Class / Patent application number | Description | Number of patent applications / Date published |
435402000 | Support is a coated or treated surface | 77 |
20080199959 | Method For Cell Culture - The present invention relates to a method for cell culture, more precisely small scale cell culture. In the present invention a screening tool is used which comprises particulate matter or microcarriers, such as beads, attached to a solid support, such as a microtiter plate, for the cultivation of cells on said microcarriers. The microcarriers are preferably cultivation beads, such as CYTODEX™. According to the invention, this small scale format for cell cultivation may be used for any testing involving cells, for example testing of optimal growth conditions for a specific type of cell, such as stem cells. Another use is cell expansion. | 08-21-2008 |
20080220525 | CULTURE SUBSTRATE PROVIDED WITH AN OXIDISED SILICONE COATING - Solid culture substrate comprising, on at least one of its surfaces, a coating made of a material chosen from the oxidised silicones, said coating comprising a nanostructuration and/or a surface nanoroughness, and a surface nanoporosity. | 09-11-2008 |
20080220526 | Gum coatings for cell culture, methods of manufacture and methods of use - This invention relates to coatings for cell culture surfaces. More particularly, this invention relates to coatings for cell culture surfaces which are derived from or contain gums including naturally occurring gums, plant gums, galactomannan gums or derivatives thereof. The invention also relates to articles of manufacture (e.g., cell culture vessels and labware) having such coatings, methods of applying these coatings to cell culture surfaces, and methods of using coated cell culture vessel. | 09-11-2008 |
20080227203 | CELL CULTURE SUPPORT AND MANUFACTURE THEREOF - An object of the present invention is to provide a cell culture support making the detachment of a cell sheet easy as well as enabling the formation of a uniform cell sheet. The present invention relates to a method for manufacturing a cell culture support having a temperature responsive polymer immobilized onto the surface thereof via covalent bonding, the method including a coating step in which a composition including a monomer that can form the polymer by polymerization by radiation irradiation, an organic solvent and, in some cases, a prepolymer formed by polymerization of the monomer is coated onto the substrate having a surface containing a material which can be covalently bonded to the temperature responsive polymer by radiation irradiation to form a film on the surface of the substrate, a radiation irradiation step in which a polymerization reaction and a binding reaction between the substrate surface and the temperature responsive polymer are allowed to proceed by irradiating radiation to the film, and a drying step to dry the film. | 09-18-2008 |
20080261307 | Method of isolating and proliferating autologous antigen-specific CD8+ T Cell using anti-4-1BB antibodies - Provided are methods of isolating and proliferating antigen-specific CD8+ T cells using anti-4-1BB antibodies. The methods of isolating and proliferating CD8+ T cells may yield cells at a higher recovery rate than a conventional isolation method, and the isolation method using humanized anti-4-1BB antibodies may also yield cells at a high recovery rate. Further, in cell culture, cells may be grown at a high proliferation rate. The antigen-specific CD8+ T cells yielded according to the isolation and proliferation methods may be used to treat cancer without any side-effects. | 10-23-2008 |
20090035859 | METHOD AND DEVICES FOR PREVENTING RESTENOSIS IN CARDIOVASCULAR STENTS - Described herein are devices and methods fabricating devices having nanostructures that allow adhesion or growth of one cell type, such as endothelial cells, more than another cell type, such as smooth muscle cells. In particular, stent covers having such nanostructures are described, and methods for fabricating these stent covers. Also described herein are methods for optimizing the nanostructures forming the devices. | 02-05-2009 |
20090042295 | Cell culture substrate and its production method - A cell culture substrate which is durable and which can be readily produced in commercial scale at a low cost, and its production method are provided. The cell culture substrate comprises a substrate and a layer formed by surface modification, which comprises a polymer containing amino group produced by reacting a polymer represented by the following formula (II): | 02-12-2009 |
20090111181 | APPARATUS FOR PREPARING A BIOCOMPATIBLE MATRIX - An apparatus and method of using the apparatus to prepare a biocompatible biodegradable matrix capable of supporting cells to form an implantable or engraftable surgical device. A matrix-forming fluid is contained within a chamber defined by top and bottom surfaces of a thermally conductive material and spacers defining the thickness of the matrix. The chamber is then cooled to freeze the solution at a controlled rate, resulting in a matrix with a desired and uniform thickness having symmetric and uniform reticulations. The apparatus and method reproducibly forms such a matrix, which may be populated with cells for transplantation and engraftment into a wound. | 04-30-2009 |
20090124010 | Peptide Fractions Promoting Growth and Synthesis of Desired Product (S) Into Cell and/or Tissue Culture - The invention relates to preparing and/or supplementing a cell or tissue culture medium. In particular, said invention relates to a serum-free and/or protein-free cell culture medium comprising peptide fractions isolated from rapeseeds, in particular rapeseeds cakes. A method for the production of a cell culture comprising said peptide fractions and for the use thereof is also disclosed. | 05-14-2009 |
20090137044 | SCHISTOSE MICROFIBRILLATED ARTICLE FOR CELL GROWTH - The present invention relates to culturing cells utilizing a matrix of microfibrillated thermoplastic polymeric materials. More specifically, the present invention relates to a method of culturing cells. In addition, the invention relates to a biaxially oriented microfibrillated article for culturing cells dispersed in a cell culture medium. The matrix of thermoplastic polymeric materials for culturing cells of this invention finds use in tissue engineering and wound healing applications. | 05-28-2009 |
20090191634 | (METH)ACRYLATE SURFACES FOR CELL CULTURE, METHODS OF MAKING AND USING THE SURFACES - A synthetic cell culture surface, prepared from a polymerized blend of at least two (meth)acrylate monomers is provided, which supports the growth of undifferentiated human embryonic stem cells in defined media augmented with fetal bovine serum. The cell culture surface forms a uniform layer over the growth area of a typical cell culture vessel. | 07-30-2009 |
20090239302 | Method for Constructing Functional Living Materials, Resulting Materials and Uses Thereof - The invention concerns a method for constructing a functional living biomaterial, characterized in that it consists in assembling layer by layer (3D) a matrix and 2D layers of functional living cells by controlling their interactions and 3D structuring based on the desired organization and final shape of the biomaterial, wherein each layer has its own pattern adapted to the neighbouring layers and on the functionality of whole synthetic biomaterials. The invention is useful in the field of biomedicine and nanobiotechnology. | 09-24-2009 |
20090239303 | Ultrasonic Machining Fabrication of Guided Tissue Generation Surfaces and Tissue Scaffolds - Ultrasonic machining is used to fabricate at least a portion of patterned surfaces that are used directly or indirectly for guided tissue generation. Tissues may be cultivated directly in the patterned surfaces or the patterned surfaces may be used as molds for polymer tissue scaffolds. | 09-24-2009 |
20090239304 | BIOACTIVE PEPTIDE FOR CELL ADHESION - Implantable devices for adhering eukaryotic cells and devices providing a substrate for eukaryotic cell growth and/or differentiation in vitro are described. Each device comprises a scaffold that is coated with a protein comprising an adhesive polypeptide that has at least 90% sequence identity to a specific peptide sequence within domain IV of perlecan. The devices adhere epithelial cells, epithelial stem cells, mesenchymal stem cells, and osteoblasts. | 09-24-2009 |
20090246874 | Method And Device For Culturing Neural Cells - A method and device are provided for culturing neural cells within a microfluidic device. A layer of predetermined material is deposited on a substrate and a cartridge is positioned on the substrate. The cartridge defines a first channel communicating with the predetermined material; a chamber communicating with the first channel and with the predetermined material; and a second channel communicating with the predetermined material and the chamber. At least one neural cell is deposited on the predetermined material communicating with the first channel. | 10-01-2009 |
20090305414 | Methods Of Tissue Engineering - An improved substrate for growing mono-layers of adherent-type cells and methods of growing tissue structures, ex vivo. The improved substrate, which comprises a silicon substrate coated with a photo cleavable polymer, releases adherent cells non-enzymatically. Also disclosed are methods for assembling complex layers of cells of various types. | 12-10-2009 |
20090305415 | Method for preserving proliferation and differentiation potential of undifferentiated cells - A method for preserving proliferation and differentiation potential of undifferentiated cells, has steps of providing a culture carrier having a surface coated with a biological material selected from the group consisting of polysaccharide, sulfated polysaccharide and derivatives thereof; and inoculating and culturing the undifferentiated cells on the surface in the culture carrier with an appropriate medium, such that the proliferation and differentiation potential of undifferentiated cells are preserved. The method can be used for expanding stem cells in vitro without loss of their replicative ability and differentiation capacity. Therefore, the method according to the present invention is amenable to application in regenerative medicine, tissue engineering, and therapy using umbilical cord blood and other cell sources such as peripheral blood, stem cells, tissue progenitor cells, and tissue cells. | 12-10-2009 |
20090305416 | Method for regulating proliferation of cells - A method for regulating proliferation of cells, has steps of providing a first culture system with a surface that is coated with a biological material; inoculating and culturing cells on the surface of the first culture system in an appropriate medium, such that the proliferation of the cells is preserved; collecting the cells; providing a second culture system with a surface; and inoculating and culturing the cells on the surface of the second culture system in a culture medium containing the biological material, such that the proliferation of the cells is promoted. A method for regulating proliferation of cells is also provided, the method being the same as the previous method except that the step of inoculating and culturing in a first culture system is performed before the step of inoculating and culturing in a second culture system. | 12-10-2009 |
20090305417 | CELL CULTURE - A cell culture surface comprising a substrate and a polymer comprising a carboxylic acid monomer, wherein the carboxylic acid concentration of the polymer is from | 12-10-2009 |
20100029001 | ROTATING TRANSFER FOR COMPLEX PATTERNING - A rotating transfer device for transfer of a film to a substrate at a gas-liquid interface, the rotating transfer device comprising a substrate holder holding the substrate, and a rotational positioning unit for rotating the substrate holder, the rotational positioning unit having a pivot to which the substrate holder is attached, whereby the pivot is angled between 0° and 60° to the plane of the interface surface. As a result, LB patterns with different dimensions and orientations that depend on the transfer velocity can be generated simultaneously. | 02-04-2010 |
20100075419 | BIOMATERIAL, METHOD OF CONSTRUCTING THE SAME AND USE THEREOF - The present provides a biomaterial composed in part of a porous material having an internal structure that has been completely controlled so as to optimize living tissue infiltration or cell introduction, a method of manufacturing, and uses thereof, including bio-implant materials for artificial bones, artificial joints and artificial tooth roots, and cell culture supports; the biomaterial undergoes increased infiltration by living tissues and the like owing to the formation of a porous region in at least a portion of the material, wherein the porous region is a porous body having therein a group of oriented pores that has an orientation and is made up of pores whose size, shape and direction have been controlled to optimize living tissue infiltration or cell introduction, and also having formed therein connecting pores that link together the primary pores and enable the passage of bodily fluids and gas bubbles, and formed with a spatial configuration in which the oriented pores are not directly connected to other oriented pores and the connecting pores which link together the oriented pores are not directly connected to other connecting pores. | 03-25-2010 |
20100099190 | CULTURED CELL CONSTRUCTION CONTAINING SPHEROIDS OF MESENCHYMAL STEM CELLS AND UTILIZATION THEREOF - Facing no ethical obstacle and easily to be isolated, multipotent concretely mesenchymal stem cells (MSCs) are one of the most powerful tools in reconstructive medicine. Here the inventors introduced 3D multicelluar spheroids culture construction based on photolithography and micropatterning techniques to improve multipotent differentiation efficiency of MSCs to adult cells. This invention, the 3D spheroid cultured construction for MSCs, leads to great improve of the differentiation efficiency. This invention relates to a cultured cell construct comprising a support; at least one island on the support; a hydrophilic and cytophobic substance applied on the surface of said support so as to encircle the island; and a spheroid which is derived from MSCs, said spheroid being in contact with the island. | 04-22-2010 |
20100129911 | Nanoparticulate Affinity Capture for Label Independent Detection System - A biosensor article including a substrate having nanoparticles on the substrate surface, the nanoparticle including:
| 05-27-2010 |
20100129912 | 3D Cell-Culture Article and Methods Thereof - An optically clear, porous polymer composition, an article incorporating the composition, and methods for making and using the composition for cell culture including, for example, regulating or promoting cell function or gene expression as defined herein. | 05-27-2010 |
20100216245 | FROZEN CELL IMMOBILIZED PRODUCT, PRIMARY HEPATOCYTE CULTURE TOOL, AND METHOD FOR PRODUCING PRIMARY HEPATOCYTE CULTURE TOOL - The present invention provides a frozen cell immobilized product which is obtained by applying a technique for freezing cultured cells to a technique for forming primary hepatocyte spheroids through co-culturing, and which can improve performance in an examination or a test using the technique for forming primary hepatocyte spheroids; a primary hepatocyte culture tool; and a method for producing the primary hepatocyte culture tool. According to the invention, a cell-adhesion region of a culture substrate is defined in a pattern; animal-derived adherent cells are cultured on the cell-adhesion region; and the cultured cells are frozen together with a freezing culture medium. | 08-26-2010 |
20100267143 | Method for Surface Modification of Polymeric Scaffold for Stem Cell Transplantation Using Decellularized Extracellular Matrix - The present invention relates to a method for the surface modification of a polymeric scaffold for stem cell transplantation using a decellularized extracellular matrix. The method for the surface modification of the polymeric scaffold according to the present invention can embody a biomimetic surface environment that is effective for initial cell attachment, cell growth and differentiation of stem cells by modifying the surface of the polymeric scaffold using the decellularized extracellular matrix directly derived from specific tissue cells. | 10-21-2010 |
20100273263 | CELL CULTURE VESSEL AND METHOD OF PRODUCTION THEREOF - Disclosed is a method of producing a cell culture vessel ( | 10-28-2010 |
20110027889 | Synthetic Microcarriers for Culturing Cells - A coated microcarrier for cell culture includes a microcarrier base and a polymeric coating grafted to the base via a polymerization initiator. A method for forming the coated microcarrier includes (i) conjugating a polymerization initiator to the microcarrier base to form an initiator-conjugated microcarrier base; (ii) contacting the initiator-conjugated microcarrier base with monomers; and (iii) activating the initiator to initiate polymerization and graft the polymer to the base. | 02-03-2011 |
20110039336 | PRODUCT FOR CELL CULTURE - The present invention relates to a product for cell culture. In particular, the invention relates to a cell growth surface having a coating comprising an animal protein free coating. The coating is derived from an enzymatic hydrolysate of a plant protein, preferably soy peptone. The cell culture product is preferably a microcarrier intended for culture of any anchorage-dependent cells. | 02-17-2011 |
20110053270 | Patterning Hydrogels - A method for forming a pattern-coated substrate includes disposing a composition comprising a polysaccharide-based polymer on a substrate to generate a coated substrate. The polysaccharide-based polymer composition is substantially free of cross-linking monomers. The method further includes exposing a portion of the coated substrate to a first dose of UV radiation to induce crosslinking of the polysaccharide-based polymer, wherein a portion of the substrate is shielded from the ionizing radiation. The UV exposed coated substrate may be washed or hydrated to remove uncross-linked polysaccharide-based polymer. | 03-03-2011 |
20110117651 | CELL ADHESION PROMOTING AGENT AND METHOD OF PROMOTING CELL ADHESION - The subject invention discloses an agent for promoting cell adhesion to a support, comprising a dispirotripiperazine derivative represented by Formula I below or a salt thereof; a method for promoting cell adhesion to a support comprising adding the dispirotripiperazine derivative represented by Formula I below or a salt thereof to a culture medium, or applying the same to a support; and an agonist of a heparin sulfate that comprises the dispirotripiperazine derivative represented by Formula I below or a salt thereof, and that promotes cell adhesion and/or cell growth. | 05-19-2011 |
20110129925 | ZEOLITE AND BONE MIMETIC ZEOLITE BASED COATINGS FOR BIOIMPLANTS - The disclosure provides biocompatible metal compositions, methods of making such compositions and uses thereof, including a method of synthesizing zeolite coatings. The disclosure further provides the zeolite-hydroxyapatite composite coatings and methods of making them, which includes forming a base zeolite layer, forming a hydroxyapatite layer on the base zeolite layer, and interlocking the hydroxyapatite layer with an outer zeolite layer. The composite can be formed on a metal substrate for bioimplants, such as titanium alloy and/or stainless steel, which is used for bioimplants. | 06-02-2011 |
20110136234 | CELL CULTURE SUBSTRATE AND ITS PRODUCTION METHOD - A cell culture substrate which is durable and which can be readily produced in commercial scale at a low cost, and its production method are provided. The cell culture substrate comprises a substrate and a layer formed by surface modification, which comprises a polymer containing amino group produced by reacting a polymer represented by the following formula (II): | 06-09-2011 |
20110143439 | METHOD FOR MANUFACTURING CELL CULTURE SUBSTRATE - A main object of the invention is to provide a new method for producing a cell culture substrate used to cause cells to adhere in a highly precise form onto a base material and then culture the cells. | 06-16-2011 |
20110207219 | MODIFIED SUBSTRATES FOR PROTECTION OF PEPTIDE-IMMOBILIZED SURFACES FROM GAMMA RADIATION DEGRADATION - In the present specification and claims, three modified cell culture substrates are disclosed for protecting peptide mimetic surfaces used in cell culture technology. The methods are able to retain the functionality of the bioactive species conjugated to the surface. In particular, a vitronectin peptide fragment Ac-Lys-Gly-Gly-Pro-Gln-Val-Thr-Arg-Gly-Asp-Val-Phe-Thr-Met-Pro-NH2 was able to facilitate growth and proliferation of undifferentiated human embryonic stem cells after stabilization using 3 different modified cell culture substrates for of protection against gamma irradiation. The modified substrates disclosed in this invention are (i) covalent attachment of the antioxidant molecules (via blocking step); (ii) The use of coatings consisting of anti-oxidants and stabilizers comprising glycoprotiens, sugars, carbohydrates, poly(amino acids), peptides and hydrophilic polymers; and (iii) a third method wherein the same methionine contained in the bioactive sequence used to facilitate growth and proliferation of human embryonic stem cells was also used as a sacrificial coating to protect the same conjugated sequence against damage by gamma irradiation. | 08-25-2011 |
20110207220 | CELL PATTERN RECOVERY TOOL - This invention provides a cell pattern recovery tool comprising a base material layer having a surface subjected to easy adhesion treatment, a temperature responsive polymer layer that is provided on the base material layer and has a surface subjected to silane treatment, and a cell adhesion inhibiting material layer provided on the temperature responsive polymer layer. According to the present invention, a cell pattern can be rapidly recovered while maintaining the cell pattern stably and reliably under minimally invasive conditions for the cells. | 08-25-2011 |
20110269232 | METHOD FOR CULTURING ANIMAL HEPATOCYTE - Provided are a technique for easily forming a spheroid by three-dimensionally culturing hepatocytes, and a technique for forming a spheroid having a higher expression level of a transporter MRP2 playing a role of biliary excretion than that of a conventional method. In order to solve the above-described problems, the present inventors have found out a condition under which hepatocytes easily form the spheroid on a nanopillar sheet. More specifically, this is related to a concentration of Type I collagen coated onto the NP sheet. Also, they have found out a condition under which an expression level of a gene related to the excretion of the formed spheroid is improved. More specifically, after the spheroid is previously formed, a biological matrix is overlayered thereon. | 11-03-2011 |
20110275154 | DERIVATIZED PEPTIDE-CONJUGATED (METH) ACRYLATE CELL CULTURE SURFACE AND METHODS OF MAKING - A synthetic cell culture surface, prepared from a mixture of at least three (meth)acrylate monomers where one of the monomers has an N-hydroxysuccinimide moiety is provided, which supports the growth of cells including undifferentiated human embryonic stem cells in defined media. Methods for preparing the cell culture surface is also provided. | 11-10-2011 |
20110306136 | LAMININ-ENTACTIN COMPLEX AND CELL CULTURE ARTICLE AND METHODS THEREOF - A cell culture system including: a substrate, a substrate coating, one or more live cells, and an overlay source. The substrate coating and overlay can be laminin, and laminin•entactin complex, respectively. Alternatively, the substrate coating and overlay can be laminin•entactin complex, and laminin, respectively. The cell culture system can further include liquid media and a protective cover. A method for making and using the system in cell culture articles and culture methods, as defined herein, is also disclosed. | 12-15-2011 |
20120122221 | CULTURE MEDIUM AND HYDROPHILIC COMPOSITE THEREOF - A hydrophilic composite includes a carbon nanotube structure and a protein layer. The carbon nanotube structure has at least one carbon nanotube film. The protein layer covers one surface of the carbon nanotube structure, and is coupled to the at least one carbon nanotube film. The carbon nanotube structure is disposed on a substrate. | 05-17-2012 |
20120122222 | NANOTOPOGRAPHIC COMPOSITIONS AND METHODS FOR CELLULAR ORGANIZATION IN TISSUE ENGINEERED STRUCTURES - The present invention relates to tissue engineered compositions and methods comprising nanotopographic surface topography (“nanotopography”) for use in modulating the organization and/or function of multiple cell types. | 05-17-2012 |
20120129258 | CELL CHIP AND METHOD OF FABRICATING THE SAME - Disclosed herein are a cell chip and a method of fabricating the same. The cell chip includes a cell-adhesivecell-adhesive layer disposed on a substrate. Photocrosslinked polymer barriers are disposed on the cell-adhesivecell-adhesive layer. The photocrosslinked polymer barriers may serve to restrict and grow cells only on the cell-adhesivecell-adhesive layer exposed between the barriers. Therefore, a cell growth direction may be precisely controlled. In addition, the photocrosslinked polymer barrier has a pattern formed by light, and simplifies a process of fabricating a cell chip. | 05-24-2012 |
20120129259 | METHOD FOR PRODUCING A COATED CELL CULTURE CARRIER - The present invention relates to a method for producing a coated cell culture carrier, wherein a solution comprising a polyurethane urea is applied to a cell carrier and dried. The polyurethane urea is produced beforehand by converting at least one polycarbonate polyol component, at least one polyisocyanate component, and at least one diamino component. The invention further relates to a cell culture carrier obtained according to the method and the use thereof for in-vitro cultivation of stem cells, particularly for cultivating mesenchymal stem cells. | 05-24-2012 |
20120135523 | PREPARATION AND USES OF POLYARYLATES - The present invention is directed to polyarylates comprising repeating units having the structure: | 05-31-2012 |
20120149112 | METHOD FOR MAKING NERVE GRAFT - A method for making a nerve graft includes the following steps. A culture layer including a lyophobic substrate, a carbon nanotube film structure, and a protein layer is provided. The carbon nanotube film structure is sandwiched between the lyophobic substrate and the protein layer. A number of nerve cells are seeded on a surface of the protein layer away from the lyophobic substrate. The nerve cells are cultured until a number of neurites branch from the nerve cells and are connected between the nerve cells. | 06-14-2012 |
20120149113 | METHOD FOR MAKING NERVE GRAFT - A method for making a nerve graft includes the following steps. A culture layer including a carbon nanotube film structure and a protein layer is provided. The protein layer is located on a surface of the carbon nanotube film structure. A number of nerve cells are seeded on a surface of the protein layer away from the carbon nanotube film structure. The nerve cells are cultured until a number of neurites branch from the nerve cells and are connected between the nerve cells. | 06-14-2012 |
20120149114 | Methods For Cell Culture Using A Synthetic, Defined Collagen Mimetic Surface - The present invention discloses methods for enhancing cell attachment, cell proliferation and cell function using a surface which mimics a collagen coated surface. Advantageously, such methods employ a xeno-free, synthetic, chemically defined surface. | 06-14-2012 |
20120156782 | CELL CULTURE MEDIUM - The present disclosure related to isolated laminin-521, methods for making recombinant laminin-521, host cells that express recombinant laminin-521, and compositions containing laminin-521. Laminin-521 can maintain stem cells in vitro pluripotency, enable self-renewal, and enable single cell survival of human embryonic stem cells. When pluripotent human embryonic stem cells are cultured on plates coated with recombinant laminin-521 (laminin-11), in the absence of differentiation inhibitors or feeder cells, the embryonic stem cells proliferate and maintain their pluripotency. It has also been discovered that human recombinant laminin-521 (laminin-11) provides single cell survival of stem cells after complete dissociation into a single cell suspension. Useful cell culture mediums containing at most 3.9 ng/ml of beta fibroblast growth factor (bFGF) are also described herein. | 06-21-2012 |
20120171769 | CELL ATTACHMENT COATINGS AND METHODS - Cell attachment coatings for articles such as implantable medical devices and cell culture vessels are disclosed. The coatings include an intermediate coater layer which includes a sulfonated component that is bonded in the coating by reacted aryl ketone functional groups. The coating also include a second coated layer including an immobilized ECM protein or peptide that includes an active portion of an ECM protein that is able to serve as an outer layer to contact cells during use. The coatings promoted enhanced cell binding and growth. | 07-05-2012 |
20120190114 | SILICON-INCORPORATED DIAMOND-LIKE CARBON FILM, FABRICATION METHOD THEREOF, AND ITS USE - A silicon-incorporated diamond-like carbon thin film, a fabrication method thereof, and its use are disclosed. The silicon-incorporated diamond-like carbon thin film comprises a chemical bond between carbon and silicon atoms present on a surface of the silicon-incorporated diamond-like carbon thin film comprising silicon incorporated within and on the surface thereof with an atom providing hydrophilicity to the surface of the thin film on the surface of the thin film. | 07-26-2012 |
20120196366 | METHOD FOR FORMING NERVE GRAFT - A method for forming a nerve graft includes the following steps. A carbon nanotube structure is provided. A hydrophilic layer is formed on a surface of the carbon nanotube structure. The hydrophilic layer is polarized to form a polar surface on the hydrophilic layer. A number of neurons are formed on the polar surface of the hydrophilic layer to form a nerve network. The neurons connect with each other. | 08-02-2012 |
20120225485 | METHODS FOR PRODUCING SYNTHETIC SURFACES THAT MIMIC COLLAGEN COATED SURFACES FOR CELL CULTURE - The present invention discloses methods for producing synthetic surfaces that mimic collagen coated surfaces for cell culture comprising: providing a monomer source comprising one or more organic compounds which are capable of polymerization, wherein at least one organic compound is prolinol; creating a plasma of said monomer source; and contacting at least a portion of a surface with the plasma to provide a plasma polymer coated surface. Advantageously, such methods provide an animal-free, synthetic, chemically defined surface that mimics a collagen coated surface for cell culture. Advantageously, such methods not only reduce the cost and/or issues associated with animal-derived collagen but are also amenable to large scale manufacturing. | 09-06-2012 |
20120270320 | CULTURE MEDIUM AND MANUFACTURING METHOD THEREOF - A culture medium for growing at least one kind of cells is provided. The culture medium includes a carbon nanotube structure and a cell adhesion layer. The cell adhesion layer covers one surface of the carbon nanotube structure. The at least one kind of cells grows on the cell adhesion layer. In addition, a method for manufacturing a culture medium for growing at least one kind of cells is also provided. | 10-25-2012 |
20120295353 | METHODS OF MAKING AND USING POLYMERS AND COMPOSITIONS - Disclosed are methods of making and using polymers compositions. The polymer compositions may have monomer/oligomer mixtures that may have at least one silicone monomer or oligomer and at least one non-silicone monomer or oligomer, at least one crosslinker, and/or at least one polymerization initiator. The polymer compositions are cured, after which they may be useful in bioapplications, such as for use as freestanding films or coatings on a substrate, such as a mold, for cell culture. | 11-22-2012 |
20130017607 | Nanotube carrier substrate for primary tissue cultureAANM Mayr; StefanAACI LeipzigAACO DEAAGP Mayr; Stefan Leipzig DEAANM Zink; MareikeAACI LeipzigAACO DEAAGP Zink; Mareike Leipzig DEAANM Dallacasagrande; ValentinaAACI LeipzigAACO DEAAGP Dallacasagrande; Valentina Leipzig DEAANM Kas; JosefAACI LeipzigAACO DEAAGP Kas; Josef Leipzig DEAANM Reichenbach; AndreasAACI LeipzigAACO DEAAGP Reichenbach; Andreas Leipzig DE - A carrier substrate for primary tissue culture has a nanotube array. A tissue culture vessel has an outer vessel and a nanotube carrier substrate with a nanotube array, located within the outer vessel, wherein the surface roughness of the nanotube array is 1 nm to 100 nm. The nanotube array is used for in vitro culturing of primary tissue in connection with a tissue culture vessel for in vitro culturing of primary tissue and a method for in vitro culturing primary tissue, wherein a nanotube array is arranged essentially horizontal inside an outer cell culture vessel, so that openings of the nanotubes point at least in upward direction, the nanotube array is contacted with cell culture medium and an isolated primary tissue sample is placed on top-side on said nanotube array. | 01-17-2013 |
20130029422 | Composite Substrate for 3D Cell Culture - A cell culture article comprises a substrate having a micro-structured surface and a thin hydrophobic elastomeric coating disposed on the substrate. The coating forms a micro-structured cell culture surface and is sufficiently thin to reduce absorption of hydrophobic molecules from an aqueous medium in contact with the coating, relative to articles fabricated entirely from the hydrophobic elastomer. | 01-31-2013 |
20130034903 | METHOD FOR CULTURING NEURAL CELLS USING CULTURE MEDIUM - A method for culturing neural cells using a culture medium is provided. Each neural cell includes a neural cell body and at least one neurite branched from the neural cell body. The culture medium includes a substrate and a carbon nanotube structure located on the substrate. A surface of the carbon nanotube structure is polarized to form a polar surface. The neural cells are cultured on the polar surface to grow neurites along the carbon nanotube wires. The carbon nanotube structure includes a number of carbon nanotube wires spaced apart from each other. A distance between adjacent carbon nanotube wires is greater than or equal to a diameter of the neural cell body. | 02-07-2013 |
20130203168 | TISSUE ENGINEERED BLOOD VESSEL - Compositions and methods of using tissue engineered blood vessels to repair and regenerate blood vessels of patients with vascular disease are disclosed. | 08-08-2013 |
20130217128 | METHOD OF MANUFACTURING A TISSUE-ENGINEERED PROSTHESIS - Developing heart valves are exposed to dynamic strains by applying a dynamic pressure difference over the leaflets. The flow is kept to a minimum, serving only as a perfusion system, supplying the developing tissue with fresh nutrients. Standard heart valves were engineered based on B trileaflet scaffolds seeded with cells isolated from the human saphenous vein. Tissue compaction is constrained by the stent, inducing increasing pre-strain in the tissue. The dynamic strains the tissues are exposed to via the dynamic pressure difference, are estimated using finite element methods based on the mechanical properties of the neo-tissue, in order to get inside into the strain distribution over the leaflet. | 08-22-2013 |
20130224861 | METHOD FOR MANUFACTURING CELL CULTURE SUBSTRATE - A method for manufacturing a cell culture substrate obtained by forming a coating layer of a polymer on the surface of a substrate, wherein the polymer is formed by polymerizing a monomer component containing a nitrogen atom-containing monomer represented by formula (I): | 08-29-2013 |
20130260466 | BONE GRAFT - The present invention relates to a novel bone graft and methods for producing said graft. Said bone graft can be used for surgical, plastic and/or cosmetic bone replacement for a patient in need thereof. The bone graft is made of a scaffold or matrix of sheet material having a 3-dimensional pattern of a continuous network of voids and/or indentations for enhancing new bone growth. | 10-03-2013 |
20130323841 | DYNAMICALLY ALTERABLE CELL SUPPORT - A dynamically alterable cell support may be altered at a large scale to induce mechanical removal of adherent cells in culture without the use of a removal solution. For example, adherent cells may be cultured on an elastic support with one or more textured surface regions and removed by expansion/contraction of the support. Mechanical removal of adherent cells may reduce or minimize damage to cell surface markers, cellular morphology, and/or cellular physiology associated with the detachment and resuspension of cultured adherent cells. | 12-05-2013 |
20130323842 | ARTIFICIAL TISSUE CONSTRUCT AND METHOD FOR PRODUCING THE SAME - An object of the present invention is to provide an artificial tissue construct that has means for transporting nutrients, oxygen, waste products, or the like and is viable in vivo. The present invention relates to a tissue construct formed in vitro, which comprises a vascular layer, a basal membrane layer, and a tissue-forming cell layer. | 12-05-2013 |
20140087467 | FERROMAGNETIC CELL AND TISSUE CULTURE MICROCARRIERS - A porous, collagen coated, ferromagnetic cell culture microcarrier, which is suitable for in vitro cell and tissue culture and which facilitates 3D multicellular construct generation. Also provided is a method for creating batches of microcarriers which have inserted within them magnetite (Fe3O4) in the presence of collagen, thus creating a microcarrier which becomes magnetic in nature when placed in a the presence of a magnetic field and which facilitates cellular adherence (via the collagen coating) for 3D construct development. | 03-27-2014 |
20140099718 | SINGLE-CRYSTAL APATITE NANOWIRES SHEATHED IN GRAPHITIC SHELLS AND SYNTHESIS METHOD THEREOF - Heterogeneous nanowires having a core-shell structure consisting of single-crystal apatite as the core and graphitic layers as the shell and a synthesis method thereof are provided. More specifically, provided is a method capable of producing large amounts of heterogeneous nanowires, composed of graphitic shells and apatite cores, in a reproducible manner, by preparing a substrate including an element corresponding to X of X | 04-10-2014 |
20140134734 | CELL CULTURE SYSTEM AND SERUM-FREE METHOD FOR CULTIVATING CELLS - The disclosure provides a cell culture system and a serum-free method for cultivating cells. The cell culture system includes a substratum, wherein the substratum has a surface. A polymer is disposed on the surface of the substratum, wherein the polymer is prepared by polymerizing a first monomer with a second monomer. The first monomer has a structure as represented by Formula (I), and the second monomer has a structure as represented by Formula (II): | 05-15-2014 |
20140287507 | Incorporation of Plant Virus Particles and Polymers as 2D and 3D Scaffolds to Manipulate Cellular Behaviors - Methods are generally disclosed for attaching a cell binding motif to a carboxy end of a coat protein of a Tobacco Mosaic Virus particle to form a modified-TMV particle; and attaching a cell to the cell binding motif of the modified-TMV particle. | 09-25-2014 |
20140329323 | THREE-DIMENSIONAL NANOSTRUCTURED HYBRID SCAFFOLD AND MANUFACTURE THEREOF - A method of making a three-dimensional biocompatible scaffold capable of supporting cell activities such as growth and differentiation, the method includes providing a supporting grid that forms an open network and provides mechanical support of a second biocompatible material. The second biocompatible material has interconnected cavities that allow nutrients, metabolites and soluble factors to diffuse throughout the scaffold. The scaffold design can be understood as a hierarchically organised structure. At the micron to submicron length scale a top/down manufacturing approach is used to make a structure that will constitute the frame into which a bottom/up processing approach is applied to form an open porous scaffold with specific nano sized features. The advantage of this hierarcially organised design is that benefits can be drawn independently from both the micron and the nano sized structures, promoting specific cell activities and providing sufficient mechanical compliance. | 11-06-2014 |
20140335617 | CONTROLLING SURFACE WETTABILITY OF ULTRAHIGH SURFACE AREA HIERARCHICAL SUPPORTS - The subject innovation is directed to hierarchical structures characterized by ultrahigh surface area and methods of fabricating the same, as well as attachment of functional species to these structures to alter interactions of these hierarchical structures with their environments, such as by making them permanently or reversibly hydrophilic. One such example hierarchical structure can include a solid substrate, an intermediate layer, at least one plurality of nanoscale attachments that are strongly bonded to the intermediate layer, and an oxygen containing species coating the at least one plurality of nanoscale attachments. | 11-13-2014 |
20140356955 | FERROMAGNETIC CELL AND TISSUE CULTURE MICROCARRIERS - A porous, collagen coated, ferromagnetic cell culture microcarrier, which is suitable for in vitro cell and tissue culture and which facilitates 3D multicellular construct generation. Also provided is a method for creating batches of microcarriers which have inserted within them magnetite (Fe3O4) in the presence of collagen, thus creating a microcarrier which becomes magnetic in nature when placed in a the presence of a magnetic field and which facilitates cellular adherence (via the collagen coating) for 3D construct development. | 12-04-2014 |
20150050737 | METHOD FOR CULTURING PLURIPOTENT STEM CELL, AND POLYPEPTIDE TO BE USED THEREFOR - A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues. | 02-19-2015 |
20150087063 | METHOD OF OBTAINING HIGH PURITY STEM CELLS FROM TISSUE - The present invention relates to a method of obtaining high purity stem cells from tissue, comprising: providing an impurity-containing cell mass obtained from a tissue; providing a filter device which comprises a cylinder structure, wherein the cylinder structure comprise an inlet and an outlet below and a content configured inside the cylinder structure between the inlet and the outlet; culturing the impurity-free cell mass on a polymeric film, wherein target stem cells of the impurity-free cell mass conjugate into a spheroid cell population; collecting the spheroid cell population from the polymeric film to obtain high purity target stem cells. According to the method of the present invention, stem cells can be rapidly and easily obtained from tissue. Only a small amount of tissue sample is required and the stem cells obtained can be readily used in clinical applications such as autotransplantation without the requirement of in vitro amplification. | 03-26-2015 |
20150093828 | CELL CULTURING ARTICLE AND METHOD FOR MANUFACTURING THEREOF - The disclosure provides a cell culturing article. The cell culturing article includes a substrate having a surface, a hydrophilic copolymer layer positioned on the surface of the substrate, and a plurality of peptide chains individually conjugated to a surface of the hydrophilic copolymer layer. The hydrophilic copolymer layer is copolymerized by a plurality of polyvinyl alcohol units, a plurality of polyvinyl alcohol derivative units, and a plurality of units containing at least one carboxyl group. A method for manufacturing the cell culturing article, a method for culturing undifferentiated stem cells and a method for regulating stem cell differentiation are also provided herein. | 04-02-2015 |
20150315542 | METHOD FOR PRESERVING PROLIFERATION AND DIFFERENTIATION POTENTIAL OF UNDIFFRENTIATED CELLS - A method for preserving proliferation and differentiation potential of undifferentiated cells, has steps of providing a culture carrier having a surface coated with a biological material selected from the group consisting of hyaluronan, chondroitin sulfate, carboxymethyl cellulose, carrageenan, alginate, and chitosan; and inoculating and culturing the undifferentiated cells on the surface in the culture carrier with an appropriate medium, such that the proliferation and differentiation potential of undifferentiated cells are preserved. The method can be used for expanding stem cells in vitro without loss of their replicative ability and differentiation capacity. Therefore, the method according to the present invention is amenable to application in regenerative medicine, tissue engineering, and therapy using umbilical cord blood and other cell sources such as peripheral blood, stem cells, tissue progenitor cells, and tissue cells. | 11-05-2015 |
20160115441 | NOVEL GRAFT POLYMER, TEMPERATURE-RESPONSIVE SUBSTRATE FOR CELL CULTURE USING THE SAME AND PRODUCTION METHOD THEREFOR, AS WELL AS LIQUID CHROMATOGRAPHIC CARRIER HAVING THE NOVEL GRAFT POLYMER IMMOBILIZED THEREON AND LIQUID CHROMATOGRAPHIC METHOD USING THE SAME - By using a graft polymer comprising a dendritic polymer with a styrene skeleton and a hydrophilic polymer grafted to a terminal thereof, a temperature-responsive substrate for cell culture having a temperature-responsive surface for cell culture that allows cells to be cultured with high efficiency and which yet allows cultured cells to be exfoliated in a short period of time and with high efficiency by simply changing the temperature of the substrate surface can be prepared conveniently. If this temperature-responsive substrate for cell culture is used, cells obtained from a variety of tissues can be cultured with high efficiency. If this culture method is utilized, cultured cells can be exfoliated intact in a short amount of time with high efficiency. In addition, by using this graft polymer, a wide range of peptides and proteins can also be separated by simply changing the temperature of a chromatographic carrier. This allows for convenient separation procedure and improves the efficiency of separating operations. What is more, the stereoregularity of the dendritic polymer per se may be utilized to enable separation of solutes based on differences in their molecular structures. | 04-28-2016 |
20160160165 | METHODS, APPARATUSES, AND SYSTEMS FOR CELL AND TISSUE CULTURE - This invention provides an apparatus and method for culturing cells to probe the influence that the properties of a surface onto which the cells are bonded has on the properties of the cell. | 06-09-2016 |
20160251613 | CULTURE METHOD FOR PLURIPOTENT STEM CELLS, CULTURE KIT, AND MEDIUM FOR PLURIPOTENT STEM CELL CULTURE | 09-01-2016 |