgtacc atcgagcgcg ctaatggact gatcaatcgc
600cttatcgagg agaacaaaat ggacttgctg ggcatggtag tggtagacga actgcatatg
660ctgggcgaca gtcaccgtgg atacctgctc gaactgctac tgactaagat ttgttacata
720actcgaaaat ccgcttcttg tcaggctgac ctcgcaagtt ccttgagcaa tgctgtccag
780atcgtgggca tgtccgctac actgcctaat cttgagttgg tggctagctg gttaaacgct
840gaactgtacc acaccgattt taggccagtc cccctgctag aatctgtcaa ggtgggcaac
900tctatttatg attcttctat gaaactggtc cgcgaattcg agcccatgct gcaggtgaaa
960ggtgacgaag atcatgtcgt tagtctttgc tatgaaacca tctgcgacaa tcacagcgtg
1020ctactctttt gcccctcaaa gaagtggtgt gaaaagttgg ctgatataat tgcccgggag
1080ttttataatc tgcatcacca ggccgagggt ctagtgaaac caagcgagtg cccccccgtt
1140attctggaac agaaggaatt actcgaggtt atggatcagc taagaaggct gccgagcggg
1200cttgattccg tcctgcagaa gaccgtgccc tggggcgtcg cctttcacca cgcaggtctc
1260acattcgagg agagagacat aatagagggc gccttccgcc aaggcctgat cagggtgctg
1320gccgccactt caactcttag ctcaggggtc aatctacccg ctcggagggt gatcatccgc
1380actcctattt ttggcggcag gcccctggat atcctgactt acaagcaaat ggtcggacgc
1440gccggccgga agggggtcga caccgtcgga gaaagtatct taatttgtaa aaattctgag
1500aaaagcaagg gcattgcgct gctacagggc tccctcaaac ccgtacgctc atgtctgcag
1560cggcgcgaag gagaagaggt taccggaagc atgattagag ctatattgga aataatagtg
1620ggcggggtgg cttcaacatc acaggacatg catacatatg ctgcgtgcac attccttgct
1680gcctccatga aggagggcaa gcagggcatc cagcgaaacc aagagtcggt gcagctgggg
1740gccattgagg cctgcgtcat gtggctgctg gagaatgaat ttatccaatc aacagaggca
1800agtgatggaa ctgagggcaa ggtataccat ccaacccact taggcagcgc aacactgtct
1860tcttctctga gccccgccga tacccttgat atattcgcag atttgcagcg cgcgatgaag
1920gggttcgtgc tggaaaacga tctgcacata ctttatcttg ttaccccaat gttcgaggac
1980tggaccacaa tcgattggta taggtttttt tgcctgtggg aaaaactgcc cacgtcaatg
2040aaaagggtcg ccgagctggt tggggtggag gaaggcttcc tggcccggtg cgttaaaggg
2100aaggtggtag ctcgaactga gagacagcac cgacaaatgg caattcataa gcgctttttt
2160acaagtttgg tcctgctcga cctcatcagt gaagtacctc tgagagagat caaccagaaa
2220tatgggtgta atagggggca gatacagtct ctgcagcaga gcgctgcagt gtacgcaggc
2280atgatcacag tcttctccaa tcgccttgga tggcacaata tggagttgct cctctcccag
2340tttcaaaaac ggctgacctt tggcatccag cgggagctct gcgatctagt tagggtgtca
2400cttctgaacg cccagcgggc tcgggtgctc tatgcttctg gtttccatac ggttgcagac
2460ctcgcgcgcg ccaatatcgt cgaagtcgag gtgatcctga aaaatgccgt accattcaag
2520tccgcccgca aagccgtcga tgaggaagag gaagccgttg aggaacgacg aaacatgaga
2580accatttggg taacagggcg taagggcctc acagagagag aggccgccgc ccttatcgtc
2640gaagaggcac ggatgatatt acagcaggac ttggtggaaa tgggggttca atggaacccc
2700tgcgcgctcc tacattccag tacttgctca ttgacccata gcgaatccga ggttaaagag
2760cacacattca tttcccagac aaaatcttcc tacaaaaaac ttacatctaa aaataaatcc
2820aacactatat tctctgactc gtatattaaa cactccccta atatcgtgca agaccttaac
2880aaatctcggg agcacacgtc ttcgtttaat tgcaatttcc agaacggcaa tcaggaacat
2940cagacctgtt ctattttcag ggccaggaag agagctagct tagacatcaa taaagaaaag
3000cctggggcct cccagaatga gggtaagact agcgataaga aggtggttca aacatttagc
3060cagaagacca agaaagctcc actcaatttt aacagcgaga aaatgagccg atctttcaga
3120tcatggaaaa gacgtaagca cctgaaacgg agcagagact cgtcaccgtt gaaggactct
3180ggggcatgtc gcattcacct gcaaggccaa actttatcaa atccctcact ttgtgaggac
3240ccatttaccc ttgatgaaaa gaaaaccgag ttcaggaact ccggcccctt tgccaaaaac
3300gtgagtctaa gcggcaaaga gaaagacaat aagacctctt ttcccttgca gattaagcaa
3360aactgtagtt ggaatatcac tctcacgaat gataacttcg ttgagcacat cgtgacaggg
3420agtcagagta aaaatgttac ctgccaagcc acctctgtag tgagcgaaaa agggcggggg
3480gttgccgtgg aggccgagaa gattaacgag gtcctgatac agaacggatc aaagaatcag
3540aatgtataca tgaaacatca tgatattcac cccatcaacc agtatctgcg caagcagtca
3600cacgagcaaa cgtctacgat taccaagcag aaaaacatca ttgaaaggca aatgccctgc
3660gaggcagtca gctcttatat taacagggac tctaatgtaa ctattaattg tgagcgtatc
3720aagttgaaca ccgaggagaa taagccatca catttccagg ccttgggtga cgatatctca
3780cgcaccgtga tccctagcga ggtgttacca tctgcaggtg ctttctcaaa gtccgaaggc
3840cagcatgaga atttcctgaa catcagcagg ctacaggaaa agacaggcac ttacaccacg
3900aacaaaacca agaacaatca tgtgagtgac ctaggtctgg tcctgtgcga cttcgaagat
3960agtttctact tggacaccca gtccgagaaa atcattcagc agatggccac ggagaatgct
4020aaactggggg ctaaggacac caatctggcc gccggcatca tgcagaagtc actggtgcag
4080cagaacagca tgaatagttt tcaaaaggag tgccatatcc catttcctgc agagcagcac
4140ccgttggggg ccaccaaaat agaccatttg gatcttaaga ctgtgggcac aatgaagcag
4200tcatctgact cacacggcgt cgatatcctg actcctgaaa gtccgatttt tcactcacca
4260atcctactgg aggagaacgg cttattcctg aaaaagaatg aagtaagtgt cacagactcc
4320cagttgaact cctttctgca gggctatcag acccaggaga ctgtgaaacc tgtgatcttg
4380ctcataccac agaagagaac tcccacgggt gtcgaggggg agtgcctccc agttcccgaa
4440acgtctctca acatgagtga tagtttactt tttgactcat ttagtgatga ttacctcgtg
4500aaagaacagc ttccagacat gcagatgaag gagcctctcc ccagcgaggt gacatcaaac
4560cacttttcag attccttatg tcttcaggag gacctgatca aaaagtctaa tgtaaacgaa
4620aatcaggaca cgcatcaaca actcacctgt tctaatgatg agagcatcat attttccgag
4680atggactctg tccagatggt cgaagccctg gacaacgtag atatctttcc cgtgcaggaa
4740aagaatcata ctgtcgtgtc gcctcgtgcc cttgagttaa gtgaccccgt cttagacgag
4800caccaccagg gcgaccagga cggcggcgac caggacgaaa gggctgagaa gagcaagctg
4860acgggcacac ggcagaacca ttccttcatt tggtccggcg cctcatttga tttgtctccc
4920gggctccagc gcatcctcga caaagtgagt tcccccctgg aaaacgaaaa acttaagagc
4980atgaccatca acttttcaag tctgaaccga aagaataccg agttgaatga agaacaggaa
5040gttattagta atcttgaaac aaaacaagtg caaggcatta gctttagctc aaataacgag
5100gtcaagagca aaatcgagat gttagagaat aacgcaaatc acgacgagac gtcctcccta
5160ctgccccgga aagagtctaa tatcgtggat gacaacggac tgattccccc tacacctatc
5220cctacctcag cctctaagct taccttcccc ggcatccttg aaaccccagt gaacccgtgg
5280aaaaccaata acgttctgca gcctggcgag agttatttat ttggcagccc gtccgatatt
5340aaaaaccatg atctgtcccc gggttcccga aatggcttca aggacaacag cccaatcagc
5400gacacaagct tttcgttgca attgtctcag gacgggctcc agctcactcc tgctagttcc
5460agttctgaat ctttgagcat aatagacgtt gctagcgatc aaaacctctt tcagacgttc
5520attaaagagt ggcgctgcaa aaaacggttc tccatatccc tcgcctgcga gaaaattcga
5580agcttaacgt cttccaagac agccaccatc gggagtcgct ttaagcaagc ctcttctccc
5640caggaaatcc ctatccgtga cgatggcttt cctattaaag gttgtgatga cactctagtg
5700gtgggcctgg ccgtctgttg gggaggccga gacgcctact atttctctct gcagaaagaa
5760cagaagcaca gtgaaattag tgcctccctg gtccccccat cccttgatcc ctcactcacc
5820ctgaaggatc gaatgtggta cctgcagagt tgcttgcgta aagaaagcga taaggagtgt
5880agcgtggtca tctacgattt tattcagtca tacaaaatac tcctgctgag ttgtggaatc
5940agtttagagc agtcctatga ggatcccaag gtggcctgct ggttgcttga ccccgattct
6000caggaaccta ccctgcatag catcgtaacc agctttctac ctcatgaact gcctcttctg
6060gagggcatgg aaacaagcca gggcattcaa tctctgggcc tcaacgctgg atctgagcac
6120agcggccgtt atagagccag cgtggaaagc attcttattt tcaactccat gaatcagttg
6180aatagcctgc tccaaaaaga gaacctccaa gacgtgttta ggaaggtcga aatgcctagc
6240cagtactgtc tggctctgct ggaactcaac ggcatcgggt tttctacggc tgagtgtgag
6300tcccagaaac acataatgca agcgaagctg gacgctattg aaacccaggc ttaccagcta
6360gctggacact cattctcctt tacttcaagc gatgacatag ctgaggtgct ttttttagaa
6420cttaaattgc cccccaaccg ggaaatgaag aaccaaggct ctaaaaaaac attagggtca
6480actcgcaggg gtatcgacaa tgggcgtaaa ttgcggctgg ggcggcagtt ctctacgtca
6540aaggatgttt tgaacaaact gaaggctctg caccccctcc ctgggctgat actggaatgg
6600aggcgtatca ccaacgctat cacgaaagtg gtgtttcctc tgcaacgaga gaaatgtctg
6660aatccgttcc tgggtatgga gagaatttat cctgtctcac agtcgcatac tgctacagga
6720agaattacct tcacggagcc aaacatccag aatgtgccta gggacttcga aatcaagatg
6780cctacactgg tgggggagag ccctcctagt caggctgtgg gaaaggggct gctaccgatg
6840ggtcggggta aatacaaaaa ggggttttca gtgaacccac gttgtcaggc acagatggag
6900gaacgggctg ctgatcgggg tatgccattc agcatatcca tgagacacgc gttcgtgcca
6960ttccccgggg gatcaatact ggcagcagat tattcccagc tggagctccg tattttagca
7020catctgtccc acgaccgacg tctgatccag gttcttaaca caggggccga cgtgttcaga
7080tccatcgctg ccgagtggaa aatgattgag ccagagtcag tcggcgatga cctgcgtcag
7140caagccaagc agatatgcta tggtattatc tacgggatgg gtgccaaatc cctcggggag
7200cagatgggca tcaaggagaa cgatgccgcc tgctacattg actctttcaa gagccgctac
7260accgggataa atcagttcat gaccgaaact gttaagaact gtaagcgaga cggctttgtg
7320caaacaattc ttggaagaag gaggtacctg cccggtatta aggataacaa tccttatcgc
7380aaagctcacg ccgaacgcca ggccataaat actatagtcc aaggctcagc tgccgatatt
7440gtcaaaatcg ccacggtcaa cattcagaaa cagctggaaa catttcattc aactttcaag
7500tcgcacggcc accgggaggg catgctgcaa tctgatcaga ccggccttag caggaagagg
7560aaactgcagg gcatgttctg tcccattcga ggcgggttct tcattctgca gttacacgac
7620gaactgctgt acgaggtcgc tgaggaggac gtcgtccagg tggcacagat cgtaaagaat
7680gagatggaat cggctgtgaa attatccgtg aagcttaaag taaaggtgaa gataggcgcc
7740tcctgggggg aattgaagga tttcgacgtc
77703237770DNAArtificial SequenceDescription of Artificial Sequence
Synthetic construct 323atgaacctgt tacgaaggtc aggtaaacgt cgaaggtcag
aatcaggttc agacagcttt 60agtggttccg gtggtgatag ctctgcaagt ccacagttct
tgagcggctc agtactaagc 120ccaccaccag gcttgggtag atgcctcaaa gcagcagccg
caggggagtg taaaccaact 180gttcctgact acgagattga taaactactg ttggctaact
ggggtttgcc taaagcagta 240cttgaaaagt accatagctt tggtgttaag aagatgtttg
aatggcaggc tgaatgcctg 300ctgttggggc aagttctgga aggtaaaaac ttggtataca
gtgcacctac ctcggcaggc 360aaaacccttg tcgcagagct cctgatacta aaacgcgtgc
tcgaaatgcg gaagaaagct 420ctctttatct tgcctttcgt gtcagtagct aaggagaaga
agtactacct gcaaagcttg 480tttcaggaag tgggcatcaa agtagacgga tacatgggta
gtacatcacc aagcaggcac 540tttagtagct tggacatcgc agtctgtacc atcgaaaggg
ctaatggctt aatcaacaga 600ctgattgaag agaacaagat ggacctgttg gggatggtgg
ttgtagacga gttgcacatg 660ctgggcgaca gccacagggg gtacctcctg gaactgctgc
taaccaaaat ctgctacatt 720accaggaaaa gtgctagctg ccaagctgat ctcgccagta
gtttgagcaa tgcagtacag 780attgttggca tgtcggcaac cttgccaaac ctagagctcg
tggctagctg gttgaatgct 840gaactgtacc acactgactt caggccggta ccactgctcg
aatcggttaa agttggcaac 900agcatctatg atagcagcat gaagttggtt cgtgagtttg
agccaatgtt acaagtcaaa 960ggcgatgagg atcatgtagt ttctctatgc tacgaaacca
tctgcgataa ccactctgta 1020ctgctgtttt gccccagtaa aaagtggtgt gaaaagcttg
cagatatcat cgcgcgtgag 1080ttttacaacc tgcaccatca agccgagggt ttggtaaagc
cctctgaatg ccctccagta 1140atacttgaac agaaggagct gctggaagtg atggaccagt
tgcgaaggct accatctggc 1200ttagactcag tactacagaa aacagtacct tggggtgtag
ccttccacca tgccggctta 1260acattcgaag aaagagatat tatagagggt gctttcaggc
agggcttaat cagagtgttg 1320gcagcaacat caaccttaag ttcaggtgta aatttgccgg
caaggagggt tatcatccgt 1380actcctatct ttggaggtag accgctggac atactgacat
acaaacagat ggtcggtaga 1440gcaggcagga agggtgttga tactgtaggc gaaagcatac
tgatatgtaa aaacagcgag 1500aaaagcaagg gtatagcatt actacaaggt agccttaaac
ctgtcagaag ctgcctgcag 1560cgacgcgaag gagaggaagt aaccggtagc atgatacgag
ctatacttga gatcattgta 1620ggcggtgttg ctagtaccag tcaggatatg catacatatg
ctgcctgtac tttcttggct 1680gccagtatga aagaggggaa gcagggtata caacgcaacc
aggaatcggt acagctcgga 1740gccattgaag cctgtgttat gtggctgcta gagaacgagt
tcatacagag taccgaagcc 1800tccgatggta cagaaggcaa agtgtaccat cctactcacc
tcggcagcgc aactttaagt 1860tcaagcttaa gtcctgctga taccctggat atctttgctg
acttgcagcg cgccatgaaa 1920ggctttgtac ttgaaaacga cttacacata ctgtacttgg
taactccgat gttcgaggac 1980tggactacca tcgactggta ccggttcttc tgtttatggg
agaaactacc taccagtatg 2040aaaagagttg cagagttggt aggcgtagag gaagggtttc
tagcacggtg tgtaaagggc 2100aaggttgtag cccgaacaga aaggcaacac aggcagatgg
caatacataa aagatttttc 2160accagtctgg tactgctcga cttgatctcc gaggtaccac
tacgcgagat taaccagaag 2220tatggctgca atcgaggtca aatacaaagc ctacagcaat
ctgcagccgt gtatgcaggc 2280atgataactg tattcagcaa caggcttggc tggcacaaca
tggagctgct gctgagccag 2340ttccaaaaaa ggctaacatt cggtatacaa cgtgagttat
gcgatttagt tagagtcagc 2400ctgctcaatg cacagagagc tcgggtgctg tatgcttccg
gctttcatac tgttgccgac 2460cttgctagag caaacatagt tgaagtggaa gtaatactta
agaacgccgt gcctttcaag 2520agtgctagaa aggcagttga cgaagaagaa gaggcagtcg
aagaaagaag aaacatgaga 2580acaatttggg taaccggcag gaaggggctt actgagcgtg
aagctgctgc attgatcgtg 2640gaagaagccc gcatgatact gcaacaggat ttagttgaaa
tgggagtaca gtggaacccg 2700tgtgccctac tacatagcag tacttgtagt ttaacacact
cagagtccga agttaaggag 2760catacattta tcagccaaac taaaagctca tacaagaaac
ttaccagtaa gaacaagagt 2820aatacaattt tctcagactc ctacattaaa cacagcccca
acattgtaca agaccttaat 2880aaaagtaggg agcataccag cagcttcaac tgtaactttc
agaacggcaa ccaggaacat 2940cagacatgca gtatattcag agctagaaag cgagcaagct
tagatattaa caaggagaaa 3000ccaggagcaa gccagaatga gggtaaaact tcagataaaa
aagttgtgca aacctttagc 3060cagaaaacta aaaaagctcc cctcaacttt aactccgaga
agatgtcccg aagctttcgt 3120agctggaaac gccgcaagca ccttaagaga agtagagaca
gtagcccact gaaagatagc 3180ggagcctgcc gaatacattt gcaagggcaa accttaagta
atcccagcct gtgcgaggat 3240ccctttacac ttgacgagaa aaaaaccgag ttcaggaatt
ctggtccttt tgcaaaaaat 3300gttagccttt caggcaaaga gaaggataac aaaacaagtt
ttcctttaca gatcaaacag 3360aactgcagct ggaacataac gctaacaaac gataactttg
ttgaacatat agttaccggt 3420tcacagagta agaatgttac ttgccaggct actagtgttg
taagcgagaa aggccgcggt 3480gttgctgtag aggcagaaaa gatcaatgag gtacttatac
aaaacggatc aaagaaccaa 3540aatgtttaca tgaagcacca cgatatacat ccaatcaacc
aatacttgcg caagcagagc 3600catgagcaaa ccagtactat taccaaacag aagaacataa
tcgagaggca aatgccctgc 3660gaggcagtaa gcagttacat caaccgtgac agtaatgtta
caataaactg tgagcgtata 3720aaacttaata ccgaagagaa caagccaagc cactttcagg
ctttgggcga tgacattagc 3780cgtacagtta tacctagtga agtactgcct tctgcaggag
ctttctctaa gtcagagggc 3840cagcatgaga acttcctcaa cataagccgg ttgcaggaga
aaaccggtac ctacactact 3900aacaaaacca aaaataacca cgtgtcagac ctcggtttgg
tactttgcga cttcgaggac 3960agcttctact tagatactca gtctgaaaaa atcatacaac
agatggcaac agaaaatgcc 4020aagctgggag ctaaagatac caacctagca gcgggtatca
tgcaaaagag tttggttcaa 4080caaaacagca tgaacagctt ccagaaggaa tgccatatac
catttcctgc agaacagcac 4140ccactaggtg caacaaaaat cgatcatctg gacctcaaaa
ctgttggtac aatgaaacag 4200agcagtgaca gccatggagt agatatactt acacctgaaa
gcccaatctt ccacagccca 4260atactactag aagaaaacgg gctgttcctc aaaaaaaatg
aagtcagtgt aactgatagc 4320cagttgaatt ccttcttgca ggggtaccaa acacaggaaa
ccgtgaaacc tgtaatacta 4380ctaatacctc aaaaaagaac acctaccggg gttgaaggcg
agtgcctgcc agtacctgag 4440acaagcctga acatgagcga tagcttgctg tttgatagct
tttctgatga ttacctggtg 4500aaggagcagt tgcccgacat gcagatgaag gaaccactgc
cctccgaagt aaccagtaac 4560cacttctccg atagcttgtg cctgcaggaa gacctgatca
agaagagtaa tgttaatgaa 4620aaccaggata cccatcaaca gcttacatgt tctaatgatg
aaagcataat atttagcgaa 4680atggactcgg tacagatggt tgaagcactg gataatgtgg
atatattccc ggttcaggag 4740aaaaaccaca ccgtagtatc acctcgtgca ctagagttgt
cagaccctgt actcgatgaa 4800catcaccagg gcgatcagga tggcggcgac caggacgagc
gtgcagaaaa gtcaaagcta 4860actggtacac ggcagaatca cagtttcatt tggtcaggag
caagctttga cttgtccccg 4920ggacttcaga gaatactgga caaagtaagc agccctttag
aaaatgagaa gttgaagagc 4980atgacaatta acttcagtag tttaaaccgc aaaaatacag
aactgaatga agagcaggaa 5040gttatcagta acttggaaac aaagcaagta caaggcatta
gctttagttc caacaatgag 5100gttaaaagca agatcgagat gcttgagaac aatgccaacc
atgatgaaac cagtagctta 5160ctgcctcgca aggaatcaaa cattgttgat gataacggct
tgataccgcc taccccaata 5220cccacctcgg caagcaagct tacttttcct ggtatactcg
aaaccccagt taatccatgg 5280aaaaccaata atgtactgca gcctggcgag tcttacttgt
tcggcagccc ttctgatata 5340aagaatcacg acctgagccc cggtagtagg aacggtttta
aagacaatag cccaatatcc 5400gataccagct tttctcttca actcagccaa gacgggctgc
agcttacccc tgccagcagt 5460agtagtgaga gtctgtctat catcgatgtt gcaagcgacc
agaacctgtt tcaaactttc 5520atcaaagagt ggagatgcaa gaaaaggttc agcattagtt
tagcatgtga aaaaatacgt 5580agccttacca gtagcaaaac tgcaacaatc ggtagtaggt
tcaaacaggc cagctcacca 5640caggagatac ctatcagaga cgacgggttt cctatcaaag
gttgcgatga tacccttgtt 5700gttggcttgg cagtttgttg gggaggtaga gatgcatatt
actttagcct gcagaaagag 5760caaaagcact ctgagatcag tgcaagtttg gttcccccaa
gccttgatcc aagtttaaca 5820ctgaaggatc gcatgtggta cctgcagagc tgccttcgaa
aggagtccga caaggagtgc 5880agtgtagtaa tctacgattt catccaaagt tacaagatcc
tgttgctctc ctgtggaatc 5940agtttggagc agagctacga ggatcctaaa gtagcttgtt
ggctgttgga tcctgacagc 6000caggaaccta ccctgcatag tatcgtaaca agtttcttgc
cgcacgaact accattacta 6060gagggcatgg aaacctccca gggtatacag tctctggggt
tgaacgctgg ttctgaacac 6120tccggtaggt acagggctag cgtagaaagc atattaatct
tcaattctat gaaccagttg 6180aacagcctgc tgcaaaagga gaacctacag gacgtgttta
gaaaggtgga gatgcccagc 6240cagtactgcc ttgcactatt ggaacttaac ggcattggct
tcagtactgc tgaatgcgaa 6300agccaaaagc acatcatgca ggcaaagctc gatgccattg
aaacacaggc atatcagcta 6360gctgggcata gctttagttt tacttcaagt gacgacattg
ctgaagtact gttccttgaa 6420ctgaagctac cacccaaccg cgagatgaaa aaccagggca
gtaaaaaaac actgggcagt 6480actcggaggg gaatagacaa cggcagaaag ctgaggctgg
gccgacagtt cagtaccagc 6540aaggatgtac tcaacaaact gaaggctctg cacccattac
cagggctgat acttgaatgg 6600aggcgaatta ccaatgctat tactaaggtt gtattcccat
tacaaaggga gaagtgcttg 6660aaccctttcc tgggcatgga gcgtatctat ccagtaagcc
agtcacatac cgcaacaggt 6720aggattacct ttaccgagcc caatatacaa aatgtaccac
gagacttcga aatcaaaatg 6780cctaccttgg taggcgagtc tccccctagc caggctgtgg
ggaaagggct gttgccaatg 6840ggtaggggca agtacaaaaa ggggttttct gtaaaccctc
gatgccaggc tcaaatggag 6900gagcgtgccg ctgatagagg tatgcccttt agcatcagca
tgaggcatgc atttgtacct 6960ttccctggtg gcagcatact ggctgcagat tacagccagc
tggagctccg catactggct 7020catctgagcc atgaccgccg gctgatacaa gtattaaaca
ccggagcaga cgtgtttcgc 7080agcatagctg ccgagtggaa aatgattgaa cccgagtcag
tgggggacga cctccgccaa 7140caggctaagc agatttgtta cggtatcata tacggtatgg
gagcaaagag cctgggcgaa 7200caaatgggca ttaaggaaaa cgatgctgct tgctacatag
atagttttaa gtcacgctac 7260actggtatta accagtttat gacagaaaca gttaagaatt
gcaagcggga tgggtttgta 7320caaaccatat taggtagaag aaggtactta cctggtatca
aagacaacaa tccttaccgt 7380aaagctcatg ccgaaagaca agctataaac acaatagtac
agggtagtgc agccgacata 7440gttaagattg caacagttaa catacagaaa cagttggaaa
cattccacag cacatttaag 7500agccatgggc accgggaagg tatgttgcag tcggatcaaa
ctggtcttag caggaagcgc 7560aagctgcaag gtatgttttg cccaatccga ggaggttttt
ttatactgca acttcatgat 7620gagctgctgt atgaagtcgc tgaagaagat gttgttcagg
tagctcaaat agttaaaaac 7680gaaatggaat cagcagtaaa gctatcagtt aagctgaagg
taaaagttaa aataggagca 7740agctggggag agctgaagga ttttgacgtg
7770324306PRTUnknownDescription of Unknown Uracil
DNA glycosylase sequence 324Met Ile Gly Gln Lys Thr Leu Tyr Ser Phe
Phe Ser Pro Thr Pro Thr1 5 10
15Gly Lys Arg Thr Thr Arg Ser Pro Glu Pro Val Pro Gly Ser Gly Val
20 25 30Ala Ala Glu Ile Gly Gly
Asp Ala Val Ala Ser Pro Ala Lys Lys Ala 35 40
45Arg Val Glu Gln Asn Glu Gln Gly Ser Pro Leu Ser Ala Glu
Gln Leu 50 55 60Val Arg Ile Gln Arg
Asn Lys Ala Ala Ala Leu Leu Arg Leu Ala Ala65 70
75 80Arg Asn Val Pro Ala Gly Phe Gly Glu Ser
Trp Lys Gln Gln Leu Cys 85 90
95Gly Glu Phe Gly Lys Pro Tyr Phe Val Lys Leu Met Gly Phe Val Ala
100 105 110Glu Glu Arg Asn His
His Lys Val Tyr Pro Pro Pro Glu Gln Val Phe 115
120 125Thr Trp Thr Gln Met Cys Asp Ile Arg Asp Val Lys
Val Val Ile Leu 130 135 140Gly Gln Asp
Pro Tyr His Gly Pro Asn Gln Ala His Gly Leu Cys Phe145
150 155 160Ser Val Gln Arg Pro Val Pro
Pro Pro Pro Ser Leu Glu Asn Ile Phe 165
170 175Lys Glu Leu Ser Thr Asp Ile Asp Gly Phe Val His
Pro Gly His Gly 180 185 190Asp
Leu Ser Gly Trp Ala Arg Gln Gly Val Leu Leu Leu Asn Ala Val 195
200 205Leu Thr Val Arg Ala His Gln Ala Asn
Ser His Lys Glu Arg Gly Trp 210 215
220Glu Gln Phe Thr Asp Ala Val Val Ser Trp Leu Asn Gln Asn Leu Ser225
230 235 240Gly Leu Val Phe
Leu Leu Trp Gly Ser Tyr Ala Gln Lys Lys Gly Ser 245
250 255Val Ile Asp Arg Lys Arg His His Val Leu
Gln Thr Ala His Pro Ser 260 265
270Pro Leu Ser Val His Arg Gly Phe Leu Gly Cys Arg His Phe Ser Lys
275 280 285Ala Asn Glu Leu Leu Gln Lys
Ser Gly Lys Lys Pro Ile Asn Trp Lys 290 295
300Glu Leu305325918DNAUnknownDescription of Unknown Uracil DNA
glycosylase sequence 325atgatcggtc agaaaactct atattctttc ttctctccaa
ccccaacagg caagcggaca 60actcgatcac ctgaaccagt gcctggtagc ggggtcgccg
cagaaattgg tggcgatgcc 120gtagctagtc cggccaagaa agcccgcgtc gagcagaatg
agcaggggag tcctttaagc 180gcggaacagt tagtgagaat tcagagaaat aaggccgccg
cactgctccg gctcgccgct 240cgaaacgttc ccgccggctt cggagagagc tggaaacagc
agttgtgcgg cgagttcggg 300aagccatact ttgtcaagct gatgggcttt gtcgctgagg
aaagaaacca ccataaagtg 360tacccaccac ctgaacaagt cttcacttgg acacagatgt
gtgacatccg agacgtgaag 420gtcgttattt taggtcagga cccgtaccac ggtcctaacc
aggcacacgg cttatgtttt 480agcgtccaga ggccagtgcc cccccctccc tctttagaaa
acatcttcaa ggaattatcc 540accgacattg atggctttgt gcatccgggc catggtgacc
ttagcggctg ggcccgacag 600ggtgtgctgc tcctcaatgc tgtgctgact gtcagggctc
accaagcaaa ttcccacaaa 660gagaggggct gggagcagtt tactgatgct gtcgtctcat
ggttaaacca gaatttgtca 720ggcctcgtgt tccttctttg ggggtcctac gcccagaaaa
aaggttcagt tatcgatcga 780aaacgacacc atgtattgca aacagcccac ccctccccgc
tgtccgtgca caggggtttc 840ttgggctgtc ggcatttctc taaagcaaac gaactcttac
agaagtccgg gaagaaacct 900atcaattgga aggaactg
918326918DNAArtificial SequenceDescription of
Artificial Sequence Synthetic construct 326atgatcgggc agaagaccct
ctattctttc ttctccccca cccccacggg gaagaggacg 60acccggtccc ccgagcccgt
ccccgggtct ggggtcgccg ccgagattgg gggggacgcc 120gtcgcctccc ccgccaagaa
agcccgggtc gagcagaatg agcaggggtc ccccctctcg 180gccgagcaac tcgtcagaat
tcagagaaat aaggccgccg ccctcctcag actcgccgcc 240cgtaatgtcc ccgccgggtt
tggggagagc tggaaacagc agctctgtgg ggagttcggg 300aagccctact ttgtcaagct
catggggttt gtcgccgagg agagaaacca ccataaagtc 360tatccccccc ccgagcaagt
cttcacttgg acccagatgt gtgacatccg agacgtcaaa 420gtcgtcatcc tcgggcagga
cccctatcat gggcccaatc aagcccacgg gctctgcttc 480tccgtccaga gacccgtccc
cccccccccc tccctcgaga acatctttaa agagctctct 540actgacatag acgggtttgt
ccaccccggg catggggacc tctcagggtg ggcccgacag 600ggggtcctcc tcctcaatgc
cgtcctcact gtcagagccc atcaagccaa ctctcataaa 660gagagggggt gggagcagtt
tacagacgcc gtcgtctcat ggctcaacca gaatctctca 720gggctcgtct ttctcctctg
ggggtcctac gcccagaaaa aggggagtgt catagacaga 780aagagacatc atgtcctcca
gaccgcccac ccctcccccc tctcagtcca cagggggttt 840ctcgggtgcc gtcacttctc
taaagccaac gagctcctcc agaagtcggg gaagaagccc 900attaattgga aggagctg
918327918DNAArtificial
SequenceDescription of Artificial Sequence Synthetic construct
327atgatagggc agaaaactct gtacagtttt ttcagcccaa ccccaaccgg caagagaaca
60acaagaagcc cagaacctgt acccggttct ggggttgcag ctgagatcgg gggcgatgca
120gtagcatctc cagctaaaaa ggctagggta gaacaaaacg aacagggcag ccctctgtct
180gcagaacaac tagtacggat acaaaggaac aaggctgcag ccctactgag gcttgctgct
240cgaaatgtac cggctgggtt cggggagagt tggaagcagc agctgtgtgg tgagttcggt
300aagccttact ttgtaaaact gatgggtttt gttgctgagg agcggaacca ccataaggtt
360tacccaccac ccgaacaggt gtttacatgg acccagatgt gcgatatcag agatgtaaag
420gttgtaatac ttgggcagga cccttaccat ggccctaacc aagcacatgg gctgtgtttt
480tcagtacaac ggccagtacc tccgccacca agccttgaaa acatattcaa agagctgagt
540accgatattg acgggtttgt acacccgggg cacggggatc tgagcggttg ggctcggcaa
600ggggtactac tgttaaatgc tgtacttaca gtaagagccc atcaagcaaa cagccataag
660gagagaggct gggagcagtt tacagatgca gtagttagct ggctgaacca gaaccttagc
720ggtttggtgt ttttgctgtg gggcagttat gcccagaaaa agggttcggt tattgaccga
780aaaaggcacc atgtactgca aacagctcat ccaagcccac tgagtgtaca caggggcttt
840ttgggctgcc ggcacttcag taaagctaat gaactactgc aaaaaagtgg taaaaagccc
900attaactgga aggagctc
9183282979DNAUnknownDescription of Unknown NisB sequence 328atgattaagt
catcatttaa agctcagcct ttcctcgtgc gaaataccat cctgtcccct 60aatgataaaa
ggtccttcac agagtacact caggtgatcg agacggtatc aaagaataag 120gtctttcttg
aacagctgct gctcgccaac cccaaattat acaacgttat gcagaagtat 180aatgctggct
tgctgaaaaa aaagcgcgtt aaaaaattgt tcgaatctat atacaagtat 240tacaagcgtt
cttacctgcg gagcaccccg tttggcttgt tttctgaaac ctcgatcggc 300gtattctcaa
agtcatctca gtataaactg atggggaaga ccaccaaagg tatccgcctg 360gacacccaat
ggctgatcag gctggtgcat aagatggagg tcgatttctc taaaaagcta 420agcttcacgc
gtaataatgc caactataaa ttcggcgaca gggtgtttca ggtctacacc 480atcaacagca
gcgagcttga ggaggtgaat atcaaataca ctaacgtgta tcagatcatt 540tcagagttct
gtgaaaatga ctaccagaaa tacgaagaca tttgcgaaac tgtgactctg 600tgctacgggg
acgaatacag agaactgtca gagcagtact taggctcgct gattgtgaac 660cattatctga
tctctaacct tcagaaagac ctgctttcag atttctcgtg ggacacattc 720ctcactaagg
tcgaggctat cgatgaggat aagaagtata taatccccct gaagaaggtg 780cagaaattca
ttcaggagta ctccgagatt gaaatcggcg aaggcattga aaaattgaag 840gagatttacc
aagaaatgtc tcagatttta gaaaacgata actatattca gatagacctg 900ataagcgatt
ccgaaatcaa ctttgacgta aagcaaaagc aacagctgga gcaccttgcc 960gaatttctcg
ggaacaccac caagtccgtg agaaggacct atcttgatga ttataaggac 1020aaatttatcg
aaaaatacgg tgtcgatcag gaagtccaga ttaccgagct ttttgatagt 1080actttcggca
ttggcgcgcc ttataattac aaccatcctc gcaatgactt ttacgagagt 1140gaaccttcta
ctctttacta ctccgaggaa gagagggaaa agtacctgtc catgtacgtg 1200gaagcagtga
aaaatcacaa tgtgattaat ttggatgatc tggagtctca ctatcagaag 1260atggacttag
agaaaaagag cgaattgcag ggtctggaac tgttcctaaa cctcgcaaag 1320gagtacgaga
aagatatttt tattctgggc gatatagtgg gcaataacaa cctgggcggc 1380gctagcggtc
gttttagcgc cctaagcccc gagctgacta gctatcacag aaccatcgtc 1440gactccgtgg
agagagagaa cgagaataag gagataacaa gctgcgaaat tgtgttcctg 1500cctgagaaca
ttaggcacgc caacgtgatg catacaagca tcatgcggcg gaaagtcctt 1560ccattcttca
cttccacctc acacaatgag gtgcagctaa ccaacatcta catcggcatc 1620gacgaaaagg
agaaatttta tgccagagac atctccaccc aagaagtgct gaagttttat 1680atcacctcta
tgtataacaa gacactattc agtaacgaac tcagatttct ttacgagata 1740tctttagacg
acaagttcgg aaatctaccc tgggagctga tatacagaga cttcgattac 1800attccacgcc
tggtgtttga tgagattgtg ataagcccag ccaagtggaa aatctggggg 1860cgagacgtga
acaataaaat gacgattcgg gagttgattc agtcaaagga aatacctaag 1920gaattttaca
ttgtgaatgg ggacaacaaa gtgtatttga gtcaggaaaa cccgctcgac 1980atggaaatcc
tggaaagtgc cattaagaag tcatctaaga gaaaggattt catcgaactg 2040caggagtact
ttgaggatga gaacatcatc aataagggtc agaaaggcag ggttgctgac 2100gtggtcgtgc
ccttcattcg aacacgagca ctgggcaacg aggggcgcgc ctttatcagg 2160gagaagcgtg
tgtcagtcga gcgccgcgag aaactgccct ttaatgagtg gctatatttg 2220aagttgtaca
tctctattaa taggcagaat gaatttttac tgagttacct tccagacata 2280cagaagattg
ttgccaacct gggcgggaag ttgttttttc tcagatatac agatccgaag 2340ccacatatac
ggctgcgcat caagtgctcc gatctctttc tggcctatgg atcaatactg 2400gaaatcctga
agaggtctca gaaaaatcgt atcatgtcta catttgatat ttccatttat 2460gaccaggagg
tcgaaagata cggtggcttc gacactcttg aactgtccga agctattttt 2520tgtgctgact
ccaaaattat acctaactta ttgactctga tcaaggacac aaataatgac 2580tggaaggtcg
acgatgtctc catactggtc aactaccttt atttgaagtg tttctttcaa 2640aacgacaaca
aaaaaatcct caattttctg aacctggtgt ctcccaagaa ggtcaaggag 2700aacgtaaacg
aaaagatcga gcactacctg aagttgctca aggtggataa tctgggagac 2760cagatctttt
atgacaaaaa cttcaaggaa ctgaagcatg caatcaagaa tctctttctc 2820aaaatgattg
cccaggattt tgagctccag aaagtgtatt cgatcattga cagtatcatc 2880cacgtgcata
ataaccgctt gataggcatc gaaagggata aggagaagct gatctattac 2940acgctccagc
gcctgtttgt ctctgaggag tacatgaag
29793292979DNAArtificial SequenceDescription of Artificial Sequence
Synthetic construct 329atgattaagt cctctttcaa agcccagccc ttcctcgtcc
gaaatactat tctctccccc 60aatgacaaga ggagcttcac agagtacact caagtcatcg
agacagtctc aaagaataag 120gtcttcctcg agcagctcct cctcgccaac cccaaactct
ataatgtcat gcagaagtat 180aatgccgggc tcctcaaaaa aaagagggtc aagaagctct
tcgagagcat atacaagtat 240tacaagaggt cttacctcag gtcgaccccc tttgggctct
tctccgagac gagcatcggg 300gtcttctcca agtcctccca atataaactc atggggaaga
ccaccaaggg gattagactc 360gacacccagt ggctcataag actcgtccat aaaatggagg
tcgacttctc taaaaagctc 420tcttttaccc gaaataatgc caactataaa tttggggaca
gggtctttca ggtctacacc 480atcaactcct ctgagctcga ggaggtcaat atcaaataca
ctaatgtcta tcagatcatc 540tctgagttct gtgagaatga ctaccagaaa tatgaggaca
tttgcgagac ggtcactctc 600tgttatgggg acgagtatag ggagctctct gagcaatatc
tcgggtctct cattgtcaat 660cactatctca tctctaacct ccagaaggac ctcctctctg
acttctcgtg ggacacattc 720ctcactaagg tcgaggccat cgacgaggac aaaaaatata
taatccccct caagaaggtc 780cagaagttca ttcaggagta ctccgagatt gagatagggg
aggggattga gaaactcaaa 840gagatttacc aggagatgtc tcagatcctc gagaatgaca
attatattca gatagacctc 900atctctgact cggagataaa ctttgacgtc aagcaaaagc
agcaactcga gcatctcgcc 960gagtttctcg ggaacaccac caagagtgtc aggaggacct
atctcgacga ctataaggac 1020aaattcatcg agaaatacgg ggtcgaccaa gaggtccaga
ttaccgagct ctttgactct 1080accttcggga ttggggcccc ctacaattac aaccaccccc
ggaatgactt ttacgagtct 1140gagccctcca ccctctacta ctccgaggag gagagggaga
aatacctctc catgtatgtc 1200gaggccgtca aaaatcacaa tgtcataaat ctcgacgacc
tcgagtctca ctatcagaag 1260atggacctcg agaaaaagag cgagctccag gggctcgagc
tcttcctcaa tctcgccaag 1320gagtacgaga aagacatttt catcctcggg gacatagtcg
ggaataataa cctcgggggg 1380gcctcgggga gattctctgc cctctccccc gagctcacct
cctatcacag gaccatagtc 1440gactcagtcg agagagagaa cgagaataag gagatcacct
catgcgagat agtcttcctc 1500cccgagaaca ttagacatgc caatgtcatg catacctcca
taatgagacg caaggtcctc 1560cccttcttta cctccacctc ccacaatgag gtccaactca
ccaacatcta catagggatc 1620gacgagaagg agaaatttta tgccagagac atctccaccc
aagaggtcct caagttttat 1680atcacctcta tgtataacaa gaccctcttc tccaatgagc
tcaggttcct ctacgagatc 1740tccctcgacg acaagttcgg gaatctcccc tgggagctca
tatacagaga ctttgactac 1800atccccagac tcgtctttga cgagattgtc atctcccccg
ccaagtggaa aatctggggg 1860agagacgtca acaataaaat gacgattcgg gagctcattc
agtcaaagga gatccccaag 1920gagttttata tagtcaatgg ggacaacaaa gtctatctct
cccaggagaa tcccctcgac 1980atggagatcc tcgagagtgc cattaagaag tcctcaaaga
gaaaagactt tatcgagctc 2040caagagtact ttgaggacga gaacatcatc aataaggggc
agaaggggag agtcgccgac 2100gtcgtcgtcc ccttcattcg gacgagggcc ctcgggaacg
aggggagggc cttcatcagg 2160gagaagaggg tctcagtcga gaggagagag aagctcccct
ttaatgagtg gctctacctc 2220aagctctaca tctctattaa tagacagaat gagtttctcc
tctcttatct ccccgacata 2280cagaaaattg tcgccaacct cggggggaaa ctcttttttc
tcagatatac agaccccaag 2340ccccacataa gactccgcat caagtgctcg gacctcttcc
tcgcctatgg gtctattctc 2400gagatcctca agaggtctca gaaaaatcgt atcatgtcta
cttttgacat ctccatatat 2460gaccaggagg tcgagagata cggggggttt gacaccctcg
agctctctga ggccattttc 2520tgtgccgact ccaaaatcat ccccaatctc ctcactctca
tcaaggacac aaataatgac 2580tggaaggtcg acgacgtctc cattctcgtc aattacctct
atctcaagtg tttctttcaa 2640aacgacaaca aaaaaatcct caattttctc aatctcgtct
cccccaagaa ggtcaaggag 2700aacgtcaacg agaagatcga gcactatctc aaactcctca
aggtcgacaa cctcggggac 2760caaatctttt atgacaaaaa cttcaaagag ctcaaacatg
ccatcaagaa tctctttctc 2820aaaatgattg cccaagactt tgagctccaa aaagtctatt
cgatcattga ctccataatc 2880cacgtccata ataaccgtct cattgggatt gagagggaca
aggagaagct catctattac 2940actctccaga gactctttgt ctctgaggag tacatgaag
29793302046DNAUnknownDescription of Unknown NisP
sequence 330atgaagaaga tcctcggatt tctattcatc gtgtgttctc tgggcctgtc
cgctaccgtg 60catggcgaaa caactaattc ccagcaactt ctgtccaaca acatcaacac
agagcttata 120aatcacaatt ctaatgcaat tctctccagt actgaggggt cgaccaccga
ctcaatcaat 180ctcggcgcac agagtcccgc tgtaaagtcc actacacgta cggagctcga
tgtaaccggg 240gccgcgaaga ctctcctcca gacatcagct gtgcagaagg aaatgaaagt
ctcgttacaa 300gagacccagg tgtccagtga attttccaag cgcgattcag tgaccaataa
agaggcagtt 360cccgtgagca aggatgaact gctggagcag tccgaggtgg ttgtgagtac
cagttctatc 420cagaaaaata agattctcga caacaagaag aaaagagcaa acttcgtcac
aagctcccca 480ctaatcaaag agaaaccaag caactctaaa gatgcctctg gggtcattga
caactctgcc 540agtcctcttt cgtataggaa ggctaaggag gtggtctccc ttcggcagcc
cctaaagaac 600cagaaagttg aagctcagcc tcttctgatc tcgaattctt cggaaaagaa
ggcctcagtg 660tacactaatt cccacgactt ttgggattac caatgggata tgaagtatgt
cactaacaac 720ggcgagagct atgccctgta ccaacccagt aagaaaatca gtgtggggat
aatcgattct 780ggtattatgg aggagcaccc cgacctgtct aactccttag gcaactattt
taagaacctg 840gtgcctaagg gtggatttga taacgaggag ccagacgaaa cgggtaatcc
cagcgatatc 900gtggacaaaa tgggccacgg gactgaagtt gctgggcaga tcaccgccaa
cggtaacatt 960ctgggtgtgg cccccggtat cactgtgaat atttatcgag ttttcgggga
aaacctcagc 1020aagagtgaat gggtcgcgcg tgcaatcagg agggcagcgg atgacggcaa
caaagtgatc 1080aatatctctg cggggcaata tctcatgatc tccggctcat acgacgacgg
cacgaatgac 1140tatcaggaat acctgaacta caagtctgcg atcaattatg ctacagccaa
gggatccatt 1200gtagtcgcgg cactgggcaa cgactcccta aacattcagg acaatcagac
gatgattaac 1260ttcctcaaac ggttcaggag tattaaggtc cccggtaaag tcgtcgatgc
cccctcagtg 1320ttcgaggacg tcattgccgt cgggggcatt gatggttatg gtaatataag
tgattttagt 1380aacatcggcg ctgacgcaat atacgcaccg gccggcacca ctgccaactt
caagaagtac 1440ggccaggaca aatttgtctc tcagggctac tacctaaagg actggctgtt
tacaaccgcc 1500aatactggct ggtatcaata cgtgtatggc aacagctttg cgactcctaa
agttagcggt 1560gccctcgcac ttgtcgttga caaatacggc attaagaatc ccaatcagct
taagcggttt 1620ctcctgatga acagtcctga agttaacggc aatcgcgttt taaatattgt
ggacctgctc 1680aatggtaaaa acaaggcctt cagcctcgac acggacaaag gacaggacga
tgctataaat 1740cataagtcta tggaaaacct taaggagtca agagatacca tgaaacagga
acaggacaaa 1800gagatacagc ggaataccaa taacaacttc agcataaaga acgacttcca
caatatcagc 1860aaagaggtta tcagtgtaga ctacaatatc aaccagaaaa tggccaataa
taggaacagc 1920cgcggtgctg tttctgtccg gtcccaggag atcctgccag tgaccggcga
cggcgaagac 1980ttcctgcctg ctctggggat cgtgtgcatc tccattctcg gtatcttgaa
aagaaagaca 2040aaaaac
20463312046DNAArtificial SequenceDescription of Artificial
Sequence Synthetic construct 331atgaagaaga ttctcgggtt tctctttatc
gtctgctccc tcgggctctc ggccactgtc 60catggggaga cgactaattc ccagcagctc
ctctcaaaca acatcaacac tgagctcata 120aatcacaatt ctaatgccat tctctcctct
acagaggggt cgacgacaga ctcaatcaat 180ctcggggccc agtcccccgc cgtcaagtcg
accacaagga ctgagctcga cgtcacgggg 240gccgccaaga ctctcctcca gacctctgcc
gtccaaaagg agatgaaagt ctctctccaa 300gagactcaag tctcctctga gttctccaag
agggactctg tcaccaataa ggaggccgtc 360cccgtctcaa aggacgagct cctcgagcag
tccgaggtcg tcgtctccac ctcctcaatc 420cagaaaaata agattctcga caacaagaag
aagagggcca acttcgtcac ctcctccccc 480ctcatcaaag agaagccctc aaactcaaag
gacgcctctg gggtcattga caactctgcc 540tcccccctct catataggaa ggccaaggag
gtcgtctctc tccgccagcc cctcaagaac 600caaaaagtcg aggcccagcc cctcctcatc
tcgaattcct ccgagaagaa ggcctcagtc 660tacaccaatt cccacgactt ttgggactat
cagtgggaca tgaagtatgt cactaacaac 720ggggagagct atgccctcta tcagccctcc
aaaaaaatct cagtcgggat aatcgactct 780gggataatgg aggagcaccc cgacctctct
aactctctcg ggaattattt taagaacctc 840gtccccaagg gggggtttga caacgaggag
cccgacgaga cagggaatcc ctccgacata 900gtcgacaaaa tggggcacgg gacagaggtc
gccgggcaga tcaccgccaa cgggaatatc 960ctcggggtcg cccccgggat tacagtcaat
atctatcgag tctttgggga gaatctctca 1020aagagtgagt gggtcgcccg ggccatcagg
agggccgccg acgacgggaa caaagtcatc 1080aatatctccg ccgggcaata tctcatgatc
tcggggtcat acgacgacgg gacaaatgac 1140tatcaggagt atctcaatta caagtcggcc
atcaattatg ccactgccaa ggggtccatt 1200gtcgtcgccg ccctcgggaa cgactctctc
aatattcagg acaatcagac gatgattaac 1260ttcctcaaga gatttaggag tattaaggtc
cccgggaaag tcgtcgacgc cccctctgtc 1320tttgaggacg tcattgccgt cggggggatt
gacgggtatg ggaatatctc agacttctca 1380aacattgggg ccgacgccat atacgccccc
gccgggacga cagccaactt caagaaatac 1440gggcaggaca aatttgtctc tcaggggtac
tatctcaagg actggctctt tacgacagcc 1500aatactgggt ggtatcaata cgtctatggg
aactcgtttg ccacccccaa ggtctcgggg 1560gccctcgccc tcgtcgtcga caaatacggg
ataaagaatc ccaatcagct caagagattt 1620ctcctcatga attcccccga ggtcaacggg
aatagagtcc tcaatattgt cgacctcctc 1680aacgggaaaa acaaggcctt ctctctcgac
acggacaagg ggcaagacga cgccataaat 1740cataagtcta tggagaatct caaggagtca
agggacacca tgaaacaaga gcaggacaaa 1800gagatacaga ggaacaccaa taacaacttc
tccatcaaga acgacttcca caatatctca 1860aaagaggtca tctctgtcga ctacaatatc
aaccagaaaa tggccaataa taggaactcc 1920cggggggccg tctctgtccg gtcccaggag
atcctccccg tcacagggga cggggaggac 1980ttcctccccg ccctcgggat cgtctgtatc
tccatactcg ggatcctcaa gagaaagaca 2040aaaaac
20463321800DNAUnknownDescription of
Unknown NisT sequence 332atggacgagg taaaagagtt tacgagcaag cagttcttct
atacactgct aacgctccca 60tcaactctga aactgatctt tcagctggaa aagaggtacg
ccatttatct gattgtgctt 120aacgctataa ccgccttcgt cccgctggca tccctcttta
tctatcagga cctgattaac 180agtgtgctgg gctctggtcg ccatcttata aatattatca
tcatatactt cattgtgcag 240gtgattacta ccgtgttggg ccagttagag tcctacgtat
cgggcaaatt tgacatgcgg 300ctcagctatt caatcaatat gcggcttatg aggacgacgt
ctagcctgga attatccgac 360tacgaacagg ctgatatgta caatatcata gagaaagtga
cccaggattc cacctacaag 420cctttccagt tattcaatgc catcattgtc gagttgtcat
catttatctc tttgctgtca 480agtcttttct tcataggcac gtggaacatt ggagtggcca
tcctgttgct gattgtccct 540gttttgtcac tagttctttt cctcagggtg gggcaactgg
aattcctcat tcagtggcaa 600agagcatcat cggagcgaga aacctggtac atcgtttacc
tgctgactca tgatttcagc 660ttcaaggaga tcaaactgaa taacatcagt aactatttta
tccacaagtt tggcaaactt 720aagaaagggt tcatcaacca ggatttggct atcgctcgga
agaagacata ttttaatatc 780tttcttgatt tcattttaaa cctaatcaat attctgacca
tcttcgccat gattctctct 840gttcgggcag gtaagcttct gattggcaat ctcgtgtctc
tcattcaggc catatcaaaa 900attaatacat attctcagac catgatccag aacatctaca
ttatctacaa cacctcattg 960tttatggagc aactgttcga gtttcttaag agagaatcag
tagttcataa gaagattgag 1020gacaccgaaa tttgcaatca gcacatcggc actgtgaagg
ttatcaacct gtcatatgta 1080tatcctaact ctaatgcctt cgcactcaaa aatatcaatc
tgagcttcga aaaaggggaa 1140ctgactgcca tcgtcggtaa aaatggctcc ggcaaatcta
cacttgtaaa aataattagc 1200ggcctgtatc agcccaccat gggcataatc cagtacgaca
agatgcgctc ctccctcatg 1260ccagaggaat tctatcagaa gaacatctcc gtcctgtttc
aggattttgt caaatacgaa 1320ctcactattc gggagaatat aggcctatcg gaccttagtt
cacagtggga ggatgagaag 1380ataatcaagg tactcgataa tctggggctc gactttttga
agaccaataa ccaatacgtc 1440ctggatacac agctgggaaa ctggttccag gaaggccacc
agctgagtgg cggtcagtgg 1500cagaagattg ctctcgccag gacatttttt aaaaaggcct
caatctacat tcttgacgag 1560ccaagcgctg ccctggaccc cgtggcggag aaagaaattt
ttgactattt tgtcgccctg 1620agcgagaaca acatctctat attcatctct catagcctga
atgctgctcg taaggccaac 1680aagatcgtcg tgatgaagga tggacaggtt gaggacgtcg
ggagccatga cgtgcttctt 1740agacggtgcc agtactatca ggagctgtat tacagcgagc
agtatgaaga taatgatgag 18003331800DNAArtificial SequenceDescription of
Artificial Sequence Synthetic construct 333atggacgagg tcaaagagtt
tacgagcaag cagttcttct atactctcct cactctcccc 60tcaactctca agctcatctt
ccagctcgag aagagatacg ccatttatct cattgtcctc 120aacgccatca ctgccttcgt
ccccctcgcc tctctcttta tctatcagga cctcattaac 180tctgtcctcg ggtcggggag
acatctcata aacattatca tcatatactt catagtccaa 240gtcattacta cagtcctcgg
gcagctcgag tcctatgtct ctgggaagtt tgacatgaga 300ctctcttact caatcaatat
gagactcatg aggacgacct cctccctcga gctctctgac 360tacgagcaag ccgacatgta
caatatcata gagaaggtca cccaagactc cacctataag 420cccttccagc tcttcaatgc
catcattgtc gagctctcct ctttcatctc tctcctctcc 480tccctcttct tcatcgggac
ttggaacata ggggtcgcca tcctcctcct catagtcccc 540gtcctctccc tcgtcctctt
cctcagagtc gggcagctcg agttcctcat tcagtggcag 600agggcctcgt ctgagagaga
gacctggtat atagtctatc tcctcactca tgacttctca 660ttcaaggaga tcaagctcaa
taatatctca aactatttta tccacaagtt tgggaaactc 720aagaaggggt tcatcaacca
ggacctcgcc atcgcccgga agaagacata ttttaatatc 780ttcctcgact tcatcctcaa
cctcataaac atcctcacca tcttcgccat gattctctct 840gtcagagccg ggaagctcct
catcgggaat ctcgtctctc tcattcaggc catctccaaa 900attaatacat attctcagac
catgatccag aacatctaca ttatctacaa cacctctctc 960tttatggagc aactcttcga
gttcctcaag agagagtcag tcgtccataa aaagattgag 1020gacactgaga tttgcaatca
gcacatcggg acagtcaaag tcatcaatct ctcatatgtc 1080taccccaact ctaatgcctt
cgccctcaaa aatataaatc tctcttttga gaagggggag 1140ctcactgcca tcgtcgggaa
aaacgggagt gggaagtcca ctctcgtcaa aataatctcg 1200gggctctatc agcccaccat
ggggatcatc cagtacgaca agatgaggtc ctccctcatg 1260cccgaggagt tctatcagaa
gaacatctcc gtcctcttcc aggacttcgt caaatatgag 1320ctcactattc gggagaatat
tgggctctcg gacctctcct ctcagtggga ggacgagaag 1380ataatcaagg tcctcgacaa
tctcgggctc gacttcctca agaccaataa ccaatacgtc 1440ctcgacaccc agctcgggaa
ctggtttcag gaggggcacc agctctctgg ggggcagtgg 1500cagaaaattg ccctcgccag
gacatttttt aaaaaggcct caatctacat tctcgacgag 1560ccctcagccg ccctcgaccc
cgtcgccgag aaagagatat tcgactattt tgtcgccctc 1620tcagagaaca acatctctat
attcatctct cactctctca atgccgcccg aaaggccaac 1680aagatcgtcg tcatgaaaga
cgggcaagtc gaggacgtcg ggagccatga cgtcctcctc 1740agacggtgcc agtactatca
ggagctctat tactccgagc agtatgagga caatgacgag
1800334171DNAUnknownDescription of Unknown NisA sequence 334atgtctacta
aagacttcaa cctggacctc gtgagtgtga gcaaaaagga ttccggggct 60agcccaagga
taacctccat ttctctgtgt acacctggat gcaaaactgg ggccctcatg 120gggtgtaata
tgaagacggc gacatgccat tgttccatcc acgtttccaa g
171335171DNAArtificial SequenceDescription of Artificial Sequence
Synthetic construct 335atgtctacta aagacttcaa tctcgacctc gtctcagtct
ccaaaaagga ctcgggggcc 60tcccccagaa taaccagcat aagcctgtgt acacctggct
gtaaaactgg ggctctcatg 120ggctgtaaca tgaagacagc cacatgccat tgtagtatac
atgtctccaa g 1713361254DNAUnknownDescription of Unknown NisC
sequence 336atgcgcatca tgatgaataa gaagaatatt aaaaggaatg tggaaaagat
tatcgctcag 60tgggacgaga ggactcggaa gaacaaagag aactttgact tcggggagct
gactctctct 120accggccttc ctggtattat cttaatgctg gcagagctga aaaataaaga
taacagtaag 180atttaccaaa agaagatcga taactatata gagtacattg tttcgaaact
gtcaacctac 240ggtctcttaa ccggcagtct ctattccggg gccgcgggca tagccttaag
cattctgcac 300ctgcgcgagg atgacgaaaa gtataaaaat ctcttagact ctctaaaccg
gtacatcgag 360tatttcgtga gggaaaagat tgagggcttt aatctggaga atatcacccc
ccccgattac 420gatgtcatcg agggcctcag cggtatcctt tcctacctgt tgctgataaa
tgatgaacag 480tatgatgatc tgaagatttt gatcatcaac ttcttgtcaa atttaactaa
agagaacaat 540ggtctcattt ctttgtacat caagagcgag aatcagatgt cccagtcaga
gtccgaaatg 600taccctcttg ggtgtctgaa catgggtctc gcccacggac tggccggagt
gggctgcata 660ctggcttacg cccatatcaa agggtacagt aatgaggcct ctctatccgc
actgcagaaa 720atcatcttta tttacgagaa gttcgagttg gagcgaaaaa aacagttcct
gtggaaagat 780ggcctggtgg ctgacgaact caaaaaggag aaggtcatca gggaggcctc
ttttattaga 840gacgcgtggt gctatggggg ccctggtatt tctctcctct acctatacgg
tgggttagcc 900ctggacaacg actactttgt tgataaagcc gagaaaatcc ttgaatcagc
catgcagcgc 960aaattgggaa tcgatagtta tatgatctgc catggataca gtggcctaat
cgagatatgc 1020agtctattta agcggctgct gaatacaaag aaattcgata gttacatgga
ggagttcaat 1080gtcaatagcg aacagatcct ggaagaatac ggggatgaga gtgggaccgg
attcctggag 1140ggcatctccg gctgtatcct ggtcttaagt aagttcgaat actccatcaa
ctttacatac 1200tggcggcagg ccttgctact tttcgacgat tttctcaagg gagggaagag
gaaa 12543371254DNAArtificial SequenceDescription of Artificial
Sequence Synthetic construct 337atgagaataa tgatgaataa gaagaatatt
aagaggaatg tcgagaagat tatcgcccag 60tgggacgaga ggactcggaa gaacaaagag
aactttgact tcggggagct cactctgagt 120accggtctcc ccgggattat cctcatgctc
gccgagctca agaataaaga caactcaaaa 180atttaccaaa agaagatcga caactatata
gagtacatcg tctctaagct ctctacctat 240gggctcctca cggggtcttt gtactcgggg
gccgccggga tagccctctc aatactccat 300ctccgagagg acgacgagaa atacaaaaat
ctcctcgact ctctcaaccg gtacatcgag 360tatttcgtca gggagaagat tgaggggttc
aatctcgaga atatcacccc ccccgactat 420gatgtaattg agggactctc agggatactc
tcatatctcc tcctcatcaa tgacgagcag 480tatgacgacc tcaagattct catcatcaac
tttctctcca atctcactaa agagaataat 540gggctcatct ccctctacat caagagcgag
aatcagatgt cccagtcaga gtctgagatg 600taccccctcg ggtgtctcaa tatggggctg
gctcatggtc tcgccggggt cgggtgcatc 660ctcgcctacg cccatataaa ggggtactcc
aacgaggcct ccctctcggc cctccagaag 720atcatcttta tttacgagaa gttcgagctc
gagagaaaaa aacagttcct ctggaaagat 780ggtttggtcg ccgacgagct caagaaggag
aaggtcatca gggaggcctc ttttattaga 840gatgcctggt gctatggggg gcccgggatc
tctctcctct acctctatgg ggggctcgcc 900ctcgacaacg actattttgt cgacaaggcc
gagaagatcc tcgagagcgc catgcagagg 960aaactgggta tagatagtta catgatttgc
catggttaca gtgggctcat agagatatgc 1020tccctcttca agagactcct caacacaaag
aaatttgact cgtacatgga ggagttcaat 1080gtcaattcgg agcagatcct cgaggagtac
ggggacgagt cggggacagg gtttctcgag 1140gggatctcgg ggtgcatcct cgtcctctcc
aagtttgagt actccatcaa ctttacatac 1200tggagacagg ccctcctcct cttcgacgac
ttcctcaagg gggggaagag gaaa 1254338235PRTMus musculus 338Met Asn
Lys Leu Leu Cys Cys Ala Leu Val Phe Leu Asp Ile Ser Ile1 5
10 15Lys Trp Thr Thr Gln Asp Ile Val
Leu Thr Gln Ser Pro Ala Thr Leu 20 25
30Ser Val Thr Pro Gly Asn Ser Val Ser Leu Ser Cys Arg Ala Ser
Gln 35 40 45Ser Ile Gly Asn Asn
Leu His Trp Tyr Gln Gln Lys Ser His Glu Ser 50 55
60Pro Arg Leu Leu Ile Lys Tyr Ala Ser Gln Ser Ile Ser Gly
Ile Pro65 70 75 80Ser
Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Ser Ile
85 90 95Asn Ser Val Glu Thr Glu Asp
Phe Gly Met Tyr Phe Cys Gln Gln Ser 100 105
110Asn Ser Trp Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu
Ile Lys 115 120 125Arg Ala Asp Ala
Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu 130
135 140Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe
Leu Asn Asn Phe145 150 155
160Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg
165 170 175Gln Asn Gly Val Leu
Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser 180
185 190Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys
Asp Glu Tyr Glu 195 200 205Arg His
Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser 210
215 220Pro Ile Val Lys Ser Phe Asn Arg Asn Glu
Cys225 230 23533924DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
339gtgggaggtc tatataagca gagc
243407PRTArtificial SequenceDescription of Artificial Sequence Synthetic
peptide 340Pro Lys Lys Lys Arg Lys Val1
5341597DNAArtificial SequenceDescription of Artificial Sequence Synthetic
construct 341atggactctc tcctcatgaa gcagagaaag tttctctacc acttcaagaa
cgtcagatgg 60gccaagggga gacatgagac ctatctctgt tacgtcgtca agaggagaga
ctcagccacc 120tctttctccc tcgactttgg gcatctccgg aacaagtctg ggtgtcatgt
cgaactcctc 180ttcctccgct atatctcaga ctgggacctc gaccccggga gatgctatag
agtcacttgg 240tttacctctt ggtccccctg ttatgactgc gccagacatg tcgccgactt
cctcaggggg 300tatcccaatc tctccctccg catattcgcc gcccgactct atttttgtga
ggacaggaaa 360gccgagcccg aggggctcag gagactccac cgggccgggg tccagatcgc
catcatgaca 420tttaaggact atttctattg ttggaataca tttgtcgaga atcgggagaa
gactttcaaa 480gcctgggagg ggctccatga gaactctgtc agactctcta ggcagctcag
gagaatcctc 540ctccccctct atgaggtcga cgacctcaga gatgccttcc ggaccctcgg
ggcttga 597342691DNAArtificial SequenceDescription of Artificial
Sequence Synthetic construct 342gagctcctaa ccaccatgga ctacaaagat
gacgatgata aaggtccaaa gaagaagaga 60aaggtagact ctctcctcat gaagcagaga
aagtttctct accacttcaa gaacgtcaga 120tgggccaagg ggagacatga gacctatctc
tgttacgtcg tcaagaggag agactcagcc 180acctctttct ccctcgactt tgggcatctc
cggaacaagt ctgggtgtca tgtcgaactc 240ctcttcctcc gctatatctc agactgggac
ctcgaccccg ggagatgcta tagagtcact 300tggtttacct cttggtcccc ctgttatgac
tgcgccagac atgtcgccga cttcctcagg 360gggtatccca atctctccct ccgcatattc
gccgcccgac tctatttttg tgaggacagg 420aaagccgagc ccgaggggct caggagactc
caccgggccg gggtccagat cgccatcatg 480acatttaagg actatttcta ttgttggaat
acatttgtcg agaatcggga gaagactttc 540aaagcctggg aggggctcca tgagaactct
gtcagactct ctaggcagct caggagaatc 600ctcctccccc tctatgaggt cgacgacctc
agagatgcct tccggaccct cggggcttga 660tgtacaatcc gcgtgagacg atcggcgcgc c
691343214PRTArtificial
SequenceDescription of Artificial Sequence Synthetic construct
343Met Asp Tyr Lys Asp Asp Asp Asp Lys Gly Pro Lys Lys Lys Arg Lys1
5 10 15Val Asp Ser Leu Leu Met
Lys Gln Arg Lys Phe Leu Tyr His Phe Lys 20 25
30Asn Val Arg Trp Ala Lys Gly Arg His Glu Thr Tyr Leu
Cys Tyr Val 35 40 45Val Lys Arg
Arg Asp Ser Ala Thr Ser Phe Ser Leu Asp Phe Gly His 50
55 60Leu Arg Asn Lys Ser Gly Cys His Val Glu Leu Leu
Phe Leu Arg Tyr65 70 75
80Ile Ser Asp Trp Asp Leu Asp Pro Gly Arg Cys Tyr Arg Val Thr Trp
85 90 95Phe Thr Ser Trp Ser Pro
Cys Tyr Asp Cys Ala Arg His Val Ala Asp 100
105 110Phe Leu Arg Gly Tyr Pro Asn Leu Ser Leu Arg Ile
Phe Ala Ala Arg 115 120 125Leu Tyr
Phe Cys Glu Asp Arg Lys Ala Glu Pro Glu Gly Leu Arg Arg 130
135 140Leu His Arg Ala Gly Val Gln Ile Ala Ile Met
Thr Phe Lys Asp Tyr145 150 155
160Phe Tyr Cys Trp Asn Thr Phe Val Glu Asn Arg Glu Lys Thr Phe Lys
165 170 175Ala Trp Glu Gly
Leu His Glu Asn Ser Val Arg Leu Ser Arg Gln Leu 180
185 190Arg Arg Ile Leu Leu Pro Leu Tyr Glu Val Asp
Asp Leu Arg Asp Ala 195 200 205Phe
Arg Thr Leu Gly Ala 210344618DNAArtificial SequenceDescription of
Artificial Sequence Synthetic construct 344gagctcctaa ccaccatgga
ctctctcctc atgaagcaga gaaagtttct ctaccacttc 60aagaacgtca gatgggccaa
ggggagacat gagacctatc tctgttacgt cgtcaagagg 120agagactcag ccacctcttt
ctccctcgac tttgggcatc tccggaacaa gtctgggtgt 180catgtcgaac tcctcttcct
ccgctatatc tcagactggg acctcgaccc cgggagatgc 240tatagagtca cttggtttac
ctcttggtcc ccctgttatg actgcgccag acatgtcgcc 300gacttcctca gggggtatcc
caatctctcc ctccgcatat tcgccgcccg actctatttt 360tgtgaggaca ggaaagccga
gcccgagggg ctcaggagac tccaccgggc cggggtccag 420atcgccatca tgacatttaa
ggactatttc tattgttgga atacatttgt cgagaatcgg 480gagaagactt tcaaagcctg
ggaggggctc catgagaact ctgtcagact ctctaggcag 540ctcaggagaa tcctcgcccc
cgcctatgag gtcgacgacg ccagagatgc cttccggacc 600gccggggctt gatgtaca
618345198PRTArtificial
SequenceDescription of Artificial Sequence Synthetic construct
345Met Asp Ser Leu Leu Met Lys Gln Arg Lys Phe Leu Tyr His Phe Lys1
5 10 15Asn Val Arg Trp Ala Lys
Gly Arg His Glu Thr Tyr Leu Cys Tyr Val 20 25
30Val Lys Arg Arg Asp Ser Ala Thr Ser Phe Ser Leu Asp
Phe Gly His 35 40 45Leu Arg Asn
Lys Ser Gly Cys His Val Glu Leu Leu Phe Leu Arg Tyr 50
55 60Ile Ser Asp Trp Asp Leu Asp Pro Gly Arg Cys Tyr
Arg Val Thr Trp65 70 75
80Phe Thr Ser Trp Ser Pro Cys Tyr Asp Cys Ala Arg His Val Ala Asp
85 90 95Phe Leu Arg Gly Tyr Pro
Asn Leu Ser Leu Arg Ile Phe Ala Ala Arg 100
105 110Leu Tyr Phe Cys Glu Asp Arg Lys Ala Glu Pro Glu
Gly Leu Arg Arg 115 120 125Leu His
Arg Ala Gly Val Gln Ile Ala Ile Met Thr Phe Lys Asp Tyr 130
135 140Phe Tyr Cys Trp Asn Thr Phe Val Glu Asn Arg
Glu Lys Thr Phe Lys145 150 155
160Ala Trp Glu Gly Leu His Glu Asn Ser Val Arg Leu Ser Arg Gln Leu
165 170 175Arg Arg Ile Leu
Ala Pro Ala Tyr Glu Val Asp Asp Ala Arg Asp Ala 180
185 190Phe Arg Thr Ala Gly Ala
195346666DNAArtificial SequenceDescription of Artificial Sequence
Synthetic construct 346gagctcctaa ccaccatgga ctacaaagat gacgatgata
aaggtccaaa gaagaagaga 60aaggtagact ctctcctcat gaagcagaga aagtttctct
accacttcaa gaacgtcaga 120tgggccaagg ggagacatga gacctatctc tgttacgtcg
tcaagaggag agactcagcc 180acctctttct ccctcgactt tgggcatctc cggaacaagt
ctgggtgtca tgtcgaactc 240ctcttcctcc gctatatctc agactgggac ctcgaccccg
ggagatgcta tagagtcact 300tggtttacct cttggtcccc ctgttatgac tgcgccagac
atgtcgccga cttcctcagg 360gggtatccca atctctccct ccgcatattc gccgcccgac
tctatttttg tgaggacagg 420aaagccgagc ccgaggggct caggagactc caccgggccg
gggtccagat cgccatcatg 480acatttaagg actatttcta ttgttggaat acatttgtcg
agaatcggga gaagactttc 540aaagcctggg aggggctcca tgagaactct gtcagactct
ctaggcagct caggagaatc 600ctcgcccccg cctatgaggt cgacgacgcc agagatgcct
tccggaccgc cggggcttga 660tgtaca
666347214PRTArtificial SequenceDescription of
Artificial Sequence Synthetic construct 347Met Asp Tyr Lys Asp Asp
Asp Asp Lys Gly Pro Lys Lys Lys Arg Lys1 5
10 15Val Asp Ser Leu Leu Met Lys Gln Arg Lys Phe Leu
Tyr His Phe Lys 20 25 30Asn
Val Arg Trp Ala Lys Gly Arg His Glu Thr Tyr Leu Cys Tyr Val 35
40 45Val Lys Arg Arg Asp Ser Ala Thr Ser
Phe Ser Leu Asp Phe Gly His 50 55
60Leu Arg Asn Lys Ser Gly Cys His Val Glu Leu Leu Phe Leu Arg Tyr65
70 75 80Ile Ser Asp Trp Asp
Leu Asp Pro Gly Arg Cys Tyr Arg Val Thr Trp 85
90 95Phe Thr Ser Trp Ser Pro Cys Tyr Asp Cys Ala
Arg His Val Ala Asp 100 105
110Phe Leu Arg Gly Tyr Pro Asn Leu Ser Leu Arg Ile Phe Ala Ala Arg
115 120 125Leu Tyr Phe Cys Glu Asp Arg
Lys Ala Glu Pro Glu Gly Leu Arg Arg 130 135
140Leu His Arg Ala Gly Val Gln Ile Ala Ile Met Thr Phe Lys Asp
Tyr145 150 155 160Phe Tyr
Cys Trp Asn Thr Phe Val Glu Asn Arg Glu Lys Thr Phe Lys
165 170 175Ala Trp Glu Gly Leu His Glu
Asn Ser Val Arg Leu Ser Arg Gln Leu 180 185
190Arg Arg Ile Leu Ala Pro Ala Tyr Glu Val Asp Asp Ala Arg
Asp Ala 195 200 205Phe Arg Thr Ala
Gly Ala 210348618DNAArtificial SequenceDescription of Artificial
Sequence Synthetic construct 348gagctcctaa ccaccatgga ctctctcctc
atgaagcaga gaaagtttct ctaccacttc 60aagaacgtca gatgggccaa ggggagacat
gagacctatc tctgttacgt cgtcaagagg 120agagactcag ccacctcttt ctccctcgac
tttgggcatc tccggaacaa gtctgggtgt 180catgtcgaac tcctcttcct ccgctatatc
tcagactggg acctcgaccc cgggagatgc 240tatagagtca cttggtttac ctcttggtcc
ccctgttatg actgcgccag acatgtcgcc 300gacttcctca gggggtatcc caatctctcc
ctccgcatat tcgccgcccg actctatttt 360tgtgaggaca ggaaagccga gcccgagggg
ctcaggagac tccaccgggc cggggtccag 420atcgccatca tgacatttaa ggactatttc
tattgttgga atacatttgt cgagaatcgg 480gagaagactt tcaaagcctg ggaggggctc
catgagaact ctgtcagact ctctaggcag 540ctcaggagaa tcctcctccc cctctatgag
gtcgaagaac tcagagaagc cttccggatc 600ctcggggctt gatgtaca
618349198PRTArtificial
SequenceDescription of Artificial Sequence Synthetic construct
349Met Asp Ser Leu Leu Met Lys Gln Arg Lys Phe Leu Tyr His Phe Lys1
5 10 15Asn Val Arg Trp Ala Lys
Gly Arg His Glu Thr Tyr Leu Cys Tyr Val 20 25
30Val Lys Arg Arg Asp Ser Ala Thr Ser Phe Ser Leu Asp
Phe Gly His 35 40 45Leu Arg Asn
Lys Ser Gly Cys His Val Glu Leu Leu Phe Leu Arg Tyr 50
55 60Ile Ser Asp Trp Asp Leu Asp Pro Gly Arg Cys Tyr
Arg Val Thr Trp65 70 75
80Phe Thr Ser Trp Ser Pro Cys Tyr Asp Cys Ala Arg His Val Ala Asp
85 90 95Phe Leu Arg Gly Tyr Pro
Asn Leu Ser Leu Arg Ile Phe Ala Ala Arg 100
105 110Leu Tyr Phe Cys Glu Asp Arg Lys Ala Glu Pro Glu
Gly Leu Arg Arg 115 120 125Leu His
Arg Ala Gly Val Gln Ile Ala Ile Met Thr Phe Lys Asp Tyr 130
135 140Phe Tyr Cys Trp Asn Thr Phe Val Glu Asn Arg
Glu Lys Thr Phe Lys145 150 155
160Ala Trp Glu Gly Leu His Glu Asn Ser Val Arg Leu Ser Arg Gln Leu
165 170 175Arg Arg Ile Leu
Leu Pro Leu Tyr Glu Val Glu Glu Leu Arg Glu Ala 180
185 190Phe Arg Ile Leu Gly Ala
195350666DNAArtificial SequenceDescription of Artificial Sequence
Synthetic construct 350gagctcctaa ccaccatgga ctacaaagat gacgatgata
aaggtccaaa gaagaagaga 60aaggtagact ctctcctcat gaagcagaga aagtttctct
accacttcaa gaacgtcaga 120tgggccaagg ggagacatga gacctatctc tgttacgtcg
tcaagaggag agactcagcc 180acctctttct ccctcgactt tgggcatctc cggaacaagt
ctgggtgtca tgtcgaactc 240ctcttcctcc gctatatctc agactgggac ctcgaccccg
ggagatgcta tagagtcact 300tggtttacct cttggtcccc ctgttatgac tgcgccagac
atgtcgccga cttcctcagg 360gggtatccca atctctccct ccgcatattc gccgcccgac
tctatttttg tgaggacagg 420aaagccgagc ccgaggggct caggagactc caccgggccg
gggtccagat cgccatcatg 480acatttaagg actatttcta ttgttggaat acatttgtcg
agaatcggga gaagactttc 540aaagcctggg aggggctcca tgagaactct gtcagactct
ctaggcagct caggagaatc 600ctcctccccc tctatgaggt cgaagaactc agagaagcct
tccggatcct cggggcttga 660tgtaca
666351214PRTArtificial SequenceDescription of
Artificial Sequence Synthetic construct 351Met Asp Tyr Lys Asp Asp
Asp Asp Lys Gly Pro Lys Lys Lys Arg Lys1 5
10 15Val Asp Ser Leu Leu Met Lys Gln Arg Lys Phe Leu
Tyr His Phe Lys 20 25 30Asn
Val Arg Trp Ala Lys Gly Arg His Glu Thr Tyr Leu Cys Tyr Val 35
40 45Val Lys Arg Arg Asp Ser Ala Thr Ser
Phe Ser Leu Asp Phe Gly His 50 55
60Leu Arg Asn Lys Ser Gly Cys His Val Glu Leu Leu Phe Leu Arg Tyr65
70 75 80Ile Ser Asp Trp Asp
Leu Asp Pro Gly Arg Cys Tyr Arg Val Thr Trp 85
90 95Phe Thr Ser Trp Ser Pro Cys Tyr Asp Cys Ala
Arg His Val Ala Asp 100 105
110Phe Leu Arg Gly Tyr Pro Asn Leu Ser Leu Arg Ile Phe Ala Ala Arg
115 120 125Leu Tyr Phe Cys Glu Asp Arg
Lys Ala Glu Pro Glu Gly Leu Arg Arg 130 135
140Leu His Arg Ala Gly Val Gln Ile Ala Ile Met Thr Phe Lys Asp
Tyr145 150 155 160Phe Tyr
Cys Trp Asn Thr Phe Val Glu Asn Arg Glu Lys Thr Phe Lys
165 170 175Ala Trp Glu Gly Leu His Glu
Asn Ser Val Arg Leu Ser Arg Gln Leu 180 185
190Arg Arg Ile Leu Leu Pro Leu Tyr Glu Val Glu Glu Leu Arg
Glu Ala 195 200 205Phe Arg Ile Leu
Gly Ala 21035245DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 352cagctcagga gaatcctcgc
ccccgcttat gaggtcgacg acctc 4535345DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
353gaggtcgtcg acctcataag cgggggcgag gattctcctg agctg
4535442DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 354ccgcttatga ggtcgacgac gccagagatg ccttccggac cg
4235543DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 355agggtccgga
aggcatctct ggcgtcgtcg acctcataag cgg
4335641DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 356ccagagatgc cttccggacc gccggggctt gatgtacaat c
4135741DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 357gattgtacat
caagccccgg cggtccggaa ggcatctctg g
4135855DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 358tcctccccct ctatgaggtc gaagaactca gagaagcctt
ccggaccctc ggggc 5535955DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 359gccccgaggg
tccggaaggc ttctctgagt tcttcgacct catagagggg gagga
5536043DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 360aactcagaga agccttccgg atcctcgggg cttgatgtac aat
4336143DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 361attgtacatc
aagccccgag gatccggaag gcttctctga gtt
4336224DNAArtificial SequenceDescription of Artificial Sequence Synthetic
primer 362gtgggaggtc tatataagca gagc
2436323DNAArtificial SequenceDescription of Artificial
Sequence Synthetic primer 363cagaggtgct cttggaggag ggt
2336424DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 364acacaacaga ggcagttcca gatt
2436522DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
365agtgtggcct tgttggcttg aa
2236616PRTArtificial SequenceDescription of Artificial Sequence Synthetic
peptide 366Lys Arg Pro Ala Ala Thr Lys Lys Ala Gly Gln Ala Lys Lys
Lys Lys1 5 10
1536720PRTArtificial SequenceDescription of Artificial Sequence Synthetic
peptide 367Ser Leu Ser Cys Arg Ala Ser Gln Ser Ile Gly Asp Asn Leu
His Trp1 5 10 15Tyr Gln
Gln Lys 2036820PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 368Ser Leu Ser Cys Arg Ala Ser Gln Ser
Ile Gly Asn Asn Leu His Trp1 5 10
15Tyr Gln Gln Lys 2036920PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 369Ser
Leu Ser Cys Arg Ala Ser Gln Ser Ile Gly Gly Asn Leu His Trp1
5 10 15Tyr Gln Gln Lys
2037020DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 370ccaaagtatt ggcgataacc
2037120DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 371ccaaagtatt
ggcaataacc
2037220DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 372ccaaagtatt ggcggtaacc
2037334PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 373Ile Xaa Ala Ile Xaa Leu Ala
Xaa Pro Gly Ala Lys Xaa Gly Ala Leu1 5 10
15Met Gly Ala Asn Met Lys Xaa Ala Xaa Ala Asn Ala Ser
Ile His Val 20 25 30Xaa
Lys37434PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 374Ile Xaa Ala Ile Xaa Leu Ala Xaa Pro Gly Ala Lys
Xaa Gly Ala Leu1 5 10
15Met Gly Xaa Asn Met Lys Xaa Ala Xaa Ala Asn Ala Ser Ile His Val
20 25 30Xaa Lys37534PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 375Ile
Xaa Xaa Ile Xaa Leu Cys Xaa Pro Gly Cys Lys Xaa Gly Ala Leu1
5 10 15Met Gly Cys Asn Met Lys Xaa
Ala Xaa Cys Asn Cys Ser Ile His Val 20 25
30Xaa Lys37634PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 376Ile Thr Ser Ile Ser Leu Cys
Thr Pro Gly Cys Lys Thr Gly Ala Leu1 5 10
15Met Gly Cys Asn Met Lys Thr Ala Thr Cys Asn Cys Ser
Ile His Val 20 25 30Ser
Lys37722DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 377gatcgtctca cgcggattgt ac
2237834PRTUnknown OrganismDescription of Unknown
Organism Teal Fluorescent Protein sequence 378Ala Phe Ala Tyr Gly
Asn Arg Ala Phe Thr Lys Tyr Pro Asp Asp Ile1 5
10 15Pro Asn Tyr Phe Lys Gln Ser Phe Pro Glu Gly
Tyr Ser Trp Glu Arg 20 25
30Thr Met379102DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 379gcctttryat atgrtrayag asytttyaca
aagtaycctg atgacatacc taaytacttc 60aarbagagct tccccrargg ttayagttgg
gagyrtacya tg 102380102DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
380gccttcgcct atgggaayag ggccttcacc aratatcccg acgacatccc caactacttt
60aracagtctt tccctgrggg rtactcctgg gagaggacta tg
1023815PRTArtificial SequenceDescription of Artificial Sequence Synthetic
peptide 381Lys Ile Pro Ile Lys1 538225DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
382caggtgnnnn nnnnnnnnnc aggtg
2538312DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 383ggcaacaacc ta
1238412DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 384ggagctaacc ta
1238512DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
385ggcggtaacc ta
1238612DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 386ggcagcaacc ta
1238712DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 387ggcaacagcc ta
1238812DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
388ggcaacggtc ta
1238912DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 389ggcagcagcc ta
1239012DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 390ggcaacaact ta
1239112DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
391ggcgataacc ta
12
User Contributions:
Comment about this patent or add new information about this topic: